Search Results

Search found 46894 results on 1876 pages for 'java native interface'.

Page 537/1876 | < Previous Page | 533 534 535 536 537 538 539 540 541 542 543 544  | Next Page >

  • Static method , Abstract method , Interface method comparision ?

    - by programmerist
    When i choose these methods? i can not decide which one i must prefer or when will i use one of them?which one give best performance? First Type Usage public abstract class _AccessorForSQL { public virtual bool Save(string sp, ListDictionary ld, CommandType cmdType); public virtual bool Update(); public virtual bool Delete(); public virtual DataSet Select(); } class GenAccessor : _AccessorForSQL { DataSet ds; DataTable dt; public override bool Save(string sp, ListDictionary ld, CommandType cmdType) { } public override bool Update() { return true; } public override bool Delete() { return true; } public override DataSet Select() { DataSet dst = new DataSet(); return dst; } Second Type Usage Also i can write it below codes: public class GenAccessor { public Static bool Save() { } public Static bool Update() { } public Static bool Delete() { } } Third Type Usage Also i can write it below codes: public interface IAccessorForSQL { bool Delete(); bool Save(string sp, ListDictionary ld, CommandType cmdType); DataSet Select(); bool Update(); } public class _AccessorForSQL : IAccessorForSQL { private DataSet ds; private DataTable dt; public virtual bool Save(string sp, ListDictionary ld, CommandType cmdType) { } } } I can use first one below usage: GenAccessor gen = New GenAccessor(); gen.Save(); I can use second one below usage: GenAccessor.Save(); Which one do you prefer? When will i use them? which time i need override method ? which time i need static method?

    Read the article

  • Designing a fluid Javascript interface to hide callback asynchrony

    - by Anurag
    How would I design an API to hide the asynchronous nature of AJAX and HTTP requests, or basically delay it to provide a fluid interface. To show an example from Twitter's new Anywhere API: // get @ded's first 20 statuses, filter only the tweets that // mention photography, and render each into an HTML element T.User.find('ded').timeline().first(20).filter(filterer).each(function(status) { $('div#tweets').append('<p>' + status.text + '</p>'); }); function filterer(status) { return status.text.match(/photography/); } vs this (asynchronous nature of each call is clearly visible) T.User.find('ded', function(user) { user.timeline(function(statuses) { statuses.first(20).filter(filterer).each(function(status) { $('div#tweets').append('<p>' + status.text + '</p>'); }); }); }); It finds the user, gets their tweet timeline, filters only the first 20 tweets, applies a custom filter, and ultimately uses the callback function to process each tweet. I am guessing that a well designed API like this should work like a query builder (think ORMs) where each function call builds the query (HTTP URL in this case), until it hits a looping function such as each/map/etc., the HTTP call is made and the passed in function becomes the callback. An easy development route would be to make each AJAX call synchronous, but that's probably not the best solution. I am interested in figuring out a way to make it asynchronous, and still hide the asynchronous nature of AJAX.

    Read the article

  • Synchronizing issue: I want the main thread to be run before another thread but it sometimes doesn´t

    - by Rox
    I have done my own small concurrency framework (just for learning purposes) inspired by the java.util.concurrency package. This is about the Callable/Future mechanism. My code below is the whole one and is compilable and very easy to understand. My problem is that sometimes I run into a deadlock where the first thread (the main thread) awaits for a signal from the other thread. But then the other thread has already notified the main thread before the main thread went into waiting state, so the main thread cannot wake up. FutureTask.get() should always be run before FutureTask.run() but sometimes the run() method (which is called by new thread) runs before the get() method (which is called by main thread). I don´t know how I can prevent that. This is a pseudo code of how I want the two threads to be run. //From main thread: Executor.submit().get() (in get() the main thread waits for new thread to notify) ->submit() calls Executor.execute(FutureTask object) -> execute() starts new thread -> new thread shall notify `main thread` I cannot understand how the new thread can start up and run faster than the main thread that actually starts the new thread. Main.java: public class Main { public static void main(String[] args) { new ExecutorServiceExample(); } public Main() { ThreadExecutor executor = new ThreadExecutor(); Integer i = executor.submit(new Callable<Integer>() { @Override public Integer call() { return 10; } }).get(); System.err.println("Value: "+i); } } ThreadExecutor.java: public class ThreadExecutor { public ThreadExecutor() {} protected <V> RunnableFuture<V> newTaskFor(Callable c) { return new FutureTask<V>(c); } public <V> Future<V> submit(Callable<V> task) { if (task == null) throw new NullPointerException(); RunnableFuture<V> ftask = newTaskFor(task); execute(ftask); return ftask; } public void execute(Runnable r) { new Thread(r).start(); } } FutureTask.java: import java.util.concurrent.locks.Condition; import java.util.concurrent.locks.ReentrantLock; import java.util.logging.Level; import java.util.logging.Logger; public class FutureTask<V> implements RunnableFuture<V> { private Callable<V> callable; private volatile V result; private ReentrantLock lock = new ReentrantLock(); private Condition condition = lock.newCondition(); public FutureTask(Callable callable) { if (callable == null) throw new NullPointerException(); this.callable = callable; } @Override public void run() { acquireLock(); System.err.println("RUN"+Thread.currentThread().getName()); V v = this.callable.call(); set(v); condition.signal(); releaseLock(); } @Override public V get() { acquireLock(); System.err.println("GET "+Thread.currentThread().getName()); try { condition.await(); } catch (InterruptedException ex) { Logger.getLogger(FutureTask.class.getName()).log(Level.SEVERE, null, ex); } releaseLock(); return this.result; } public void set(V v) { this.result = v; } private void acquireLock() { lock.lock(); } private void releaseLock() { lock.unlock(); } } And the interfaces: public interface RunnableFuture<V> extends Runnable, Future<V> { @Override void run(); } public interface Future<V> { V get(); } public interface Callable<V> { V call(); }

    Read the article

  • Designing a fluent Javascript interface to abstract away the asynchronous nature of AJAX

    - by Anurag
    How would I design an API to hide the asynchronous nature of AJAX and HTTP requests, or basically delay it to provide a fluid interface. To show an example from Twitter's new Anywhere API: // get @ded's first 20 statuses, filter only the tweets that // mention photography, and render each into an HTML element T.User.find('ded').timeline().first(20).filter(filterer).each(function(status) { $('div#tweets').append('<p>' + status.text + '</p>'); }); function filterer(status) { return status.text.match(/photography/); } vs this (asynchronous nature of each call is clearly visible) T.User.find('ded', function(user) { user.timeline(function(statuses) { statuses.first(20).filter(filterer).each(function(status) { $('div#tweets').append('<p>' + status.text + '</p>'); }); }); }); It finds the user, gets their tweet timeline, filters only the first 20 tweets, applies a custom filter, and ultimately uses the callback function to process each tweet. I am guessing that a well designed API like this should work like a query builder (think ORMs) where each function call builds the query (HTTP URL in this case), until it hits a looping function such as each/map/etc., the HTTP call is made and the passed in function becomes the callback. An easy development route would be to make each AJAX call synchronous, but that's probably not the best solution. I am interested in figuring out a way to make it asynchronous, and still hide the asynchronous nature of AJAX.

    Read the article

  • Proper use of the IDisposable interface

    - by cwick
    I know from reading the MSDN documentation that the "primary" use of the IDisposable interface is to clean up unmanaged resources http://msdn.microsoft.com/en-us/library/system.idisposable.aspx. To me, "unmanaged" means things like database connections, sockets, window handles, etc. But, I've seen code where the Dispose method is implemented to free managed resources, which seems redundant to me, since the garbage collector should take care of that for you. For example: public class MyCollection : IDisposable { private List<String> _theList = new List<String>(); private Dictionary<String, Point> _theDict = new Dictionary<String, Point>(); // Die, you gravy sucking pig dog! public void Dispose() { _theList.clear(); _theDict.clear(); _theList = null; _theDict = null; } My question is, does this make the garbage collector free memory used by MyCollection any faster than it normally would? edit: So far people have posted some good examples of using IDisposable to clean up unmanaged resources such as database connections and bitmaps. But suppose that _theList in the above code contained a million strings, and you wanted to free that memory now, rather than waiting for the garbage collector. Would the above code accomplish that?

    Read the article

  • Building an *efficient* if/then interface for non-technical users to build flow-control in PHP

    - by Brendan
    I am currently building an internal tool to be used by our management to control the flow of traffic. I have built an if/then interface allowing the user to set conditions for certain outcomes, however it is inefficient to use the switch statement to control the flow. How can I improve the efficiency of my code? Example of code: if($previous['route_id'] == $condition['route_id'] && $failed == 0) //if we have not moved on to a new set of rules and we haven't failed yet { switch($condition['type']) { case 0 : $type = $user['hour']; break; case 1 : $type = $user['location']['region_abv']; break; case 2 : $type = $user['referrer_domain']; break; case 3 : $type = $user['affiliate']; break; case 4 : $type = $user['location']['country_code']; break; case 5 : $type = $user['location']['city']; break; } $type = strtolower($type); $condition['value'] = strtolower($condition['value']); switch($condition['operator']) { case 0 : if($type == $condition['value']); else $failed = '1'; break; case 1 : if($type != $condition['value']); else $failed = '1'; break; case 2 : if($type > $condition['value']); else $failed = '1'; break; case 3 : if($type >= $condition['value']); else $failed = '1'; break; case 4 : if($type < $condition['value']); else $failed = '1'; break; case 5 : if($type <= $condition['value']); else $failed = '1'; break; } }

    Read the article

  • is it right to call ejb bean from thread by ThreadPoolExecutor?

    - by kislo_metal
    I trying to call some ejb bean method from tread. and getting error : (as is glassfish v3) Log Level SEVERE Logger javax.enterprise.system.std.com.sun.enterprise.v3.services.impl Name-Value Pairs {_ThreadName=Thread-1, _ThreadID=42} Record Number 928 Message ID java.lang.NullPointerException at ua.co.rufous.server.broker.TempLicService.run(TempLicService.java Complete Message 35) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:637) here is tread public class TempLicService implements Runnable { String hash; //it`s Stateful bean @EJB private LicActivatorLocal lActivator; public TempLicService(String hash) { this.hash= hash; } @Override public void run() { lActivator.proccessActivation(hash); } } my ThreadPoolExecutor public class RequestThreadPoolExecutor extends ThreadPoolExecutor { private boolean isPaused; private ReentrantLock pauseLock = new ReentrantLock(); private Condition unpaused = pauseLock.newCondition(); private static RequestThreadPoolExecutor threadPool; private RequestThreadPoolExecutor() { super(1, Integer.MAX_VALUE, 10, TimeUnit.SECONDS, new LinkedBlockingQueue<Runnable>()); System.out.println("RequestThreadPoolExecutor created"); } public static RequestThreadPoolExecutor getInstance() { if (threadPool == null) threadPool = new RequestThreadPoolExecutor(); return threadPool; } public void runService(Runnable task) { threadPool.execute(task); } protected void beforeExecute(Thread t, Runnable r) { super.beforeExecute(t, r); pauseLock.lock(); try { while (isPaused) unpaused.await(); } catch (InterruptedException ie) { t.interrupt(); } finally { pauseLock.unlock(); } } public void pause() { pauseLock.lock(); try { isPaused = true; } finally { pauseLock.unlock(); } } public void resume() { pauseLock.lock(); try { isPaused = false; unpaused.signalAll(); } finally { pauseLock.unlock(); } } public void shutDown() { threadPool.shutdown(); } //<<<<<< creating thread here public void runByHash(String hash) { Runnable service = new TempLicService(hash); threadPool.runService(service); } } and method where i call it (it is gwt servlet, but there is no proble to call thread that not contain ejb) : @Override public Boolean submitHash(String hash) { System.out.println("submiting hash"); try { if (tBoxService.getTempLicStatus(hash) == 1) { //<<< here is the call RequestThreadPoolExecutor.getInstance().runByHash(hash); return true; } } catch (NoResultException e) { e.printStackTrace(); } return false; } I need to organize some pool of submitting hash to server (calls of LicActivator bean), is ThreadPoolExecutor design good idea and why it is not working in my case? (as I know we can`t create thread inside bean, but could we call bean from different threads? ). If No, what is the bast practice for organize such request pool? Thanks. << Answer: I am using DI (EJB 3.1) soo i do not need any look up here. (application packed in ear and both modules in it (web module and ejb), it works perfect for me). But I can use it only in managed classes. So.. 2.Can I use manual look up in Tread ? Could I use Bean that extends ThreadPoolExecutor and calling another bean that implements Runnable ? Or it is not allowed ?

    Read the article

  • Designing a general database interface in PHP

    - by lamas
    I'm creating a small framework for my web projects in PHP so I don't have to do the basic work over and over again for every new website. It is not my goal to create a second CakePHP or Codeigniter and I'm also not planning to build my websites with any of the available frameworks as I prefer to use things I've created myself in general. I have no problems in designing that framework when it comes to parts like the core structure, request handling, and so on but I'm getting stuck with designing the database interface for my modules. I've already thought about using the MVC pattern but thought that it would be a bit of a overkill. So the exact problem I'm facing is how my frameworks modules (viewCustomers could be a module, for example) should interact with the database. Is it a good idea to write SQL directly in PHP (mysql_query( 'SELECT firstname, lastname(.....))? How could I abstract a query like SELECT firstname, lastname FROM customers WHERE id=X Would MySQL helper functions like $this->db->get( array('firstname', 'lastname'), array('id'=>X) ) be a good idea? I suppose not because they actually make everything more complicated by requiring arrays to be created and passed. Is the Model pattern from MVC my only real option?

    Read the article

  • Auto-rotating freshly created interface

    - by zoul
    Hello! I have trouble with auto-rotating interfaces in my iPad app. I have a class called Switcher that observes the interface rotation notifications and when it receives one, it switches the view in window, a bit like this: - (void) orientationChanged: (NSNotification*) notice { UIDeviceOrientation newIO = [[UIDevice currentDevice] orientation]; UIViewController *newCtrl = /* something based on newIO */; [currentController.view removeFromSuperview]; // remove the old view [window addSubview newCtrl.view]; [self setCurrentController:newCtrl]; } The problem is that the new view does not auto-rotate. My auto-rotation callback in the controller class looks like this: - (BOOL) shouldAutorotateToInterfaceOrientation: (UIInterfaceOrientation) io { NSString *modes[] = {@"unknown", @"portrait", @"portrait down", @"landscape left", @"landscape right"}; NSLog(@"shouldAutorotateToInterfaceOrientation: %i (%@)", io, modes[io]); return YES; } But no matter how I rotate the device, I find the following in the log: shouldAutorotateToInterfaceOrientation: 1 (portrait) shouldAutorotateToInterfaceOrientation: 1 (portrait) …and the willRotateToInterfaceOrientation:duration: does not get called at all. Now what? The orientation changing is becoming my least favourite part of the iPhone SDK… (I can’t check the code on the device yet, could it be a bug in the simulator?) PS. The subscription code looks like this: [[UIDevice currentDevice] beginGeneratingDeviceOrientationNotifications]; [[NSNotificationCenter defaultCenter] addObserver:self selector:@selector(orientationChanged:) name:UIDeviceOrientationDidChangeNotification object:nil];

    Read the article

  • Action property of interface type

    - by Daniel
    Hi, guys. With my understading, the nature of a Action is that properties can be pushed w/ request parameter values. And, one wonderful feature is that Struts2 allows you to directly populate parameter values against Class type property ;) Assuming there exists a Action and property class as below, class Action extends ActionSupport { User user; @Action(value="hello" {@result=(.......)}) public void execute() { ........ } ..... public void setUser(User user) { this.user = user; } public User getUser() { return this.user; } } class User { String name; ..... public void setName(String name) { this.name = name; } public String getName() { return this.name; } } you could populate User class property by doing like this. http://...../hello.action?user.name=John or via jsp page Then, I realize that there are actually people make an Action property as a Interface type. My question is what is the reason behind this. If there is a sample code demonstrating it will be great. Thanks in advance!

    Read the article

  • How to set interface method between two viewController to pass paramter in Navigation Controller

    - by TechFusion
    Hello, I have created Window based application, root controller as Tab Bar controller. One Tab bar has Navigation controller. Navigation controller's ViewControlller implementation, I am pushing Viewcontroller. I am looking to pass parameter from Navigation Controller's View controller to pushed View Controller. I have tried to pass as per below method. //ViewController.h @interface ViewController:UIViewController{ NSString *String; } @property(copy, nonatomic)NSString *String; @end //ViewController.m #import "ViewController1.h" ViewController1 *level1view = [[ViewController alloc]init]; level1view.hideBottomBarWhenPushed = YES; level1view.theString = String; [self.navigationController pushViewController:level1view animated:YES]; [level1view release]; //ViewController1.h NSString *theString; @property(copy, nonatomic)NSString *theString; This is working fine. but I want to pass more than one parameter like Integer and UITextFiled Values so how to do that? Is there any Apple Doc that I can get idea about this? Thanks,

    Read the article

  • How to use custom UITableViewCell from Interface Builder?

    - by Krumelur
    I want to be able to design my own UITableViewCell in IB. But I keep getting a null ref exception when trying to access the label I defined in IB. Here's what I'm doing: In Interface Builder: I removed the "View" and added a UITableViewCell instead. Changed the class of the UITableViewCell to "TestCellView". Added a UILabel to the cell. Added an outlet "oLblText" to TestCellView and connected the UILabel to it. Changed the identifier of the class to "TestCellView". Implement TestCellView.xib.cs public partial class TestCellView : UITableViewCell { public TestCellView(string sKey) : base(UITableViewCellStyle.Default, sKey) { } public TestCellView(IntPtr oHandle) : base(oHandle) { } public string TestText { get { return this.oLblText.Text; } set { // HERE I get the null ref exception! this.oLblText.Text = value; } } } ** The TestCellView.designer.cs** [MonoTouch.Foundation.Register("TestCellView")] public partial class TestCellView { private MonoTouch.UIKit.UILabel __mt_oLblText; #pragma warning disable 0169 [MonoTouch.Foundation.Connect("oLblText")] private MonoTouch.UIKit.UILabel oLblText { get { this.__mt_oLblText = ((MonoTouch.UIKit.UILabel)(this.GetNativeField("oLblText"))); return this.__mt_oLblText; } set { this.__mt_oLblText = value; this.SetNativeField("oLblText", value); } } } In my table's source: public override UITableViewCell GetCell (UITableView tableView, NSIndexPath indexPath) { TestCellView oCell = (TestCellView)tableView.DequeueReusableCell("myCell"); if(oCell == null) { // I suppose this is wrong but how to do it correctly? // this == my UITableViewSource. NSBundle.MainBundle.LoadNib("TestCellView", this, null); oCell = new TestCellView("myCell"); } oCell.TestText = "Cell " + indexPath.Row; return oCell; } Please note that I do NOT want a solution that involves a UIViewController for every cell. I have seen a couple of examples on the web doing this. I just think it is total overkill. What am I doing wrong?

    Read the article

  • How to specify multiple values in where with AR query interface in rails3

    - by wkhatch
    Per section 2.2 of rails guide on Active Record query interface here: which seems to indicate that I can pass a string specifying the condition(s), then an array of values that should be substituted at some point while the arel is being built. So I've got a statement that generates my conditions string, which can be a varying number of attributes chained together with either AND or OR between them, and I pass in an array as the second arg to the where method, and I get: ActiveRecord::PreparedStatementInvalid: wrong number of bind variables (1 for 5) which leads me to believe I'm doing this incorrectly. However, I'm not finding anything on how to do it correctly. To restate the problem another way, I need to pass in a string to the where method such as "table.attribute = ? AND table.attribute1 = ? OR table.attribute1 = ?" with an unknown number of these conditions anded or ored together, and then pass something, what I thought would be an array as the second argument that would be used to substitute the values in the first argument conditions string. Is this the correct approach, or, I'm just missing some other huge concept somewhere and I'm coming at this all wrong? I'd think that somehow, this has to be possible, short of just generating a raw sql string.

    Read the article

  • multiple models in Rails with a shared interface

    - by dfondente
    I'm not sure of the best structure for a particular situation in Rails. We have several types of workshops. The administration of the workshops is the same regardless of workshop type, so the data for the workshops is in a single model. We collect feedback from participants about the workshops, and the questionnaire is different for each type of workshop. I want to access the feedback about the workshop from the workshop model, but the class of the associated model will depend on the type of workshop. If I was doing this in something other than Rails, I would set up an abstract class for WorkshopFeedback, and then have subclasses for each type of workshop: WorkshopFeedbackOne, WorkshopFeedbackTwo, WorkshopFeedbackThree. I'm unsure how to best handle this with Rails. I currently have: class Workshop < ActiveRecord::Base has_many :workshop_feedbacks end class Feedback < ActiveRecord::Base belongs_to :workshop has_many :feedback_ones has_many :feedback_twos has_many :feedback_threes end class FeedbackOne < ActiveRecord::Base belongs_to :feedback end class FeedbackTwo < ActiveRecord::Base belongs_to :feedback end class FeedbackThree < ActiveRecord::Base belongs_to :feedback end This doesn't seem like to the cleanest way to access the feedback from the workshop model, as accessing the correct feedback will require logic investigating the Workshop type and then choosing, for instance, @workshop.feedback.feedback_one. Is there a better way to handle this situation? Would it be better to use a polymorphic association for feedback? Or maybe using a Module or Mixin for the shared Feedback interface? Note: I am avoiding using Single Table Inheritance here because the FeedbackOne, FeedbackTwo, FeedbackThree models do not share much common data, so I would end up with a large sparsely populated table with STI.

    Read the article

  • Looping the layout that was set up in Interface Builder

    - by Slavenko
    I just need for someone to point me in the right direction of how I should be doing things. I wanted to make an iOS news like app that would have interface resembling Windows Phone. Large and small image tiles that represent one news item each. Now I was thinking to create some basic layout in storyboard, that would consist out of, for example, a title, and a 3 different sized tiles/images (the gray part on the attached image). Now, I would be getting the data as a JSON array that has holds different news categories so I was wondering if somehow the set up layout could be reused in a for loop since the layout will only repeat itself (the red part on the attached image) and oly the data would be different. Can this be done, should I even try doing something like this, or should I try to create an entire layout programmatically? I wouldn't mind doing it programatically, it's just that I don't have much experience in creating layouts that way, and wanted to make sure that I don't do something that I might regret later. Thank you for any help and advice.

    Read the article

  • Implementing inotifycollectionchanged interface

    - by George
    Hello, I need to implement a collection with special capabilities. In addition, I want to bind this collection to a ListView, Therefore I ended up with the next code (I omitted some methods to make it shorter here in the forum): public class myCollection<T> : INotifyCollectionChanged { private Collection<T> collection = new Collection<T>(); public event NotifyCollectionChangedEventHandler CollectionChanged; public void Add(T item) { collection.Insert(collection.Count, item); OnCollectionChange(new NotifyCollectionChangedEventArgs(NotifyCollectionChangedAction.Add, item)); } protected virtual void OnCollectionChange(NotifyCollectionChangedEventArgs e) { if (CollectionChanged != null) CollectionChanged(this, e); } } I wanted to test it with a simple data class: public class Person { public string GivenName { get; set; } public string SurName { get; set; } } So I created an instance of myCollection class as follows: myCollection<Person> _PersonCollection = new myCollection<Person>(); public myCollection<Person> PersonCollection { get { return _PersonCollection; } } The problem is that the ListView does not update when the collection updates although I implemented the INotifyCollectionChanged interface. I know that my binding is fine (in XAML) because when I use the ObservableCollecion class instead of myCollecion class like this: ObservableCollection<Person> _PersonCollection = new ObservableCollection<Person>(); public ObservableCollection<Person> PersonCollection { get { return _PersonCollection; } } the ListView updates What is the problem?

    Read the article

  • Cisco 891w multiple VLAN configuration

    - by Jessica
    I'm having trouble getting my guest network up. I have VLAN 1 that contains all our network resources (servers, desktops, printers, etc). I have the wireless configured to use VLAN1 but authenticate with wpa2 enterprise. The guest network I just wanted to be open or configured with a simple WPA2 personal password on it's own VLAN2. I've looked at tons of documentation and it should be working but I can't even authenticate on the guest network! I've posted this on cisco's support forum a week ago but no one has really responded. I could really use some help. So if anyone could take a look at the configurations I posted and steer me in the right direction I would be extremely grateful. Thank you! version 15.0 service timestamps debug datetime msec service timestamps log datetime msec no service password-encryption ! hostname ESI ! boot-start-marker boot-end-marker ! logging buffered 51200 warnings ! aaa new-model ! ! aaa authentication login userauthen local aaa authorization network groupauthor local ! ! ! ! ! aaa session-id common ! ! ! clock timezone EST -5 clock summer-time EDT recurring service-module wlan-ap 0 bootimage autonomous ! crypto pki trustpoint TP-self-signed-3369945891 enrollment selfsigned subject-name cn=IOS-Self-Signed-Certificate-3369945891 revocation-check none rsakeypair TP-self-signed-3369945891 ! ! crypto pki certificate chain TP-self-signed-3369945891 certificate self-signed 01 (cert is here) quit ip source-route ! ! ip dhcp excluded-address 192.168.1.1 ip dhcp excluded-address 192.168.1.5 ip dhcp excluded-address 192.168.1.2 ip dhcp excluded-address 192.168.1.200 192.168.1.210 ip dhcp excluded-address 192.168.1.6 ip dhcp excluded-address 192.168.1.8 ip dhcp excluded-address 192.168.3.1 ! ip dhcp pool ccp-pool import all network 192.168.1.0 255.255.255.0 default-router 192.168.1.1 dns-server 10.171.12.5 10.171.12.37 lease 0 2 ! ip dhcp pool guest import all network 192.168.3.0 255.255.255.0 default-router 192.168.3.1 dns-server 10.171.12.5 10.171.12.37 ! ! ip cef no ip domain lookup no ipv6 cef ! ! multilink bundle-name authenticated license udi pid CISCO891W-AGN-A-K9 sn FTX153085WL ! ! username ESIadmin privilege 15 secret 5 $1$g1..$JSZ0qxljZAgJJIk/anDu51 username user1 password 0 pass ! ! ! class-map type inspect match-any ccp-cls-insp-traffic match protocol cuseeme match protocol dns match protocol ftp match protocol h323 match protocol https match protocol icmp match protocol imap match protocol pop3 match protocol netshow match protocol shell match protocol realmedia match protocol rtsp match protocol smtp match protocol sql-net match protocol streamworks match protocol tftp match protocol vdolive match protocol tcp match protocol udp class-map type inspect match-all ccp-insp-traffic match class-map ccp-cls-insp-traffic class-map type inspect match-any ccp-cls-icmp-access match protocol icmp class-map type inspect match-all ccp-invalid-src match access-group 100 class-map type inspect match-all ccp-icmp-access match class-map ccp-cls-icmp-access class-map type inspect match-all ccp-protocol-http match protocol http ! ! policy-map type inspect ccp-permit-icmpreply class type inspect ccp-icmp-access inspect class class-default pass policy-map type inspect ccp-inspect class type inspect ccp-invalid-src drop log class type inspect ccp-protocol-http inspect class type inspect ccp-insp-traffic inspect class class-default drop policy-map type inspect ccp-permit class class-default drop ! zone security out-zone zone security in-zone zone-pair security ccp-zp-self-out source self destination out-zone service-policy type inspect ccp-permit-icmpreply zone-pair security ccp-zp-in-out source in-zone destination out-zone service-policy type inspect ccp-inspect zone-pair security ccp-zp-out-self source out-zone destination self service-policy type inspect ccp-permit ! ! crypto isakmp policy 1 encr 3des authentication pre-share group 2 ! crypto isakmp client configuration group 3000client key 67Nif8LLmqP_ dns 10.171.12.37 10.171.12.5 pool dynpool acl 101 ! ! crypto ipsec transform-set myset esp-3des esp-sha-hmac ! crypto dynamic-map dynmap 10 set transform-set myset ! ! crypto map clientmap client authentication list userauthen crypto map clientmap isakmp authorization list groupauthor crypto map clientmap client configuration address initiate crypto map clientmap client configuration address respond crypto map clientmap 10 ipsec-isakmp dynamic dynmap ! ! ! ! ! interface FastEthernet0 ! ! interface FastEthernet1 ! ! interface FastEthernet2 ! ! interface FastEthernet3 ! ! interface FastEthernet4 ! ! interface FastEthernet5 ! ! interface FastEthernet6 ! ! interface FastEthernet7 ! ! interface FastEthernet8 ip address dhcp ip nat outside ip virtual-reassembly duplex auto speed auto ! ! interface GigabitEthernet0 description $FW_OUTSIDE$$ES_WAN$ ip address 10...* 255.255.254.0 ip nat outside ip virtual-reassembly zone-member security out-zone duplex auto speed auto crypto map clientmap ! ! interface wlan-ap0 description Service module interface to manage the embedded AP ip unnumbered Vlan1 arp timeout 0 ! ! interface Wlan-GigabitEthernet0 description Internal switch interface connecting to the embedded AP switchport trunk allowed vlan 1-3,1002-1005 switchport mode trunk ! ! interface Vlan1 description $ETH-SW-LAUNCH$$INTF-INFO-FE 1$$FW_INSIDE$ ip address 192.168.1.1 255.255.255.0 ip nat inside ip virtual-reassembly zone-member security in-zone ip tcp adjust-mss 1452 crypto map clientmap ! ! interface Vlan2 description guest ip address 192.168.3.1 255.255.255.0 ip access-group 120 in ip nat inside ip virtual-reassembly zone-member security in-zone ! ! interface Async1 no ip address encapsulation slip ! ! ip local pool dynpool 192.168.1.200 192.168.1.210 ip forward-protocol nd ip http server ip http access-class 23 ip http authentication local ip http secure-server ip http timeout-policy idle 60 life 86400 requests 10000 ! ! ip dns server ip nat inside source list 23 interface GigabitEthernet0 overload ip route 0.0.0.0 0.0.0.0 10.165.0.1 ! access-list 23 permit 192.168.1.0 0.0.0.255 access-list 100 remark CCP_ACL Category=128 access-list 100 permit ip host 255.255.255.255 any access-list 100 permit ip 127.0.0.0 0.255.255.255 any access-list 100 permit ip 10.165.0.0 0.0.1.255 any access-list 110 permit ip 192.168.0.0 0.0.5.255 any access-list 120 remark ESIGuest Restriction no cdp run ! ! ! ! ! ! control-plane ! ! alias exec dot11radio service-module wlan-ap 0 session Access point version 12.4 no service pad service timestamps debug datetime msec service timestamps log datetime msec no service password-encryption ! hostname ESIRouter ! no logging console enable secret 5 $1$yEH5$CxI5.9ypCBa6kXrUnSuvp1 ! aaa new-model ! ! aaa group server radius rad_eap server 192.168.1.5 auth-port 1812 acct-port 1813 ! aaa group server radius rad_acct server 192.168.1.5 auth-port 1812 acct-port 1813 ! aaa authentication login eap_methods group rad_eap aaa authentication enable default line enable aaa authorization exec default local aaa authorization commands 15 default local aaa accounting network acct_methods start-stop group rad_acct ! aaa session-id common clock timezone EST -5 clock summer-time EDT recurring ip domain name ESI ! ! dot11 syslog dot11 vlan-name one vlan 1 dot11 vlan-name two vlan 2 ! dot11 ssid one vlan 1 authentication open eap eap_methods authentication network-eap eap_methods authentication key-management wpa version 2 accounting rad_acct ! dot11 ssid two vlan 2 authentication open guest-mode ! dot11 network-map ! ! username ESIadmin privilege 15 secret 5 $1$p02C$WVHr5yKtRtQxuFxPU8NOx. ! ! bridge irb ! ! interface Dot11Radio0 no ip address no ip route-cache ! encryption vlan 1 mode ciphers aes-ccm ! broadcast-key vlan 1 change 30 ! ! ssid one ! ssid two ! antenna gain 0 station-role root ! interface Dot11Radio0.1 encapsulation dot1Q 1 native no ip route-cache bridge-group 1 bridge-group 1 subscriber-loop-control bridge-group 1 block-unknown-source no bridge-group 1 source-learning no bridge-group 1 unicast-flooding bridge-group 1 spanning-disabled ! interface Dot11Radio0.2 encapsulation dot1Q 2 no ip route-cache bridge-group 2 bridge-group 2 subscriber-loop-control bridge-group 2 block-unknown-source no bridge-group 2 source-learning no bridge-group 2 unicast-flooding bridge-group 2 spanning-disabled ! interface Dot11Radio1 no ip address no ip route-cache shutdown ! encryption vlan 1 mode ciphers aes-ccm ! broadcast-key vlan 1 change 30 ! ! ssid one ! antenna gain 0 dfs band 3 block channel dfs station-role root ! interface Dot11Radio1.1 encapsulation dot1Q 1 native no ip route-cache bridge-group 1 bridge-group 1 subscriber-loop-control bridge-group 1 block-unknown-source no bridge-group 1 source-learning no bridge-group 1 unicast-flooding bridge-group 1 spanning-disabled ! interface GigabitEthernet0 description the embedded AP GigabitEthernet 0 is an internal interface connecting AP with the host router no ip address no ip route-cache ! interface GigabitEthernet0.1 encapsulation dot1Q 1 native no ip route-cache bridge-group 1 no bridge-group 1 source-learning bridge-group 1 spanning-disabled ! interface GigabitEthernet0.2 encapsulation dot1Q 2 no ip route-cache bridge-group 2 no bridge-group 2 source-learning bridge-group 2 spanning-disabled ! interface BVI1 ip address 192.168.1.2 255.255.255.0 no ip route-cache ! ip http server no ip http secure-server ip http help-path http://www.cisco.com/warp/public/779/smbiz/prodconfig/help/eag access-list 10 permit 192.168.1.0 0.0.0.255 radius-server host 192.168.1.5 auth-port 1812 acct-port 1813 key ***** bridge 1 route ip

    Read the article

  • applet does not load

    - by jcp
    We have a legacy program that was ported from Java 1.3 to Java 1.5. This application involves applets which worked fine before. After porting however, the applet would not load. However there are no errors or exceptions. The app would just try to load it forever. We tried to run it with Java 1.6 and poof! No problems whatsoever. Isn't Java 6 backwards compatible? So how come it would run in that version and not in 1.5? ==== Java Console log for Java 1.5.0_19 basic: Registered modality listener basic: Registered modality listener basic: Registered modality listener liveconnect: Invoking JS method: document liveconnect: Invoking JS method: document liveconnect: Invoking JS method: document liveconnect: Invoking JS method: URL liveconnect: Invoking JS method: URL liveconnect: Invoking JS method: URL basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=1 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=2 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Added progress listener: sun.plugin.util.GrayBoxPainter@b0bad7 basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Added progress listener: sun.plugin.util.GrayBoxPainter@ba9340 basic: Added progress listener: sun.plugin.util.GrayBoxPainter@1198891 basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Loading applet ... basic: Initializing applet ... basic: Starting applet ... basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 basic: Referencing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=4 basic: Releasing classloader: sun.plugin.ClassLoaderInfo@bb7759, refcount=3 network: Connecting <something>.jar with proxy=HTTP @ proxy/<ip address> basic: Loading <something>.jar from cache basic: No certificate info, this is unsigned JAR file. Left START init() Left END init() Right START init() Control start() Waiting for Left Panel to load... Right START start() network: Connecting socket://<ip address>:14444 with proxy=DIRECT Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... my HostName : <ip address> Thread-19 Check : Thread-19 Check : Monitor : run : start Thread-20 Monitor : Monitor: run() start Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... Control start() Waiting for Left Panel to load... the last message goes on forever... and now with the working version: ==== Java Console log for Java 1.6.0_15 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@1b000e7 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@12611a7 basic: Added progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@1807ca8 network: CleanupThread used 6 us network: CleanupThread used 5 us network: CleanupThread used 6 us cache: Skip blacklist check as cached value is ok. network: Cache entry found [url: <something>.jar, version: null] network: Connecting <something>.jar with proxy=HTTP @ proxy/<ip address> network: ResponseCode for <something>.jar : 304 network: Encoding for <something>.jar : null network: Disconnect connection to <something>.jar Reading certificates from 11 <something>.jar | <something>.idx network: No certificate info for unsigned JAR file: <something>.jar basic: Applet loaded. basic: Applet loaded. basic: Applet resized and added to parent container basic: Applet resized and added to parent container basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27768955 us, TotalTime: 28099230 us Right START init() basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27770563 us, TotalTime: 28100838 us Left START init() basic: Applet loaded. basic: Applet resized and added to parent container basic: PERF: AppletExecutionRunnable - applet.init() BEGIN ; jvmLaunch dt 330275 us, pluginInit dt 27779332 us, TotalTime: 28109607 us Left END init() basic: Applet initialized basic: Removed progress listener: sun.plugin.util.GrayBoxPainter$GrayBoxProgressListener@12611a7 basic: Applet made visible And that's it. Still haven't figured out why it works with java6 and not java5. @valli: the object tag was used, not applet @thorbjorn: i tried that already... it just keeps saying loading applet... @aaron: how can i know what exception it is, if there really is one? and yes we have considered that its a java bug but i still havent found what that bug is. i have to submit a report tomorrow and i've scoured the net but came up with nothing as of yet... @all: thank you for your replies

    Read the article

  • o display an image

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • Using only alphanumeric characters(a-z) inside toCharArray

    - by Aaron
    Below you will find me using toCharArray in order to send a string to array. I then MOVE the value of the letter using a for statement... for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } However, when I use shiftCode to move the value such as... a shifted by -1; I get a symbol @. Is there a way to send the string to shiftCode or tell shiftCode to ONLY use letters? I need it to see my text, like "aaron", and when I use the for statement iterate through a-z only and ignore all symbols and numbers. I THINK it is as simple as... letter=codeWord.toCharArray(a,z); But trying different forms of that and googling it didn't give me any results. Perhaps it has to do with regex or something? Below you will find a complete copy of my program; it works exactly how I want it to do; but it iterates through letters and symbols. I also tried finding instructions online for toCharArray but if there exists any arguments I can't locate them. My program... import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Aaron L. Jones * CS219 * AaronJonesProg3 * * This program is designed to - * Work as a Ceasar Cipher */ /** * * Aaron Jones */ public class AaronJonesProg3 { static String codeWord; static int shiftCode; static int i; static char[] letter; /** * @param args the command line arguments */ public static void main(String[] args) throws IOException { // Instantiating that Buffer Class // We are going to use this to read data from the user; in buffer // For performance related reasons BufferedReader reader; // Building the reader variable here // Just a basic input buffer (Holds things for us) reader = new BufferedReader(new InputStreamReader(System.in)); // Java speaks to us here / We get it to query our user System.out.print("Please enter text to encrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); /**************************************************************** **************************************************************** ***************************************************************/ // Java speaks to us here / We get it to query our user System.out.print("Please enter text to decrypt: "); // Try to get their input here try { // Get their codeword using the reader codeWord = reader.readLine(); // Make that input upper case codeWord = codeWord.toUpperCase(); // Cut the white space out codeWord = codeWord.replaceAll("\\s",""); // Make it all a character array letter = codeWord.toCharArray(); } // If they messed up the input we let them know here and end the prog. catch(Throwable t) { System.out.println(t.toString()); System.out.println("You broke it. But you impressed me because" + "I don't know how you did it!"); } // Java Speaks / Lets get their desired shift value System.out.print("Please enter the shift value: "); // Try for their input try { // We get their number here shiftCode = Integer.parseInt(reader.readLine()); } // Again; if the user broke it. We let them know. catch(java.lang.NumberFormatException ioe) { System.out.println(ioe.toString()); System.out.println("How did you break this? Use a number next time!"); } for(i = 0; i < letter.length; i++){ letter[i] += (shiftCode); System.out.print(letter[i]); } System.out.println(); } }

    Read the article

  • Watching a variable for changes without polling.

    - by milkfilk
    I'm using a framework called Processing which is basically a Java applet. It has the ability to do key events because Applet can. You can also roll your own callbacks of sorts into the parent. I'm not doing that right now and maybe that's the solution. For now, I'm looking for a more POJO solution. So I wrote some examples to illustrate my question. Please ignore using key events on the command line (console). Certainly this would be a very clean solution but it's not possible on the command line and my actual app isn't a command line app. In fact, a key event would be a good solution for me but I'm trying to understand events and polling beyond just keyboard specific problems. Both these examples flip a boolean. When the boolean flips, I want to fire something once. I could wrap the boolean in an Object so if the Object changes, I could fire an event too. I just don't want to poll with an if() statement unnecessarily. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; /* * Example of checking a variable for changes. * Uses dumb if() and polls continuously. */ public class NotAvoidingPolling { public static void main(String[] args) { boolean typedA = false; String input = ""; System.out.println("Type 'a' please."); while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic if (input.equals("a")) { typedA = true; } else { typedA = false; } // problem: this is polling. if (typedA) System.out.println("Typed 'a'."); } } } Running this outputs: Type 'a' please. a Typed 'a'. On some forums people suggested using an Observer. And although this decouples the event handler from class being observed, I still have an if() on a forever loop. import java.io.BufferedReader; import java.io.IOException; import java.io.InputStreamReader; import java.util.Observable; import java.util.Observer; /* * Example of checking a variable for changes. * This uses an observer to decouple the handler feedback * out of the main() but still is polling. */ public class ObserverStillPolling { boolean typedA = false; public static void main(String[] args) { // this ObserverStillPolling o = new ObserverStillPolling(); final MyEvent myEvent = new MyEvent(o); final MyHandler myHandler = new MyHandler(); myEvent.addObserver(myHandler); // subscribe // watch for event forever Thread thread = new Thread(myEvent); thread.start(); System.out.println("Type 'a' please."); String input = ""; while (true) { InputStreamReader isr = new InputStreamReader(System.in); BufferedReader br = new BufferedReader(isr); try { input = br.readLine(); } catch (IOException ioException) { System.out.println("IO Error."); System.exit(1); } // contrived state change logic // but it's decoupled now because there's no handler here. if (input.equals("a")) { o.typedA = true; } } } } class MyEvent extends Observable implements Runnable { // boolean typedA; ObserverStillPolling o; public MyEvent(ObserverStillPolling o) { this.o = o; } public void run() { // watch the main forever while (true) { // event fire if (this.o.typedA) { setChanged(); // in reality, you'd pass something more useful notifyObservers("You just typed 'a'."); // reset this.o.typedA = false; } } } } class MyHandler implements Observer { public void update(Observable obj, Object arg) { // handle event if (arg instanceof String) { System.out.println("We received:" + (String) arg); } } } Running this outputs: Type 'a' please. a We received:You just typed 'a'. I'd be ok if the if() was a NOOP on the CPU. But it's really comparing every pass. I see real CPU load. This is as bad as polling. I can maybe throttle it back with a sleep or compare the elapsed time since last update but this is not event driven. It's just less polling. So how can I do this smarter? How can I watch a POJO for changes without polling? In C# there seems to be something interesting called properties. I'm not a C# guy so maybe this isn't as magical as I think. private void SendPropertyChanging(string property) { if (this.PropertyChanging != null) { this.PropertyChanging(this, new PropertyChangingEventArgs(property)); } }

    Read the article

  • Injection of an EJB into a web java class under JBoss 7.1.1

    - by Dobbo
    I am trying to build a website using JBoss 7.1.1 and RESTeasy. I have managed to constructed and deploy and EAR with a both a WAR and an EJB-JAR contained within: voyager-app.ear META-INF/MANIFEST.MF META-INF/application.xml META-INF/jboss-app.xml lib/voyager-lib.jar voyager-adm.war voyager-ejb.jar voyager-web.war So far things are very simple. voyager-adm.war & voyager-lib.jar are empty (just the manifest file) but I know that I'm going to have code for them shortly. There is just one Stateful EJB - HarbourMasterBean (with just a local interface) and a few Database Entity Beans in the EJB jar file: voyager-ejb.jar META-INF/MANIFEST.MF META-INF/persistence.xml com/nutrastat/voyager/db/HarbourMasterBean.class com/nutrastat/voyager/db/HarbourMasterLocal.class com/nutrastat/voyager/db/PortEntity.class com/nutrastat/voyager/db/ShipEntity.class As far as I can tell the EJBs deploy correctly because the database units are created and the log shows that the publication of some HarbourMaster references: java:global/voyager-app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:app/voyager-ejb/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:module/harbour-master!com.nutrastat.voyager.db.HarbourMasterLocal java:global/voyager-app/voyager-ejb/harbour-master java:app/voyager-ejb/harbour-master java:module/harbour-master The problem lies in getting the HarbourMaster EJB injected into my web bean. The reference to it is alway NULL no matter what I try. voyager-web.war META-INF/MANIFEST.MF WEB-INF/web.xml WEB-INF/classes/com/nutrastat/voyager/web/ WEB-INF/classes/com/nutrastat/voyager/web/Ships.class WEB-INF/classes/com/nutrastat/voyager/web/VoyagerApplication.class Ships.java: @Path("fleet") public class Ships { protected transient final Logger log; @EJB private HarbourMasterLocal harbourMaster; public Ships() { log = LoggerFactory.getLogger(getClass()); } @GET @Path("ships") @Produces({"text/plain"}) public String listShips() { if (log.isDebugEnabled()) log.debug("Harbour master value: " + harbourMaster); return "Harbour Master: " + harbourMaster; } } &lt;web-app xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd" version="3.0" &gt; <display-name>Voyager Web Application</display-name> <listener> <listener-class> org.jboss.resteasy.plugins.server.servlet.ResteasyBootstrap </listener-class> </listener> <servlet> <servlet-name>Resteasy</servlet-name> <servlet-class> org.jboss.resteasy.plugins.server.servlet.HttpServletDispatcher </servlet-class> <init-param> <param-name> javax.ws.rs.Application </param-name> <param-value> com.nutrastat.voyager.web.VoyagerApplication </param-value> </init-param> </servlet> <servlet-mapping> <servlet-name>Resteasy</servlet-name> <url-pattern>/*</url-pattern> </servlet-mapping> &lt;/web-app&gt; I have been searching the web for an answer and read a number of places, both on StackOverflow and elsewhere that suggests is can be done, and that the problems lies with configuration. But they post only snippets and I'm never sure if I'm doing things correctly. Many thanks for any help you can provide. Dobbo

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I prevent my form from freezing when it is loading an image from the web at the click of a button?

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • maven-ear-plugin works if jboss version is 4.2, but not 5. Why ?

    - by NSINGH
    I am using maven to configure maven-ear-plugin. I am getting following exception when I say jboss version is 5 (See below code, under tag). It works if I replace version to 4.2 <build> <finalName>tactical</finalName> <plugins> <plugin> <artifactId>maven-ear-plugin</artifactId> <configuration> <version>5</version> <defaultJavaBundleDir>lib</defaultJavaBundleDir> <jboss> <version>5</version> <loader-repository>seam.jboss.org:loader=tactical</loader-repository> </jboss> <modules> <ejbModule> <groupId>${project.groupId}</groupId> <artifactId>tactical-jar</artifactId> </ejbModule> </modules> </configuration> </plugin> </plugins> </build> Why it works fine for jboss 4.2 but not for 5. What ?? I get the following exception: [INFO] Failed to initialize JBoss configuration Embedded error: Invalid JBoss configuration, version[5] is not supported. [INFO] ------------------------------------------------------------------------ [INFO] Trace org.apache.maven.lifecycle.LifecycleExecutionException: Failed to initialize JBoss configuration at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:583) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalWithLifecycle(DefaultLifecycleExecutor.java:49 9) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoal(DefaultLifecycleExecutor.java:478) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoalAndHandleFailures(DefaultLifecycleExecutor.jav a:330) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeTaskSegments(DefaultLifecycleExecutor.java:291) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.execute(DefaultLifecycleExecutor.java:142) at org.apache.maven.DefaultMaven.doExecute(DefaultMaven.java:336) at org.apache.maven.DefaultMaven.execute(DefaultMaven.java:129) at org.apache.maven.cli.MavenCli.main(MavenCli.java:287) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.codehaus.classworlds.Launcher.launchEnhanced(Launcher.java:315) at org.codehaus.classworlds.Launcher.launch(Launcher.java:255) at org.codehaus.classworlds.Launcher.mainWithExitCode(Launcher.java:430) at org.codehaus.classworlds.Launcher.main(Launcher.java:375) Caused by: org.apache.maven.plugin.MojoExecutionException: Failed to initialize JBoss configuration at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:159) at org.apache.maven.plugin.ear.GenerateApplicationXmlMojo.execute(GenerateApplicationXmlMojo.java:96) at org.apache.maven.plugin.DefaultPluginManager.executeMojo(DefaultPluginManager.java:451) at org.apache.maven.lifecycle.DefaultLifecycleExecutor.executeGoals(DefaultLifecycleExecutor.java:558) ... 16 more Caused by: org.apache.maven.plugin.ear.EarPluginException: Invalid JBoss configuration, version[5] is not supported. at org.apache.maven.plugin.ear.JbossConfiguration.(JbossConfiguration.java:95) at org.apache.maven.plugin.ear.AbstractEarMojo.initializeJbossConfiguration(AbstractEarMojo.java:296) at org.apache.maven.plugin.ear.AbstractEarMojo.execute(AbstractEarMojo.java:155) ... 19 more [INFO] ------------------------------------------------------------------------ [INFO] Total time: 2 seconds Any idea. Thanks

    Read the article

< Previous Page | 533 534 535 536 537 538 539 540 541 542 543 544  | Next Page >