Search Results

Search found 21235 results on 850 pages for 'no www'.

Page 536/850 | < Previous Page | 532 533 534 535 536 537 538 539 540 541 542 543  | Next Page >

  • Audio not working in 12.10

    - by frampy
    I did a clean install of 12.10, when I open Sound Settings in gnome the only device in the list is "Dummy Output", and sound is not working. Sound worked fine out of the box in 12.04 I ran alsamixer, it says my card is "HDA Intel", and chip is "Realtek ALC880". The alsamixer playback output was set to mute at first, unmuting did not fix. I checked out the info at http://www.unixmen.com/2012003-howto-resolve-nosound-problem-on-ubuntu/ as suggested on a similar question, I've done everything there except installing the ubuntu audio dev team driver. Should I try install this? Edit: I've been reading the sound troubleshooting guide at https://help.ubuntu.com/community/SoundTroubleshooting It looks like Ubuntu is finding my audio device correctly. mike@wucade:~$ lspci -v | grep -A7 -i "audio" 00:1b.0 Audio device: Intel Corporation 82801FB/FBM/FR/FW/FRW (ICH6 Family) High Definition Audio Controller (rev 03) Subsystem: Albatron Corp. Device 2668 Flags: bus master, fast devsel, latency 0, IRQ 40 Memory at d01c0000 (64-bit, non-prefetchable) [size=16K] Capabilities: Kernel driver in use: snd_hda_intel Kernel modules: snd-hda-intel Still stuck as to why this isn't working.

    Read the article

  • Convert collections of enums to collection of strings and vice versa

    - by Michael Freidgeim
    Recently I needed to convert collections of  strings, that represent enum names, to collection of enums, and opposite,  to convert collections of   enums  to collection of  strings. I didn’t find standard LINQ extensions.However, in our big collection of helper extensions I found what I needed - just with different names: /// <summary> /// Safe conversion, ignore any unexpected strings/// Consider to name as Convert extension /// </summary> /// <typeparam name="EnumType"></typeparam> /// <param name="stringsList"></param> /// <returns></returns> public static List<EnumType> StringsListAsEnumList<EnumType>(this List<string> stringsList) where EnumType : struct, IComparable, IConvertible, IFormattable     { List<EnumType> enumsList = new List<EnumType>(); foreach (string sProvider in stringsList)     {     EnumType provider;     if (EnumHelper.TryParse<EnumType>(sProvider, out provider))     {     enumsList.Add(provider);     }     }     return enumsList;     }/// <summary> /// Convert each element of collection to string /// </summary> /// <typeparam name="T"></typeparam> /// <param name="objects"></param> /// <returns></returns> public static IEnumerable<string> ToStrings<T>(this IEnumerable<T> objects) {//from http://www.c-sharpcorner.com/Blogs/997/using-linq-to-convert-an-array-from-one-type-to-another.aspx return objects.Select(en => en.ToString()); }

    Read the article

  • How can i compare Audio, what programming language should i use

    - by Pimmetje
    I have 2 audio files that are from almost the same source. But at some points there shifted a bit. Also the codecs does not match. I would like to make a program that takes a sample 2 - 4 seconds. And looks for it in the other file. (Most of the time it's not shifted more than 30 seconds). Than take the time and store it, Go ahead for a few seconds take a sample and find it again. This way i want to create a file where i can see on what points the file is shifted. For people who are more interested in what i want. I have a audio/video file speech and subtitles. But i have same speech from different sources with differs a bit in time. And i like to make a program that can correct the subtitle time for me. Enough about the problem I looked on the Internet for ways to compare audio files. Based on what i read comparing 2 audio files isn't that easy as i had hoped. Some talk about algorithms http://www.perlmonks.org/?node_id=169641 Some audio-library's portaudio.com aubio.org sourceforge.net/projects/ccaudio/ ambiera.com/irrklang/ The biggest problem i have is that i can't find something i can generate from the audio that i can use to compare with. I hope someone here can point me in the right direction.

    Read the article

  • VPN Authentication Credentials (Local/Remote Identifiers) For Remote Access VPN

    - by thatidiotguy
    So I am trying to set up a remote access VPN using the free ShrewSoft vpn client: https://www.shrew.net/software I want to use a PSK as the authentication mechanism combined with XAuth so that a connection requires a valid username/pass combo. Under the authentication tab this particular VPN Client however is asking for a Local Identity and a Remote Identity. The options for Local Identity Type are: Fully Qualified Domain Name User Fully Qualified Domain Name IP Address Key Identifier The options for Remote Identity are: Any Fully Qualified Domain Name User Fully Qualified Domain Name IP Address Key Identifier My current thinking is that I can use the Fully Qualifed Domain Name provided by the remote firewall for the Remote Identity, but I do not know what it wants for local identity. Just to stress: I am not trying to set up a site to site VPN. Can anybody shed any light on what I am missing here? A screenshot can be provided if that would be helpful. The current error I am getting during the connection is: IKE Responder: Proposed IKE ID mismatch

    Read the article

  • Send request body data when running siege

    - by qui
    I am trying to use the command line utility Siege to load test a service. The service recieves json in the request body via a POST. I have a file called example-data.json with the json inside. I will eventually turn this into a tiny service which creates random json for testing, but this should do for now I have another file called hit-qa.siege with http://www.qa-url.com POST < example-data.json and i try and run siege -c10 -d1 -r1 -f ops/perf/hammer-dev.siege When I check the logs of the service, it is not recieving anything in the request body. My googles have been fruitless, does anyone know how to accomplish this?

    Read the article

  • Artificial Intelligence ... how to make an object roam freely/avoid other objects, and model consciousness? [on hold]

    - by help bonafide pigeons
    Say a simple free roam battle scene in which a player runs around freely and engages in battle with other enemies/objects, as shown below: The dragon/dinosaur (or whatever that thing I drew appears to be) will, by some measure, try and avoid attacks so it is modeled to appear to have a conscious desire to avoid pain. My question is ... since this is very complex, many possible strategies for solving this, algorithms, etc., what is the basic idea behind how this would be accomplished in any sort? Like, we can assume the enemy in the picture is not just going to aimlessly hop around and avoid, but freely be modeled to behave as if it were really exploring/fighting. For the best example I can give, witness the behavior of the enemies in Final Fantasy 12 in this video: http://www.youtube.com/watch?v=mO0TkmhiQ6w How do the pros, or how would anyone attempt solve/implement this? PS: I have tried several times to give an image the "illusion" that is has a conciousness, but aside from emulating a real animal's consciousness in complete, I fall short and get choppy moving images that follow predictable patterns, error-prone movements, and the worst imaginable scenario of a battle engagement.

    Read the article

  • Which metric/list should be used to evaluate whole software development team?

    - by adt
    Title might be seem vague, so let me tell you a little bit history what i am trying to clarify question. I have been hired as a consultant for a corporate's small developement divison ( The company also owns a couple of software dev. companies) My ex manager runs a BI team, with reportes, analyts and developers. He asked me to evaluate overall design, software developement process and code quality . Here what i found, Lots of copy/paste code everywhere ( no reuse ) Even though they have everything TFS, VS Ultimate etc, No Build process , No Cruise Control.net / team city... No unit tests Web Pages with 3700 lines of code, Lots of huge functions ( which can be divided into smaller one's ) No naming convention both db and c# code No 3r party or open source project No IoC No Seperation Of Concerns No Code Quality Check ( NDepend or FxCope or nothing ) No Code Review No Communication within the team They claim they wrote an application framework ( 6 months 3 persons), but I would hardly call a framework ( of course no unit test, there are some but all commented out). Framework contains 14 projects but there are some projects with 1 file 20 lines of code . Honestly, what people are doing fixing bug all thr day( which will provide more bugs eventually), they are kind of isolated from community, some team members even dont know github or stackoverflow they probably went there with google but they dont know about it. So here is question, Is This list ok ? Or am i being picky? Since I dont have any grudge against them, I just want to be fair, honest and I would like to hear you suggestions, before I would submit this list. And since this list also will be review by software division's manager, I dont want any heart break or something like this. http://www.hanselman.com/altnetgeekcode/ For example I would love to such lists, i cant make references. Thanks in advance.

    Read the article

  • Form development optimization

    - by Juan
    Like many web developers I do forms all the time. I found myself doing the same all the time: placing input fields, assigning a name to each, ajax the form, then create the PHP which involves to assign a PHP var to each $_REQUEST['var'], escape and validate data, build the html and emailing the results. So I found that 70% of the work is duplicated but I just can't duplicate a page and change the fields. I end up wasting more time reformatting, deleting and adding different fields than creating from scratch. I started planing to program a "list of IDs to html+php" converter in which I'd input all the IDs and this would output the basic html and php. Then I thought: there's got to be thousands of developers that go through this, I'd be reinventing the wheel. So this is my question, I'm trying to find that wheel that somebody must have invented already. I found this: http://www.trirand.com/blog/jqform/ which does more or less what I'm looking for but it's an expensive solution and it has too much functionality for what I'd be using it. Which tools do you use to optimize repetitive task about HTML and PHP?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How to write to Samba folder?

    - by Darren
    I created a Samba share on my CentOS machine and I can connect to the share and read the contents but I cannot write files to it or delete them. In Samba I have set readable to yes and writeable to yes, as well as made the folder I want to access apart of the wheel group of which I added the user that is accessing it from Samba. The folder in quesiton is /var/www/. I have set that folder and all folders under it to the wheel group which can read and write to it. What am I doing wrong here?

    Read the article

  • Redirecting HTTP traffic from a local server on the web

    - by MrJackV
    Here is the situation: I have a webserver (let's call it C1) that is running an apache/php server and it is port forwarded so that I can access it anywhere. However there is another computer within the webserver LAN that has a apache server too (let's call it C2). I cannot change the port forwarding nor I can change the apache server (a.k.a. install custom modules). My question is: is there a way to access C2 within a directory of C1? (e.g. going to www.website.org/random_dir will allow me to browse the root of C2 apache server.) I am trying to change as little as possible of the config/other (e.g. activating modules etc.) Is there a possible solution? Thanks in advance.

    Read the article

  • who can tell me the rules of extra 100% bonus for swtor credits in swtor2credits?

    - by user46860
    During Father's Day, you can buy swtor credits with 50% OFF! swtor2credits.com offer swtor players with extra 100% bonus for swtor credits, when you spend the same money as before, you can get double swtor credits! Rules for extra 100% bonus for swtor credits. 1. From June 16 to June 18, 2014, 02:00-03:00 a.m. GMT, is the ONLY valid time for getting double swtor credits at swtor2credits. 2. The total sum of your order is valued $10 at most. Beyond this money, please apply discount code you know to save extra money. 3. Everyone has only one chance to get double swtor credits at swtor2credits during our promotion. 4. As long as your order has used extra discount code or voucher, you lose the chance to get exclusive 100% bonus. Please read these activities rules carefully, and don't miss the time! Like Swtor2credits Facebook to Gain Free Cash Coupon, Up to $16 Giveaways for Swtor Credits! 1. Share our facebook posts in your timeline. 2. Leave your preciously constructive suggestion on our facebook page. 3. Share your amazing swtor gaming screenshots on our page. Time: May 29, 2014 to June 12.2014.GMT. https://www.facebook.com/pages/swtor2creditscom/493389160685307 Cheap swtor credits in swtor2credits.com.

    Read the article

  • VMWare hypervisor with only 1 network card?

    - by Rafiq Maniar
    VMWare hypervisor minimum requirements states that the minimum network requirements is: one NIC, plus one for Management interface (source: http://www.vmware.com/products/datacenter-virtualization/vsphere-hypervisor/requirements.html) It used to be possible to use 1 NIC only. Is anybody using the new versions of VMWare in this configuration? I ask because my colo provider will only provide me with 1 uplink (my server does have 2 NICs). I need to be able to run the VMs and also have remote management using only 1 NIC. Possible?

    Read the article

  • Resources started with slash .htaccess redirection

    - by Pawka
    I have moved old version of webpage to some subdirectory: http://www.smth.com/old/. But all resources (images, css, etc.) in HTML are linked with slash symbol at the start. So browser still tries to load them from root path. For example old/test.html contains: <img src="/images/lma_logo.ico" /> <!-- not working !--> <img src="images/lma_logo.ico" /> <!-- working !--> How can I rewrite ulrs to load resources from the "old" dir if urls still starts with "/"?

    Read the article

  • Thinking about open-sourcing quiz project [closed]

    - by user72727
    I was thinking about starting an open source project. I have a few projects that might work ok as an open project but thought I might dip my toe into the water with a simple quiz project. The idea is you can add questions to a quiz, arrange questions by topic, difficulty or location. Users would hopefully get an interesting quiz, tuned to their ability. At the end they'd get a score and hopefully they might provide either some feedback on the questions or even supply a few questions of their own. I couldn't see a similar project (fame's last words). I have a basic version of the project that gives the user a bunch of questions to answer in 10 minutes. It doesn't currently group the questions into topics, and no feedback is taken. I've also been told the graphical questions don't work on Ipads for some reason. Would this be a suitable project to go open source? I did find various quiz's out there but all seemed rather narrowly focused. I really wanted something that could cover any type of question on any type of subject. I prefer to keep the questions in MySQL but I could see how this might make it more difficult for others to get on board - should I move to data files? How do I proceed? http://www.checkmypages.com/numbers

    Read the article

  • GLSL custom interpolation filter

    - by Cyan
    I'm currently building a fragment shader which is using several textures to render the final pixel color. The textures are not really textures, they are in fact "input data" to be used in the formula to generate the final color. The problem I've got is that the texture are getting bi-linear-filtered, and therefore the input data as well. This results in many unwanted side-effects, especially when final rendered texture is "zoomed" compared to original resolution. Removing the side effect is a complex task, and only result in "average" rendering. I was thinking : well, all my problems seems to come from the "default" bi-linear filtering on these input data. I can't move to GL_NEAREST either, since it would create "blocky" rendering. So i guess the better way to proceed is to be fully in charge of the interpolation. For this to work, i would need the input data at their "natural" resolution (so that means 4 samples), and a relative position between the sampled points. Is that possible, and if yes, how ? [EDIT] Since i started this question, i found this internet entry, which seems to (mostly) answer my needs. http://www.gamerendering.com/2008/10/05/bilinear-interpolation/ One aspect of the solution worry me though : the dimensions of the texture must be provided in an argument. It seems there is no way to "find this information transparently". Adding an argument into the rendering pipeline is unwelcomed though, since it's not under my responsibility, and translates into adding complexity for others.

    Read the article

  • iptables redirect single website traffic to port 8080

    - by Luke John Southard
    My goal is to be able to make a connection to one, and only one, website through a proxy. Everything else should be dropped. I have been able to do this successfully without a proxy with this code: ./iptables -I INPUT 1 -i lo -j ACCEPT ./iptabels -A OUTPUT -p udp --dport 53 -j ACCEPT ./iptables -A OUTPUT -p tcp -d www.website.com --dport 80 -j ACCEPT ./iptables -A INPUT -m conntrack --cstate ESTABLISHED,RELATED -j ACCEPT ./iptables -P INPUT DROP ./iptables -P OUTPUT DROP How could I do the same thing except redirect the traffic to port 8080 somewhere? I've been trying to redirect in the PREROUTING chain in the nat table. I'm unsure if this is the proper place to do that tho. Thanks for your help!

    Read the article

  • which user is the website host

    - by Kossel
    I m learning about server, and I'm configuring nginx mysql php wordpress. the server distro is debian 6. I created a new user and I wish each user is the owner of the site folder /var/www/site.one so I chown -R kossel:kossel site.one my problem is, my wordpress only work if I chmod 644 wp-config.php, which all can read wordpress site suggest that file should be 640. and my question is: when someone open mydomain.com, wordpress has to access wp-config.php file, but which user is it actually using to "read" that file? root? user kossel? anyone else? how can I properly give it permission or owner??

    Read the article

  • init.d service died

    - by jerluc
    Adapting some code from a linux forum, I've added a service script to /etc/init.d on my ubuntu natty server to start/stop/restart node.js It literally was working the first day I made it, but then today, after viewing my website this morning, the server threw a 404, and upon further inspection, the node.js process was gone. So I went to start the service again, only this time, node.js didn't start at all, and ever since I haven't been able to get my service script working. Below is the entire script: #!/bin/sh # # Node Server Startup # case "$1" in start) echo -n "Starting node: " daemon node /usr/local/www/server.js echo touch /var/lock/subsys/node ;; stop) echo -n "Shutting down node: " killall node echo rm -f /var/lock/subsys/node rm -f /var/run/node.pid ;; status) status node ;; restart) $0 stop $0 start ;; reload) echo -n "Reloading node: " killall node -HUP echo ;; *) echo "Usage: $0 {start|stop|restart|reload|status}" exit 1 esac exit 0 Thanks for any help!

    Read the article

  • apache port number

    - by user983223
    For each development sites I want to have a unique port number. For instance, domain.com:1234 This is what I have in my httpd.conf file. After restart the page domain.com:1234 is not showing in the browser. Is there anything else that I need to do besides what I have already done to make this work? Listen *:1234 <VirtualHost *:1234> DocumentRoot /var/www/dev_sites/test ServerName domain.com:1234 </VirtualHost> It looks like if I go to my local hostname (kk.local:1234) it shows. Is there some sort of dns that I need to do? I really don't want to go into godaddy everytime I add a development site. Is there a way around that?

    Read the article

  • background in JAVA [closed]

    - by leen.zd
    how can i put a background image in my java code? this is my code... what's error? import java.awt.Container; import java.awt.Dimension; import java.awt.Graphics; import java.awt.image.BufferedImage; import java.io.File; import java.io.IOException; import javax.imageio.ImageIO; import javax.swing.JFrame; import javax.swing.JPanel; public class background extends JFrame { private Container c; private JPanel imagePanel; public background() { initialize(); } private void initialize() { setDefaultCloseOperation(EXIT_ON_CLOSE); c = getContentPane(); imagePanel = new JPanel() { public void paint(Graphics g) { try { BufferedImage image = ImageIO.read(new File("http://www.signe-zodiaque.com/images/signes/balance.jpg")); g.drawImage(image, 1000, 2000, null); } catch (IOException e) { e.printStackTrace(); } } }; imagePanel.setPreferredSize(new Dimension(640, 480)); c.add(imagePanel); }

    Read the article

  • Trouble with collision detection in XNA?

    - by Lewis Wilcock
    I'm trying to loop through an list of enemies (enemyList) and then any that have intersected the rectangle belonging to the box object (Which doesn't move), declare there IsAlive bool as false. Then another part of the code removes any enemies that have the IsAlive bool as false. The problem im having is getting access to the variable that holds the Rectangle (named boundingBox) of the enemy. When this is in a foreach loop it works fine, as the enemy class is declared within the foreach. However, there are issues in using the foreach as it removes more than one of the enemies at once (Usually at positions 0 and 2, 1 and 3, etc...). I was wondering the best way to declare the enemy class, without it actually creating new instances of the class? Heres the code I currently have: if (keyboardState.IsKeyDown(Keys.Q) && oldKeyState.IsKeyUp(Keys.Q)) { enemyList.Add(new enemy(textureList.ElementAt(randText), new Vector2(250, 250), graphics)); } //foreach (enemy enemy in enemyList) //{ for (int i = 0; i < enemyList.Count; i++) { if (***enemy.boundingBox***.Intersects(theDefence.boxRectangle)) { enemyList[i].IsDead = true; i++; } } //} for(int j = enemyList.Count - 1; j >= 0; j--) { if(enemyList[j].IsDead) enemyList.RemoveAt(j); } (The enemy.boundingBox is the variables I can't get access too). This is a complete copy of the code (Zipped) If it helps: https://www.dropbox.com/s/ih52k4e21g98j3k/Collision%20tests.rar I managed to find the issue. Changed enemy.boundingBox to enemyList[i].boundingBox. Collision works now! Thanks for any help!

    Read the article

  • All email directed to 3rd party vendor except for one specific domain. How?

    - by jherlitz
    So we setup a site to site vpn tunnel with another company. We then proceeded to setup a DNS zone on each others dns servers and entered in each others Mail server name and IP, MX record and WWW record. This allowed us to send emails to each others mail servers through the site to site vpn. Now recently the other company started using MX Logic to scan all outbound and incoming mail. So all outbound email is directed to MX Logic. However we still want email between us to travel across the the Site to Site VPN tunnel. How can we specify that to happen for just one domain not to be directed to MX Logic? Stump on both ends and looking for help.

    Read the article

  • Setting up a network between a host and guest virtual machine

    - by anonymous
    (I'm running ubuntu server 12.04 on virtual box) I'm trying to transfer a file (scp) from my laptop to one of the directories of a virtual machine. I tried sharing folders, but that failed. I'm a bit of a networking newbie. I've looked at like 20-30 pages. Here's one: http://www.howtoforge.com/moving-files-between-linux-systems-with-scp I followed those steps exactly. My problem is that when I try using scp, it just hangs. I'm also not sure which network interface to configure (eth0, eth1?) in the guest OS. Another (significant?) detail is that the inet address of eth0 is 10.0.2.15 instead of something like 192.168.x.y. I've enabled the bridge adapter and the host-only adapter. Both the laptop and guest VM have openssh-server installed. I'm not sure what to do at this point. Is there a better place to ask about this?

    Read the article

  • Open Terminal Here, as Root (OS X)

    - by cwd
    There is a pretty awesome applescript called "Open Terminal Here" ( http://www.entropy.ch/software/applescript/ ) which you can add to your finder's toolbar and click when you want to launch a terminal console which is set to that directory. Sometimes I need to be root, and so I end up starting terminal, doing something like sudo -i and then I have to change back to the previous directory because the sudo command is landing me in /var/root. I'm using sudo -i because I like it to load things like aliases / the bash profile. The script is applescript, and here's the important part of how it works: ... set cmd to "cd " & quoted form of the_path & " && echo $'\\ec'" ... tell application "Terminal" activate do script with command cmd How do I get this to load as root?

    Read the article

< Previous Page | 532 533 534 535 536 537 538 539 540 541 542 543  | Next Page >