Search Results

Search found 81445 results on 3258 pages for 'file command'.

Page 54/3258 | < Previous Page | 50 51 52 53 54 55 56 57 58 59 60 61  | Next Page >

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

  • Can't find the PHPdoc binary file

    - by ajsie
    I've downloaded the phpdoc from their site, extracted it, and put it in apache's documentroot for access through the web browser. However, I cant access the phpdoc tool from the command line. I have to add it to the PATH because I want to use the command line for automated documentation building, but considering I can't find it I can't add it to the PATH.

    Read the article

  • Bash does not remember programs with non 0 exit status in history

    - by Amigable Clark Kant
    I enter a command. It fails. I press arrow up, modify something and enter it again ... hold it right there. It used to work like that. Now it's more like: I enter a command. It fails. I press arrow up, get the last command which didn't fail, likely "ls" or something useless and I type the whole thing again back by hand. What happened? It wasn't always like this. But it's quite some time since this behavior changed, I'll give you that. Some years ago, at least. How do I put some sanity back into my bash prompt?

    Read the article

  • "sudo cd ..." one-liner?

    - by j-g-faustus
    Occasionally I want to cd into a directory where my user does not have permission, so I resort to sudo. The obvious command sudo cd somedir doesn't work: $ sudo mkdir test $ sudo chmod go-rxw test $ ls -l drwx------ 2 root root [...snip...] test $ cd test -bash: cd: test: Permission denied $ sudo cd test sudo: cd: command not found Using sudo su works: $ sudo su # cd test Is it possible to make this into a one-liner? (Not a big deal, just idle curiosity :) The variations I tried didn't work: $ sudo "cd test" sudo: cd: command not found $ sudo -i cd test -bash: line 0: cd: test: No such file or directory $ sudo -s cd test The last one doesn't give an error, but it cd's within a new shell that exits by the end of the line, so it doesn't actually take me anywhere. Can someone enlighten me as to why this happens? Why is sudo cd not found, when for example sudo ls ... works fine?

    Read the article

  • Why some user functions don't get recognised by bash?

    - by strapakowsky
    I can define a function like: myfunction () { ls -R "$1" ; } And then myfunction . just works. But if I do echo "myfunction ." | sh echo "myfunction ." | bash the messages are: sh: myfunction: not found bash: line 1: myfunction: command not found Why? And how can I call a function that comes from a string if not by piping it to sh or bash? I know there is this command source, but I am confused of when I should use source and when sh or bash. Also, I cannot pipe through source. To add to confusion, there is this command . that seems to have nothing to do with the "." that means "current directory".

    Read the article

  • Terminal line glitches

    - by foxy
    I installed Ubuntu 11.10 mini + LXDE and wanted to make my command line different in terminal (than just plain white), so I added blue color to path line (everything until $ sign) and it works fine but I have two strange glitches now: When i write a line which is longer than terminal window, instead of starting at next line it starts at the same one, overwriting everything which was in there. Sometimes while navigating over previous commands (up/down arrow keys) some part of command gets stuck and is treated as part of prompt (the blue text), but it is white and is non-deletable and is not taken as part of command when i press enter. What could I mess up? The bad thing is that I don't remember what exactly did I change, but i'm sure I changed only one line in bashrc

    Read the article

  • Mac keyboard shortcut to rm file

    - by MattDiPasquale
    What's the Mac keyboard shortcut to rm a file? I know command + delete sends it to trash, but I want to permanently delete it, say with command + fn + delete. UPDATE: It doesn't look like there is one. So, I want to create a service with Automator and then assign a keyboard shortcut to it from System Preferences. I can get to Automator - Service - Service receives selected files or folders in Finder.app, but how do I write the script that then runs rm -rf #{file/folder name}?

    Read the article

  • How do I toggle sound with amixer?

    - by joschi
    Including Natty I was always able to toggle (mute/unmute) the 'Master' sound volume with the amixer sset Master toggle command that I linked to an edge binding in CompizConfig-Manager. Now after installing Oneiric the command only mutes the sound but doesn't unmute it. I even tried it in the Terminal but it also doesn't work. It changes 'Mono: Playback 68 [78%] [-14.25dB] [off]' to '...[on]' but the sound stays muted so that I have to unmute it via the 'sound-indicator' in the panel. How can I get this working again? What did change since Natty? Does anyone know the command the 'sound-indicator' uses to toggle the sound volume?

    Read the article

  • How to edit files in a terminal with vim?

    - by andrew.46
    It is not always possible to edit and create files in a terminal and I would like to get the answers to the basics of manipulating files in a terminal using vim under Ubuntu Linux. Specific questions I have are: How can I open text files for editing? How can I save the file? How can I save the file with a different name? How can I leave the file without saving the changes? What settings are best in my configuration file and where is this file? How do I set the colors for vim? How do I show line numbers in vim and can this be toggled? A lot of questions here but I believe these questions and their answers should cover basic vim usage...

    Read the article

  • What Scripting Program would you choose to recover deleted and missing files?

    - by Steven Graf
    For a private project I'm looking for a command line tool to scan and recover files. I'm working on Gnome 3 (but I could also change my OS if it helps reaching my goal) and must be able to find and recover files on attached devices with formats such as NTFS, Fat32, MAC OS Extended and ext3. Is there a command line script to cover all of them or do I need to use different programs to reach my goal? can you recommend command line tools for these kind of tasks? is one of you willing and able to show me some examples and teach me further?

    Read the article

  • How to run ubuntu-tweak's janitor automatically?

    - by Eliran Malka
    My aim is to have the janitor running at startup, with a pre-configured profile (e.g. clear redundant packages and browser cache). The website is lacking any documentation or usage instructions, and I could not find any information on this here as well. I tried, naturally, to start ubuntu-tweak from the command line, hoping additional API exists that will come through in this (allegedly) simple task. I only got as far as: ubuntu-tweak -f janitor which is a step in the right direction, but what's still missing is a command for the clear action. Is such a command available, or is there any better way of achieving the desired behavior?

    Read the article

  • How to copy files via terminal?

    - by Levan
    This might sound silly for some people but I'm new to Linux and don't know how to use it as good as other people, yes I rad about copying files with terminal but these examples will help me a lot. So here is what I want to do: Examples: I have a file in /home/levan/kdenlive untitelds.mpg and I want to copy this file to /media/sda3/SkyDrive and do not want to delete any thing in SkyDrive directory. I have a file in /media/sda3/SkyDrive untitelds.mpg and I want to copy this file to /home/levan/kdenlive and do not want to delete any thing in kdenlive directory I want to copy a folder from home directory to sda3 and do not want to delete any thing on sda3 directory and opposite I want to cut a folder/file and copy to other place without deleting files in that directory I cut it into.

    Read the article

  • Daemon for moving files between partitions?

    - by RATHI
    I have a system with Ubuntu installed in 20GB and windows in 100 GB, two partitions - each of 100GB using NTFS. While using DC++ (multiple downloading of big file) I used to get message that system is running out of memory. Is there any way to make a deamon which will be checking the Ubuntu partition so that if its used space goes up to a certain amount (let's say 18 GB) it will automatically start a moving file from this drive to another drive (let's assume it will pick the file from movie folder or largest media file from this drive to move)? Or it prompt to ask from user which file to move? Is there any program which can do this for me? If not, can you suggest something to read so that I could make it?

    Read the article

  • What has 'rm -r ~' done to my home directory?

    - by GUI Junkie
    gedit creates hidden backup files ending with '~'. I wanted to do a recursive cleanup of my directory tree. The command rm *~ will delete all local files ending with '~' I thought rm -r *~ . would delete all files in the whole tree, but I typo-ed rm -r ~. There was a message some directory could not be deleted and I quit the command. The question is: What have I been deleting? I did notice that my Filezilla configuration was gone. Does this command delete all hidden directories from the home dir?

    Read the article

  • How to clean launch a GUI app via the Terminal (so it doesn't wait for termination)?

    - by Peter.O
    Some GUI apps launch cleanly via the Terminal command line. Some don't, and they cause the Terminal to wait for the app to terminate. ...and even then, some don't "release" the command line. The mysterious ampersand "&" suffix, seems to cause the terminal to put the process into the background... (but I'm not sure what happens there). Is there a way to launch an app via the Terminal, so that there is no "hang on" effect? ... just like launching something via F2. I'd like to have the command line available again, immediately (without something still in the background and writing out system message in the terminal).

    Read the article

< Previous Page | 50 51 52 53 54 55 56 57 58 59 60 61  | Next Page >