Search Results

Search found 29194 results on 1168 pages for 'non null'.

Page 545/1168 | < Previous Page | 541 542 543 544 545 546 547 548 549 550 551 552  | Next Page >

  • More SharePoint 2010 Expression Builders

    - by Ricardo Peres
    Introduction Following my last post, I decided to publish the whole set of expression builders that I use with SharePoint. For all who don’t know about expression builders, they allow us to employ a declarative approach, so that we don’t have to write code for “gluing” things together, like getting a value from the query string, the page’s underlying SPListItem or the current SPContext and assigning it to a control’s property. These expression builders are for some quite common scenarios, I use them quite often, and I hope you find them useful as well. SPContextExpression This expression builder allows us to specify an expression to be processed on the SPContext.Current property object. For example: 1: <asp:Literal runat="server" Text=“<%$ SPContextExpression:Site.RootWeb.Lists[0].Author.LoginName %>”/> It is identical to having the following code: 1: String authorName = SPContext.Current.Site.RootWeb.Lists[0].Author.LoginName; SPFarmProperty Returns a property stored on the farm level: 1: <asp:Literal runat="server" Text="<%$ SPFarmProperty:SomeProperty %>"/> Identical to: 1: Object someProperty = SPFarm.Local.Properties["SomeProperty"]; SPField Returns the value of a selected page’s list item field: 1: <asp:Literal runat="server" Text="<%$ SPField:Title %>"/> Does the same as: 1: String title = SPContext.Current.ListItem["Title"] as String; SPIsInAudience Checks if the current user belongs to an audience: 1: <asp:CheckBox runat="server" Checked="<%$ SPIsInAudience:SomeAudience %>"/> Equivalent to: 1: AudienceManager audienceManager = new AudienceManager(SPServiceContext.Current); 2: Audience audience = audienceManager.Audiences["SomeAudience"]; 3: Boolean isMember = audience.IsMember(SPContext.Current.Web.User.LoginName); SPIsInGroup Checks if the current user belongs to a group: 1: <asp:CheckBox runat="server" Checked="<%$ SPIsInGroup:SomeGroup %>"/> The equivalent C# code is: 1: SPContext.Current.Web.CurrentUser.Groups.OfType<SPGroup>().Any(x => String.Equals(x.Name, “SomeGroup”, StringComparison.OrdinalIgnoreCase)); SPProperty Returns the value of a user profile property for the current user: 1: <asp:Literal runat="server" Text="<%$ SPProperty:LastName %>"/> Where the same code in C# would be: 1: UserProfileManager upm = new UserProfileManager(SPServiceContext.Current); 2: UserProfile u = upm.GetUserProfile(false); 3: Object property = u["LastName"].Value; SPQueryString Returns a value passed on the query string: 1: <asp:GridView runat="server" PageIndex="<%$ SPQueryString:PageIndex %>" /> Is equivalent to (no SharePoint code this time): 1: Int32 pageIndex = Convert.ChangeType(typeof(Int32), HttpContext.Current.Request.QueryString["PageIndex"]); SPWebProperty Returns the value of a property stored at the site level: 1: <asp:Literal runat="server" Text="<%$ SPWebProperty:__ImagesListId %>"/> You can get the same result as: 1: String imagesListId = SPContext.Current.Web.AllProperties["__ImagesListId"] as String; Code OK, let’s move to the code. First, a common abstract base class, mainly for inheriting the conversion method: 1: public abstract class SPBaseExpressionBuilder : ExpressionBuilder 2: { 3: #region Protected static methods 4: protected static Object Convert(Object value, PropertyInfo propertyInfo) 5: { 6: if (value != null) 7: { 8: if (propertyInfo.PropertyType.IsAssignableFrom(value.GetType()) == false) 9: { 10: if (propertyInfo.PropertyType.IsEnum == true) 11: { 12: value = Enum.Parse(propertyInfo.PropertyType, value.ToString(), true); 13: } 14: else if (propertyInfo.PropertyType == typeof(String)) 15: { 16: value = value.ToString(); 17: } 18: else if ((typeof(IConvertible).IsAssignableFrom(propertyInfo.PropertyType) == true) && (typeof(IConvertible).IsAssignableFrom(value.GetType()) == true)) 19: { 20: value = System.Convert.ChangeType(value, propertyInfo.PropertyType); 21: } 22: } 23: } 24:  25: return (value); 26: } 27: #endregion 28:  29: #region Public override methods 30: public override CodeExpression GetCodeExpression(BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 31: { 32: if (String.IsNullOrEmpty(entry.Expression) == true) 33: { 34: return (new CodePrimitiveExpression(String.Empty)); 35: } 36: else 37: { 38: return (new CodeMethodInvokeExpression(new CodeMethodReferenceExpression(new CodeTypeReferenceExpression(this.GetType()), "GetValue"), new CodePrimitiveExpression(entry.Expression.Trim()), new CodePropertyReferenceExpression(new CodeArgumentReferenceExpression("entry"), "PropertyInfo"))); 39: } 40: } 41: #endregion 42:  43: #region Public override properties 44: public override Boolean SupportsEvaluate 45: { 46: get 47: { 48: return (true); 49: } 50: } 51: #endregion 52: } Next, the code for each expression builder: 1: [ExpressionPrefix("SPContext")] 2: public class SPContextExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String expression, PropertyInfo propertyInfo) 6: { 7: SPContext context = SPContext.Current; 8: Object expressionValue = DataBinder.Eval(context, expression.Trim().Replace('\'', '"')); 9:  10: expressionValue = Convert(expressionValue, propertyInfo); 11:  12: return (expressionValue); 13: } 14:  15: #endregion 16:  17: #region Public override methods 18: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 19: { 20: return (GetValue(entry.Expression, entry.PropertyInfo)); 21: } 22: #endregion 23: }   1: [ExpressionPrefix("SPFarmProperty")] 2: public class SPFarmPropertyExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String propertyName, PropertyInfo propertyInfo) 6: { 7: Object propertyValue = SPFarm.Local.Properties[propertyName]; 8:  9: propertyValue = Convert(propertyValue, propertyInfo); 10:  11: return (propertyValue); 12: } 13:  14: #endregion 15:  16: #region Public override methods 17: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 18: { 19: return (GetValue(entry.Expression, entry.PropertyInfo)); 20: } 21: #endregion 22: }   1: [ExpressionPrefix("SPField")] 2: public class SPFieldExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String fieldName, PropertyInfo propertyInfo) 6: { 7: Object fieldValue = SPContext.Current.ListItem[fieldName]; 8:  9: fieldValue = Convert(fieldValue, propertyInfo); 10:  11: return (fieldValue); 12: } 13:  14: #endregion 15:  16: #region Public override methods 17: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 18: { 19: return (GetValue(entry.Expression, entry.PropertyInfo)); 20: } 21: #endregion 22: }   1: [ExpressionPrefix("SPIsInAudience")] 2: public class SPIsInAudienceExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String audienceName, PropertyInfo info) 6: { 7: Debugger.Break(); 8: audienceName = audienceName.Trim(); 9:  10: if ((audienceName.StartsWith("'") == true) && (audienceName.EndsWith("'") == true)) 11: { 12: audienceName = audienceName.Substring(1, audienceName.Length - 2); 13: } 14:  15: AudienceManager manager = new AudienceManager(); 16: Object value = manager.IsMemberOfAudience(SPControl.GetContextWeb(HttpContext.Current).CurrentUser.LoginName, audienceName); 17:  18: if (info.PropertyType == typeof(String)) 19: { 20: value = value.ToString(); 21: } 22:  23: return(value); 24: } 25:  26: #endregion 27:  28: #region Public override methods 29: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 30: { 31: return (GetValue(entry.Expression, entry.PropertyInfo)); 32: } 33: #endregion 34: }   1: [ExpressionPrefix("SPIsInGroup")] 2: public class SPIsInGroupExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String groupName, PropertyInfo info) 6: { 7: groupName = groupName.Trim(); 8:  9: if ((groupName.StartsWith("'") == true) && (groupName.EndsWith("'") == true)) 10: { 11: groupName = groupName.Substring(1, groupName.Length - 2); 12: } 13:  14: Object value = SPControl.GetContextWeb(HttpContext.Current).CurrentUser.Groups.OfType<SPGroup>().Any(x => String.Equals(x.Name, groupName, StringComparison.OrdinalIgnoreCase)); 15:  16: if (info.PropertyType == typeof(String)) 17: { 18: value = value.ToString(); 19: } 20:  21: return(value); 22: } 23:  24: #endregion 25:  26: #region Public override methods 27: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 28: { 29: return (GetValue(entry.Expression, entry.PropertyInfo)); 30: } 31: #endregion 32: }   1: [ExpressionPrefix("SPProperty")] 2: public class SPPropertyExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String propertyName, System.Reflection.PropertyInfo propertyInfo) 6: { 7: SPServiceContext serviceContext = SPServiceContext.GetContext(HttpContext.Current); 8: UserProfileManager upm = new UserProfileManager(serviceContext); 9: UserProfile up = upm.GetUserProfile(false); 10: Object propertyValue = (up[propertyName] != null) ? up[propertyName].Value : null; 11:  12: propertyValue = Convert(propertyValue, propertyInfo); 13:  14: return (propertyValue); 15: } 16:  17: #endregion 18:  19: #region Public override methods 20: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 21: { 22: return (GetValue(entry.Expression, entry.PropertyInfo)); 23: } 24: #endregion 25: }   1: [ExpressionPrefix("SPQueryString")] 2: public class SPQueryStringExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String parameterName, PropertyInfo propertyInfo) 6: { 7: Object parameterValue = HttpContext.Current.Request.QueryString[parameterName]; 8:  9: parameterValue = Convert(parameterValue, propertyInfo); 10:  11: return (parameterValue); 12: } 13:  14: #endregion 15:  16: #region Public override methods 17: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 18: { 19: return (GetValue(entry.Expression, entry.PropertyInfo)); 20: } 21: #endregion 22: }   1: [ExpressionPrefix("SPWebProperty")] 2: public class SPWebPropertyExpressionBuilder : SPBaseExpressionBuilder 3: { 4: #region Public static methods 5: public static Object GetValue(String propertyName, PropertyInfo propertyInfo) 6: { 7: Object propertyValue = SPContext.Current.Web.AllProperties[propertyName]; 8:  9: propertyValue = Convert(propertyValue, propertyInfo); 10:  11: return (propertyValue); 12: } 13:  14: #endregion 15:  16: #region Public override methods 17: public override Object EvaluateExpression(Object target, BoundPropertyEntry entry, Object parsedData, ExpressionBuilderContext context) 18: { 19: return (GetValue(entry.Expression, entry.PropertyInfo)); 20: } 21: #endregion 22: } Registration You probably know how to register them, but here it goes again: add this following snippet to your Web.config file, inside the configuration/system.web/compilation/expressionBuilders section: 1: <add expressionPrefix="SPContext" type="MyNamespace.SPContextExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 2: <add expressionPrefix="SPFarmProperty" type="MyNamespace.SPFarmPropertyExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 3: <add expressionPrefix="SPField" type="MyNamespace.SPFieldExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 4: <add expressionPrefix="SPIsInAudience" type="MyNamespace.SPIsInAudienceExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 5: <add expressionPrefix="SPIsInGroup" type="MyNamespace.SPIsInGroupExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 6: <add expressionPrefix="SPProperty" type="MyNamespace.SPPropertyExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 7: <add expressionPrefix="SPQueryString" type="MyNamespace.SPQueryStringExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> 8: <add expressionPrefix="SPWebProperty" type="MyNamespace.SPWebPropertyExpressionBuilder, MyAssembly, Culture=neutral, Version=1.0.0.0, PublicKeyToken=xxx" /> I’ll leave it up to you to figure out the best way to deploy this to your server!

    Read the article

  • problem in loading images from web

    - by Lynnooi
    hi, I am new in android and had developed an app which get images from the website and display it. I got it working in emulator but not in real phones. In some device, it will crash or take very long loading period. Can anyone please help me or guide me in improving it as i'm not sure whether the way i loads the images is correct or not. Here are the code i use to get the images from the web and display accordingly. if (xmlURL.length() != 0) { try { URL url = new URL(xmlURL); SAXParserFactory spf = SAXParserFactory.newInstance(); SAXParser sp = spf.newSAXParser(); /* Get the XMLReader of the SAXParser we created. */ XMLReader xr = sp.getXMLReader(); /* * Create a new ContentHandler and apply it to the * XML-Reader */ xr.setContentHandler(myExampleHandler); /* Parse the xml-data from our URL. */ xr.parse(new InputSource(url.openStream())); /* Parsing has finished. */ /* * Our ExampleHandler now provides the parsed data to * us. */ ParsedExampleDataSet parsedExampleDataSet = myExampleHandler.getParsedData(); } catch (Exception e) { } } if (s.equalsIgnoreCase("wallpapers")) { Context context = helloAndroid.this.getBaseContext(); for (int j = 0; j <= myExampleHandler.filenames.size() - 1; j++) { if (myExampleHandler.filenames.elementAt(j).toString() != null) { helloAndroid.this.ed = myExampleHandler.thumbs.elementAt(j) .toString(); if (helloAndroid.this.ed.length() != 0) { Drawable image = ImageOperations(context, helloAndroid.this.ed, "image.jpg"); file_info = myExampleHandler.filenames .elementAt(j).toString(); author = "\nby " + myExampleHandler.authors.elementAt(j) .toString(); switch (j + 1) { case 1: ImageView imgView1 = new ImageView(context); imgView1 = (ImageView) findViewById(R.id.image1); if (image.getIntrinsicHeight() > 0) { imgView1.setImageDrawable(image); } else imgView1 .setImageResource(R.drawable.empty_wallpaper); tv = (TextView) findViewById(R.id.filename1); tv.setText(file_info); tv = (TextView) findViewById(R.id.author1); tv.setText(author); imgView1 .setOnClickListener(new View.OnClickListener() { public void onClick(View view) { // Perform action on click Intent myIntent1 = new Intent( helloAndroid.this, galleryFile.class); Bundle b = new Bundle(); b.putString("fileID",myExampleHandler.fileid.elementAt(0).toString()); b.putString("page", "1"); b.putString("family", s); b.putString("fi",myExampleHandler.folder_id.elementAt(folder).toString()); b.putString("kw", keyword); myIntent1.putExtras(b); startActivityForResult( myIntent1, 0); } }); break; case 2: ImageView imgView2 = new ImageView(context); imgView2 = (ImageView) findViewById(R.id.image2); imgView2.setImageDrawable(image); tv = (TextView) findViewById(R.id.filename2); tv.setText(file_info); tv = (TextView) findViewById(R.id.author2); tv.setText(author); imgView2 .setOnClickListener(new View.OnClickListener() { public void onClick(View view) { // Perform action on click Intent myIntent1 = new Intent( helloAndroid.this, galleryFile.class); Bundle b = new Bundle(); b.putString("fileID",myExampleHandler.fileid.elementAt(1).toString()); b.putString("page", "1"); b.putString("family", s); b.putString("fi",myExampleHandler.folder_id.elementAt(folder).toString()); b.putString("kw", keyword); myIntent1.putExtras(b); startActivityForResult( myIntent1, 0); } }); break; case 3: //same code break; } } } } } private Drawable ImageOperations(Context ctx, String url, String saveFilename) { try { InputStream is = (InputStream) this.fetch(url); Drawable d = Drawable.createFromStream(is, "src"); return d; } catch (MalformedURLException e) { e.printStackTrace(); return null; } catch (IOException e) { e.printStackTrace(); return null; } } public Object fetch(String address) throws MalformedURLException, IOException { URL url = new URL(address); Object content = url.getContent(); return content; }

    Read the article

  • regular expression to read the string between <title> and </title>

    - by user262325
    Hello every one I hope to read the contents between and in a html string. I think it should be in objective-c @"<title([\\s\\S]*)</title>" below are the codes that rewrited for regular expression //source of NSStringCategory.h #import <Foundation/Foundation.h> #import <regex.h> @interface NSStringCategory:NSObject { regex_t preg; } -(id)initWithPattern:(NSString *)pattern options:(int)options; -(void)dealloc; -(BOOL)matchesString:(NSString *)string; -(NSString *)matchedSubstringOfString:(NSString *)string; -(NSArray *)capturedSubstringsOfString:(NSString *)string; +(NSStringCategory *)regexWithPattern:(NSString *)pattern options:(int)options; +(NSStringCategory *)regexWithPattern:(NSString *)pattern; +(NSString *)null; +(void)initialize; @end @interface NSString (NSStringCategory) -(BOOL)matchedByPattern:(NSString *)pattern options:(int)options; -(BOOL)matchedByPattern:(NSString *)pattern; -(NSString *)substringMatchedByPattern:(NSString *)pattern options:(int)options; -(NSString *)substringMatchedByPattern:(NSString *)pattern; -(NSArray *)substringsCapturedByPattern:(NSString *)pattern options:(int)options; -(NSArray *)substringsCapturedByPattern:(NSString *)pattern; -(NSString *)escapedPattern; @end and .m file #import "NSStringCategory.h" static NSString *nullstring=nil; @implementation NSStringCategory -(id)initWithPattern:(NSString *)pattern options:(int)options { if(self=[super init]) { int err=regcomp(&preg,[pattern UTF8String],options|REG_EXTENDED); if(err) { char errbuf[256]; regerror(err,&preg,errbuf,sizeof(errbuf)); [NSException raise:@"CSRegexException" format:@"Could not compile regex \"%@\": %s",pattern,errbuf]; } } return self; } -(void)dealloc { regfree(&preg); [super dealloc]; } -(BOOL)matchesString:(NSString *)string { if(regexec(&preg,[string UTF8String],0,NULL,0)==0) return YES; return NO; } -(NSString *)matchedSubstringOfString:(NSString *)string { const char *cstr=[string UTF8String]; regmatch_t match; if(regexec(&preg,cstr,1,&match,0)==0) { return [[[NSString alloc] initWithBytes:cstr+match.rm_so length:match.rm_eo-match.rm_so encoding:NSUTF8StringEncoding] autorelease]; } return nil; } -(NSArray *)capturedSubstringsOfString:(NSString *)string { const char *cstr=[string UTF8String]; int num=preg.re_nsub+1; regmatch_t *matches=calloc(sizeof(regmatch_t),num); if(regexec(&preg,cstr,num,matches,0)==0) { NSMutableArray *array=[NSMutableArray arrayWithCapacity:num]; int i; for(i=0;i<num;i++) { NSString *str; if(matches[i].rm_so==-1&&matches[i].rm_eo==-1) str=nullstring; else str=[[[NSString alloc] initWithBytes:cstr+matches[i].rm_so length:matches[i].rm_eo-matches[i].rm_so encoding:NSUTF8StringEncoding] autorelease]; [array addObject:str]; } free(matches); return [NSArray arrayWithArray:array]; } free(matches); return nil; } +(NSStringCategory *)regexWithPattern:(NSString *)pattern options:(int)options { return [[[NSStringCategory alloc] initWithPattern:pattern options:options] autorelease]; } +(NSStringCategory *)regexWithPattern:(NSString *)pattern { return [[[NSStringCategory alloc] initWithPattern:pattern options:0] autorelease]; } +(NSString *)null { return nullstring; } +(void)initialize { if(!nullstring) nullstring=[[NSString alloc] initWithString:@""]; } @end @implementation NSString (NSStringCategory) -(BOOL)matchedByPattern:(NSString *)pattern options:(int)options { NSStringCategory *re=[NSStringCategory regexWithPattern:pattern options:options|REG_NOSUB]; return [re matchesString:self]; } -(BOOL)matchedByPattern:(NSString *)pattern { return [self matchedByPattern:pattern options:0]; } -(NSString *)substringMatchedByPattern:(NSString *)pattern options:(int)options { NSStringCategory *re=[NSStringCategory regexWithPattern:pattern options:options]; return [re matchedSubstringOfString:self]; } -(NSString *)substringMatchedByPattern:(NSString *)pattern { return [self substringMatchedByPattern:pattern options:0]; } -(NSArray *)substringsCapturedByPattern:(NSString *)pattern options:(int)options { NSStringCategory *re=[NSStringCategory regexWithPattern:pattern options:options]; return [re capturedSubstringsOfString:self]; } -(NSArray *)substringsCapturedByPattern:(NSString *)pattern { return [self substringsCapturedByPattern:pattern options:0]; } -(NSString *)escapedPattern { int len=[self length]; NSMutableString *escaped=[NSMutableString stringWithCapacity:len]; for(int i=0;i<len;i++) { unichar c=[self characterAtIndex:i]; if(c=='^'||c=='.'||c=='['||c=='$'||c=='('||c==')' ||c=='|'||c=='*'||c=='+'||c=='?'||c=='{'||c=='\\') [escaped appendFormat:@"\\%C",c]; else [escaped appendFormat:@"%C",c]; } return [NSString stringWithString:escaped]; } @end I use the codes below to get the string between "" and "" NSStringCategory *a=[[NSStringCategory alloc] initWithPattern:@"<title([\s\S]*)</title>" options:0];// Unfortunately [a matchedSubstringOfString:response]] always returns nil I do not if the regular expression is wrong or any other reason. Welcome any comment Thanks interdev

    Read the article

  • JPA behaviour...

    - by Marcel
    Hi I have some trouble understanding a JPA behaviour. Mabye someone could give me a hint. Situation: Product entity: @Entity public class Product implements Serializable { ... @OneToMany(mappedBy="product", fetch=FetchType.EAGER) private List<ProductResource> productResources = new ArrayList<ProductResource>(); .... public List<ProductResource> getProductResources() { return productResources; } public boolean equals(Object obj) { if (obj == this) return true; if (obj == null) return false; if (!(obj instanceof Product)) return false; Product p = (Product) obj; return p.productId == productId; } } Resource entity: @Entity public class Resource implements Serializable { ... @OneToMany(mappedBy="resource", fetch=FetchType.EAGER) private List<ProductResource> productResources = new ArrayList<ProductResource>(); ... public void setProductResource(List<ProductResource> productResource) { this.productResources = productResource; } public List<ProductResource> getProductResources() { return productResources; } public boolean equals(Object obj) { if (obj == this) return true; if (obj == null) return false; if (!(obj instanceof Resource)) return false; Resource r = (Resource) obj; return (long)resourceId==(long)r.resourceId; } } ProductResource Entity: This is a JoinTable (association class) with additional properties (amount). It maps Product and Resources. @Entity public class ProductResource implements Serializable { ... @JoinColumn(nullable=false, updatable=false) @ManyToOne(fetch=FetchType.EAGER, cascade=CascadeType.PERSIST) private Product product; @JoinColumn(nullable=false, updatable=false) @ManyToOne(fetch=FetchType.EAGER, cascade=CascadeType.PERSIST) private Resource resource; private int amount; public void setProduct(Product product) { this.product = product; if(!product.getProductResources().contains((this))){ product.getProductResources().add(this); } } public Product getProduct() { return product; } public void setResource(Resource resource) { this.resource = resource; if(!resource.getProductResources().contains((this))){ resource.getProductResources().add(this); } } public Resource getResource() { return resource; } ... public boolean equals(Object obj) { if (obj == this) return true; if (obj == null) return false; if (!(obj instanceof ProductResource)) return false; ProductResource pr = (ProductResource) obj; return (long)pr.productResourceId == (long)productResourceId; } } This is the Session Bean (running on glassfish). @Stateless(mappedName="PersistenceManager") public class PersistenceManagerBean implements PersistenceManager { @PersistenceContext(unitName = "local_mysql") private EntityManager em; public Object create(Object entity) { em.persist(entity); return entity; } public void delete(Object entity) { em.remove(em.merge(entity)); } public Object retrieve(Class entityClass, Long id) { Object entity = em.find(entityClass, id); return entity; } public void update(Object entity) { em.merge(entity); } } I call the session Bean from a java client: public class Start { public static void main(String[] args) throws NamingException { PersistenceManager pm = (PersistenceManager) new InitialContext().lookup("java:global/BackITServer/PersistenceManagerBean"); ProductResource pr = new ProductResource(); Product p = new Product(); Resource r = new Resource(); pr.setProduct(p); pr.setResource(r); ProductResource pr_stored = (ProductResource) pm.create(pr); pm.delete(pr_stored); Product p_ret = (Product) pm.retrieve(Product.class, pr_stored.getProduct().getProductId()); // prints out true ???????????????????????????????????? System.out.println(p_ret.getProductResources().contains(pr_stored)); } } So here comes my problem. Why is the ProductResource entity still in the List productResources(see code above). The productResource tuple in the db is gone after the deletion and I do newly retrieve the Product entity. If I understood right every method call of the client happens in a new persistence context, but here i obviously get back the non-refreshed product object!? Any help is appreciated Thanks Marcel

    Read the article

  • java: how to compress data into a String and uncompress data from the String

    - by Guillaume
    I want to put some compressed data into a remote repository. To put data on this repository I can only use a method that take the name of the resource and its content as a String. (like data.txt + "hello world"). The repository is moking a filesystem but is not, so I can not use File directly. I want to be able to do the following: client send to server a file 'data.txt' server compress 'data.txt' into data.zip server send to repository content of data.zip repository store data.zip client download from repository data.zip and his able to open it with its favorite zip tool I have tried a lots of compressing example found on the web but each time a send the data to the repository, my resulting zip file is corrupted. Here is a sample class, using the zip*stream and that emulate the repository showcasing my problem. The created zip file is working, but after its 'serialization' it's get corrupted. (the sample class use jakarta commons.io ) Many thanks for your help. package zip; import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.util.zip.ZipEntry; import java.util.zip.ZipInputStream; import java.util.zip.ZipOutputStream; import org.apache.commons.io.FileUtils; /** * Date: May 19, 2010 - 6:13:07 PM * * @author Guillaume AME. */ public class ZipMe { public static void addOrUpdate(File zipFile, File ... files) throws IOException { File tempFile = File.createTempFile(zipFile.getName(), null); // delete it, otherwise you cannot rename your existing zip to it. tempFile.delete(); boolean renameOk = zipFile.renameTo(tempFile); if (!renameOk) { throw new RuntimeException("could not rename the file " + zipFile.getAbsolutePath() + " to " + tempFile.getAbsolutePath()); } byte[] buf = new byte[1024]; ZipInputStream zin = new ZipInputStream(new FileInputStream(tempFile)); ZipOutputStream out = new ZipOutputStream(new FileOutputStream(zipFile)); ZipEntry entry = zin.getNextEntry(); while (entry != null) { String name = entry.getName(); boolean notInFiles = true; for (File f : files) { if (f.getName().equals(name)) { notInFiles = false; break; } } if (notInFiles) { // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(name)); // Transfer bytes from the ZIP file to the output file int len; while ((len = zin.read(buf)) > 0) { out.write(buf, 0, len); } } entry = zin.getNextEntry(); } // Close the streams zin.close(); // Compress the files if (files != null) { for (File file : files) { InputStream in = new FileInputStream(file); // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(file.getName())); // Transfer bytes from the file to the ZIP file int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } // Complete the entry out.closeEntry(); in.close(); } // Complete the ZIP file } tempFile.delete(); out.close(); } public static void main(String[] args) throws IOException { final String zipArchivePath = "c:/temp/archive.zip"; final String tempFilePath = "c:/temp/data.txt"; final String resultZipFile = "c:/temp/resultingArchive.zip"; File zipArchive = new File(zipArchivePath); FileUtils.touch(zipArchive); File tempFile = new File(tempFilePath); FileUtils.writeStringToFile(tempFile, "hello world"); addOrUpdate(zipArchive, tempFile); //archive.zip exists and contains a compressed data.txt that can be read using winrar //now simulate writing of the zip into a in memory cache String archiveText = FileUtils.readFileToString(zipArchive); FileUtils.writeStringToFile(new File(resultZipFile), archiveText); //resultingArchive.zip exists, contains a compressed data.txt, but it can not //be read using winrar: CRC failed in data.txt. The file is corrupt } }

    Read the article

  • How do I create an instance of this class in Android?

    - by Lloyd Banks
    I was wondering if it is possible to create an instance of this class (from the link, which creates a listview) from another class so that I can call on either lazyadapter.java or customizedlistview.java (not sure which one) to inflate that same listview. Is this possible? This is what I tried (obviously incorrect): CustomizedListView clv = new CustomizedListView(); clv.onCreate(...); source: http://www.androidhive.info/2012/02/android-custom-listview-with-image-and-text/ LazyAdapter.java import java.util.ArrayList; import java.util.HashMap; import android.app.Activity; import android.content.Context; import android.view.LayoutInflater; import android.view.View; import android.view.ViewGroup; import android.widget.BaseAdapter; import android.widget.ImageView; import android.widget.TextView; public class LazyAdapter extends BaseAdapter { private Activity activity; private ArrayList&lt;HashMap&lt;String, String&gt;&gt; data; private static LayoutInflater inflater=null; public ImageLoader imageLoader; public LazyAdapter(Activity a, ArrayList&lt;HashMap&lt;String, String&gt;&gt; d) { activity = a; data=d; inflater = (LayoutInflater)activity.getSystemService(Context.LAYOUT_INFLATER_SERVICE); imageLoader=new ImageLoader(activity.getApplicationContext()); } public int getCount() { return data.size(); } public Object getItem(int position) { return position; } public long getItemId(int position) { return position; } public View getView(int position, View convertView, ViewGroup parent) { View vi=convertView; if(convertView==null) vi = inflater.inflate(R.layout.list_row, null); TextView title = (TextView)vi.findViewById(R.id.title); // title TextView artist = (TextView)vi.findViewById(R.id.artist); // artist name TextView duration = (TextView)vi.findViewById(R.id.duration); // duration ImageView thumb_image=(ImageView)vi.findViewById(R.id.list_image); // thumb image HashMap&lt;String, String&gt; song = new HashMap&lt;String, String&gt;(); song = data.get(position); // Setting all values in listview title.setText(song.get(CustomizedListView.KEY_TITLE)); artist.setText(song.get(CustomizedListView.KEY_ARTIST)); duration.setText(song.get(CustomizedListView.KEY_DURATION)); imageLoader.DisplayImage(song.get(CustomizedListView.KEY_THUMB_URL), thumb_image); return vi; } } CustomizedListView.java import java.util.ArrayList; import java.util.HashMap; import org.w3c.dom.Document; import org.w3c.dom.Element; import org.w3c.dom.NodeList; import android.app.Activity; import android.os.Bundle; import android.view.View; import android.widget.AdapterView; import android.widget.AdapterView.OnItemClickListener; import android.widget.ListView; public class CustomizedListView extends Activity { // All static variables static final String URL = "http://api.androidhive.info/music/music.xml"; // XML node keys static final String KEY_SONG = "song"; // parent node static final String KEY_ID = "id"; static final String KEY_TITLE = "title"; static final String KEY_ARTIST = "artist"; static final String KEY_DURATION = "duration"; static final String KEY_THUMB_URL = "thumb_url"; ListView list; LazyAdapter adapter; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); ArrayList&lt;HashMap&lt;String, String&gt;&gt; songsList = new ArrayList&lt;HashMap&lt;String, String&gt;&gt;(); XMLParser parser = new XMLParser(); String xml = parser.getXmlFromUrl(URL); // getting XML from URL Document doc = parser.getDomElement(xml); // getting DOM element NodeList nl = doc.getElementsByTagName(KEY_SONG); // looping through all song nodes &lt;song&gt; for (int i = 0; i &lt; nl.getLength(); i++) { // creating new HashMap HashMap&lt;String, String&gt; map = new HashMap&lt;String, String&gt;(); Element e = (Element) nl.item(i); // adding each child node to HashMap key =&gt; value map.put(KEY_ID, parser.getValue(e, KEY_ID)); map.put(KEY_TITLE, parser.getValue(e, KEY_TITLE)); map.put(KEY_ARTIST, parser.getValue(e, KEY_ARTIST)); map.put(KEY_DURATION, parser.getValue(e, KEY_DURATION)); map.put(KEY_THUMB_URL, parser.getValue(e, KEY_THUMB_URL)); // adding HashList to ArrayList songsList.add(map); } list=(ListView)findViewById(R.id.list); // Getting adapter by passing xml data ArrayList adapter=new LazyAdapter(this, songsList); list.setAdapter(adapter); // Click event for single list row list.setOnItemClickListener(new OnItemClickListener() { @Override public void onItemClick(AdapterView&lt;?&gt; parent, View view, int position, long id) { } }); } }

    Read the article

  • Answers to Your Common Oracle Database Lifecycle Management Questions

    - by Scott McNeil
    We recently ran a live webcast on Strategies for Managing Oracle Database's Lifecycle. There were tons of questions from our audience that we simply could not get to during the hour long presentation. Below are some of those questions along with their answers. Enjoy! Question: In the webcast the presenter talked about “gold” configuration standards, for those who want to use this technique, could you recommend a best practice to consider or follow? How do I get started? Answer:Gold configuration standardization is a quick and easy way to improve availability through consistency. Start by choosing a reference database and saving the configuration to the Oracle Enterprise Manager repository using the Save Configuration feature. Next create a comparison template using the Oracle provided template as a starting point and modify the ignored properties to eliminate expected differences in your environment. Finally create a comparison specification using the comparison template you created plus your saved gold configuration and schedule it to run on a regular basis. Don’t forget to fill in the email addresses of those you want to notify upon drift detection. Watch the database configuration management demo to learn more. Question: Can Oracle Lifecycle Management Pack for Database help with patching an Oracle Real Application Cluster (RAC) environment? Answer: Yes, Oracle Enterprise Manager supports both parallel and rolling patch application of Oracle Real Application Clusters. The use of rolling patching is recommended as there is no downtime involved. For more details watch this demo. Question: What are some of the things administrators can do to control configuration drift? Why is it important? Answer:Configuration drift is one of the main causes of instability and downtime of applications. Oracle Enterprise Manager makes it easy to manage and control drift using scheduled configuration comparisons combined with comparison templates. Question: Does Oracle Enterprise Manager 12c Release 2 offer an incremental update feature for "gold" images? For instance, if the source binary has a higher PSU level, what is the best approach to update the existing "gold" image in the software library? Do you have to create a new image or can you just update the original one? Answer:Provisioning Profiles (Gold images) can contain the installation files and database configuration templates. Although it is possible to make some changes to the profile after creation (mainly to configuration), it is normally recommended to simply create a new profile after applying a patch to your reference database. Question: The webcast talked about enforcing in-house standards, does Oracle Enterprise Manager 12c offer verification of your databases and systems to those standards? For example, the initial "gold" image has been massively deployed over time, and there may be some changes to it. How can you do regular checks from Enterprise Manager to ensure the in-house standards are being enforced? Answer:There are really two methods to validate conformity to standards. The first method is to use gold standards which you compare other databases to report unwanted differences. This method uses a new comparison template technology which allows users to ignore known differences (i.e. SID, Start time, etc) which results in a report only showing important or non-conformant differences. This method is quick to setup and configure and recommended for those who want to get started validating compliance quickly. The second method leverages the new compliance framework which allows the creation of specific and robust validations. These compliance rules are grouped into standards which can be assigned to databases quickly and easily. Compliance rules allow for targeted and more sophisticated validation beyond the basic equals operation available in the comparison method. The compliance framework can be used to implement just about any internal or industry standard. The compliance results will track current and historic compliance scores at the overall and individual database targets. When the issue is resolved, the score is automatically affected. Compliance framework is the recommended long term solution for validating compliance using Oracle Enterprise Manager 12c. Check out this demo on database compliance to learn more. Question: If you are using the integration between Oracle Enterprise Manager and My Oracle Support in an "offline" mode, how do you know if you have the latest My Oracle Support metadata? Answer:In Oracle Enterprise Manager 12c Release 2, you now only need to download one zip file containing all of the metadata xmls files. There is no indication that the metadata has changed but you could run a checksum on the file and compare it to the previously downloaded version to see if it has changed. Question: What happens if a patch fails while administrators are applying it to a database or system? Answer:A large portion of Oracle Enterprise Manager's patch automation is the pre-requisite checks that happen to ensure the highest level of confidence the patch will successfully apply. It is recommended you test the patch in a non-production environment and save the patch plan as a template once successful so you can create new plans using the saved template. If you are using the recommended ‘out of place’ patching methodology, there is no urgency because the database is still running as the cloned Oracle home is being patched. Users can address the issue and restart the patch procedure at the point it left off. If you are using 'in place' method, you can address the issue and continue where the procedure left off. Question: Can Oracle Enterprise Manager 12c R2 compare configurations between more than one target at the same time? Answer:Oracle Enterprise Manager 12c can compare any number of target configurations at one time. This is the basis of many important use cases including Configuration Drift Management. These comparisons can also be scheduled on a regular basis and emails notification sent should any differences appear. To learn more about configuration search and compare watch this demo. Question: How is data comparison done since changes are taking place in a live production system? Answer:There are many things to keep in mind when using the data comparison feature (as part of the Change Management ability to compare table data). It was primarily intended to be used for maintaining consistency of important but relatively static data. For example, application seed data and application setup configuration. This data does not change often but is critical when testing an application to ensure results are consistent with production. It is not recommended to use data comparison on highly dynamic data like transactional tables or very large tables. Question: Which versions of Oracle Database can be monitored through Oracle Enterprise Manager 12c? Answer:Oracle Database versions: 9.2.0.8, 10.1.0.5, 10.2.0.4, 10.2.0.5, 11.1.0.7, 11.2.0.1, 11.2.0.2, 11.2.0.3. Watch the On-Demand Webcast Stay Connected: Twitter | Facebook | YouTube | Linkedin | NewsletterDownload the Oracle Enterprise Manager Cloud Control12c Mobile app

    Read the article

  • Two-way databinding of a custom templated asp.net control

    - by Jason
    I hate long code snippets and I'm sorry about this one, but it turns out that this asp.net stuff can't get much shorter and it's so specific that I haven't been able to generalize it without a full code listing. I just want simple two-way, declarative, edit-only databinding to a single instance of an object. Not a list of objects of a type with a bunch of NotImplementedExceptions for Add, Delete, and Select, but just a single view-state persisted object. This is certainly something that can be done but I've struggled with an implementation for years. This newest, closest implementation was inspired by this article from 4-Guys-From-Rolla. Unfortunately, after implementing, I'm getting the following error and I don't know what I'm missing: System.InvalidOperationException: Databinding methods such as Eval(), XPath(), and Bind() can only be used in the context of a databound control. If I don't use Bind(), and only use Eval() functionality, it works. In that way, the error is especially confusing. Update: Actually, using Eval() does NOT work, but using <%# Container.SampleString %> works. However, Eval("SampleString") gives the same error. That leads me back to this article I found earlier but had discarded. Now I believe it might be related, though I haven't cracked it yet ... Here's the simplified codeset that still produces the error: using System.ComponentModel; namespace System.Web.UI.WebControls.Special { public class SampleFormData { public string SampleString = "Sample String Data"; public int SampleInt = -1; } [ToolboxItem(false)] public class SampleSpecificFormDataContainer : DataBoundControl, INamingContainer { SampleSpecificEntryForm entryForm; internal SampleSpecificEntryForm EntryForm { get { return entryForm; } } [Bindable(true), Category("Data")] public string SampleString { get { return entryForm.FormData.SampleString; } set { entryForm.FormData.SampleString = value; } } [Bindable(true), Category("Data")] public int SampleInt { get { return entryForm.FormData.SampleInt; } set { entryForm.FormData.SampleInt = value; } } internal SampleSpecificFormDataContainer(SampleSpecificEntryForm entryForm) { this.entryForm = entryForm; } } public class SampleSpecificEntryForm : WebControl, INamingContainer { #region Template private IBindableTemplate formTemplate = null; [Browsable(false), DefaultValue(null), TemplateContainer(typeof(SampleSpecificFormDataContainer), ComponentModel.BindingDirection.TwoWay), PersistenceMode(PersistenceMode.InnerProperty)] public virtual IBindableTemplate FormTemplate { get { return formTemplate; } set { formTemplate = value; } } #endregion #region Viewstate SampleFormData FormDataVS { get { return (ViewState["FormData"] as SampleFormData) ?? new SampleFormData(); } set { ViewState["FormData"] = value; SaveViewState(); } } #endregion public override ControlCollection Controls { get { EnsureChildControls(); return base.Controls; } } private SampleSpecificFormDataContainer formDataContainer = null; [Browsable(false), DesignerSerializationVisibility(DesignerSerializationVisibility.Hidden)] public SampleSpecificFormDataContainer FormDataContainer { get { EnsureChildControls(); return formDataContainer; } } [Bindable(true), Browsable(false)] public SampleFormData FormData { get { return FormDataVS; } set { FormDataVS = value; } } protected override void CreateChildControls() { if (!this.ChildControlsCreated) { Controls.Clear(); formDataContainer = new SampleSpecificFormDataContainer(this); Controls.Add(formDataContainer); FormTemplate.InstantiateIn(formDataContainer); this.ChildControlsCreated = true; } } public override void DataBind() { CreateChildControls(); base.DataBind(); } } } With an ASP.NET page the following: <%@ Page Title="Home Page" Language="C#" MasterPageFile="~/Site.master" AutoEventWireup="true" CodeBehind="Default2.aspx.cs" Inherits="EntryFormTest._Default2" EnableEventValidation="false" %> <%@ Register Assembly="EntryForm" Namespace="System.Web.UI.WebControls.Special" TagPrefix="cc1" %> <asp:Content ID="HeaderContent" runat="server" ContentPlaceHolderID="HeadContent"> </asp:Content> <asp:Content ID="BodyContent" runat="server" ContentPlaceHolderID="MainContent"> <h2> Welcome to ASP.NET! </h2> <cc1:SampleSpecificEntryForm ID="EntryForm1" runat="server"> <FormTemplate> <asp:TextBox ID="TextBox1" runat="server" Text='<%# Bind("SampleString") %>'></asp:TextBox><br /> <h3>(<%# Container.SampleString %>)</h3><br /> <asp:Button ID="Button1" runat="server" Text="Button" /> </FormTemplate> </cc1:SampleSpecificEntryForm> </asp:Content> Default2.aspx.cs using System; namespace EntryFormTest { public partial class _Default2 : System.Web.UI.Page { protected void Page_Load(object sender, EventArgs e) { EntryForm1.DataBind(); } } } Thanks for any help!

    Read the article

  • Converting Encrypted Values

    - by Johnm
    Your database has been protecting sensitive data at rest using the cell-level encryption features of SQL Server for quite sometime. The employees in the auditing department have been inviting you to their after-work gatherings and buying you drinks. Thousands of customers implicitly include you in their prayers of thanks giving as their identities remain safe in your company's database. The cipher text resting snuggly in a column of the varbinary data type is great for security; but it can create some interesting challenges when interacting with other data types such as the XML data type. The XML data type is one that is often used as a message type for the Service Broker feature of SQL Server. It also can be an interesting data type to capture for auditing or integrating with external systems. The challenge that cipher text presents is that the need for decryption remains even after it has experienced its XML metamorphosis. Quite an interesting challenge nonetheless; but fear not. There is a solution. To simulate this scenario, we first will want to create a plain text value for us to encrypt. We will do this by creating a variable to store our plain text value: -- set plain text value DECLARE @PlainText NVARCHAR(255); SET @PlainText = 'This is plain text to encrypt'; The next step will be to create a variable that will store the cipher text that is generated from the encryption process. We will populate this variable by using a pre-defined symmetric key and certificate combination: -- encrypt plain text value DECLARE @CipherText VARBINARY(MAX); OPEN SYMMETRIC KEY SymKey     DECRYPTION BY CERTIFICATE SymCert     WITH PASSWORD='mypassword2010';     SET @CipherText = EncryptByKey                          (                            Key_GUID('SymKey'),                            @PlainText                           ); CLOSE ALL SYMMETRIC KEYS; The value of our newly generated cipher text is 0x006E12933CBFB0469F79ABCC79A583--. This will be important as we reference our cipher text later in this post. Our final step in preparing our scenario is to create a table variable to simulate the existence of a table that contains a column used to hold encrypted values. Once this table variable has been created, populate the table variable with the newly generated cipher text: -- capture value in table variable DECLARE @tbl TABLE (EncVal varbinary(MAX)); INSERT INTO @tbl (EncVal) VALUES (@CipherText); We are now ready to experience the challenge of capturing our encrypted column in an XML data type using the FOR XML clause: -- capture set in xml DECLARE @xml XML; SET @xml = (SELECT               EncVal             FROM @tbl AS MYTABLE             FOR XML AUTO, BINARY BASE64, ROOT('root')); If you add the SELECT @XML statement at the end of this portion of the code you will see the contents of the XML data in its raw format: <root>   <MYTABLE EncVal="AG4Skzy/sEafeavMeaWDBwEAAACE--" /> </root> Strangely, the value that is captured appears nothing like the value that was created through the encryption process. The result being that when this XML is converted into a readable data set the encrypted value will not be able to be decrypted, even with access to the symmetric key and certificate used to perform the decryption. An immediate thought might be to convert the varbinary data type to either a varchar or nvarchar before creating the XML data. This approach makes good sense. The code for this might look something like the following: -- capture set in xml DECLARE @xml XML; SET @xml = (SELECT              CONVERT(NVARCHAR(MAX),EncVal) AS EncVal             FROM @tbl AS MYTABLE             FOR XML AUTO, BINARY BASE64, ROOT('root')); However, this results in the following error: Msg 9420, Level 16, State 1, Line 26 XML parsing: line 1, character 37, illegal xml character A quick query that returns CONVERT(NVARCHAR(MAX),EncVal) reveals that the value that is causing the error looks like something off of a genuine Chinese menu. While this situation does present us with one of those spine-tingling, expletive-generating challenges, rest assured that this approach is on the right track. With the addition of the "style" argument to the CONVERT method, our solution is at hand. When dealing with converting varbinary data types we have three styles available to us: - The first is to not include the style parameter, or use the value of "0". As we see, this style will not work for us. - The second option is to use the value of "1" will keep our varbinary value including the "0x" prefix. In our case, the value will be 0x006E12933CBFB0469F79ABCC79A583-- - The third option is to use the value of "2" which will chop the "0x" prefix off of our varbinary value. In our case, the value will be 006E12933CBFB0469F79ABCC79A583-- Since we will want to convert this back to varbinary when reading this value from the XML data we will want the "0x" prefix, so we will want to change our code as follows: -- capture set in xml DECLARE @xml XML; SET @xml = (SELECT              CONVERT(NVARCHAR(MAX),EncVal,1) AS EncVal             FROM @tbl AS MYTABLE             FOR XML AUTO, BINARY BASE64, ROOT('root')); Once again, with the inclusion of the SELECT @XML statement at the end of this portion of the code you will see the contents of the XML data in its raw format: <root>   <MYTABLE EncVal="0x006E12933CBFB0469F79ABCC79A583--" /> </root> Nice! We are now cooking with gas. To continue our scenario, we will want to parse the XML data into a data set so that we can glean our freshly captured cipher text. Once we have our cipher text snagged we will capture it into a variable so that it can be used during decryption: -- read back xml DECLARE @hdoc INT; DECLARE @EncVal NVARCHAR(MAX); EXEC sp_xml_preparedocument @hDoc OUTPUT, @xml; SELECT @EncVal = EncVal FROM OPENXML (@hdoc, '/root/MYTABLE') WITH ([EncVal] VARBINARY(MAX) '@EncVal'); EXEC sp_xml_removedocument @hDoc; Finally, the decryption of our cipher text using the DECRYPTBYKEYAUTOCERT method and the certificate utilized to perform the encryption earlier in our exercise: SELECT     CONVERT(NVARCHAR(MAX),                     DecryptByKeyAutoCert                          (                            CERT_ID('AuditLogCert'),                            N'mypassword2010',                            @EncVal                           )                     ) EncVal; Ah yes, another hurdle presents itself! The decryption produced the value of NULL which in cryptography means that either you don't have permissions to decrypt the cipher text or something went wrong during the decryption process (ok, sometimes the value is actually NULL; but not in this case). As we see, the @EncVal variable is an nvarchar data type. The third parameter of the DECRYPTBYKEYAUTOCERT method requires a varbinary value. Therefore we will need to utilize our handy-dandy CONVERT method: SELECT     CONVERT(NVARCHAR(MAX),                     DecryptByKeyAutoCert                          (                             CERT_ID('AuditLogCert'),                             N'mypassword2010',                             CONVERT(VARBINARY(MAX),@EncVal)                           )                     ) EncVal; Oh, almost. The result remains NULL despite our conversion to the varbinary data type. This is due to the creation of an varbinary value that does not reflect the actual value of our @EncVal variable; but rather a varbinary conversion of the variable itself. In this case, something like 0x3000780030003000360045003--. Considering the "style" parameter got us past XML challenge, we will want to consider its power for this challenge as well. Knowing that the value of "1" will provide us with the actual value including the "0x", we will opt to utilize that value in this case: SELECT     CONVERT(NVARCHAR(MAX),                     DecryptByKeyAutoCert                          (                            CERT_ID('SymCert'),                            N'mypassword2010',                            CONVERT(VARBINARY(MAX),@EncVal,1)                           )                     ) EncVal; Bingo, we have success! We have discovered what happens with varbinary data when captured as XML data. We have figured out how to make this data useful post-XML-ification. Best of all we now have a choice in after-work parties now that our very happy client who depends on our XML based interface invites us for dinner in celebration. All thanks to the effective use of the style parameter.

    Read the article

  • MVVM - implementing 'IsDirty' functionality to a ModelView in order to save data

    - by Brendan
    Hi, Being new to WPF & MVVM I struggling with some basic functionality. Let me first explain what I am after, and then attach some example code... I have a screen showing a list of users, and I display the details of the selected user on the right-hand side with editable textboxes. I then have a Save button which is DataBound, but I would only like this button to display when data has actually changed. ie - I need to check for "dirty data". I have a fully MVVM example in which I have a Model called User: namespace Test.Model { class User { public string UserName { get; set; } public string Surname { get; set; } public string Firstname { get; set; } } } Then, the ViewModel looks like this: using System.Collections.ObjectModel; using System.Collections.Specialized; using System.Windows.Input; using Test.Model; namespace Test.ViewModel { class UserViewModel : ViewModelBase { //Private variables private ObservableCollection<User> _users; RelayCommand _userSave; //Properties public ObservableCollection<User> User { get { if (_users == null) { _users = new ObservableCollection<User>(); //I assume I need this Handler, but I am stuggling to implement it successfully //_users.CollectionChanged += HandleChange; //Populate with users _users.Add(new User {UserName = "Bob", Firstname="Bob", Surname="Smith"}); _users.Add(new User {UserName = "Smob", Firstname="John", Surname="Davy"}); } return _users; } } //Not sure what to do with this?!?! //private void HandleChange(object sender, NotifyCollectionChangedEventArgs e) //{ // if (e.Action == NotifyCollectionChangedAction.Remove) // { // foreach (TestViewModel item in e.NewItems) // { // //Removed items // } // } // else if (e.Action == NotifyCollectionChangedAction.Add) // { // foreach (TestViewModel item in e.NewItems) // { // //Added items // } // } //} //Commands public ICommand UserSave { get { if (_userSave == null) { _userSave = new RelayCommand(param => this.UserSaveExecute(), param => this.UserSaveCanExecute); } return _userSave; } } void UserSaveExecute() { //Here I will call my DataAccess to actually save the data } bool UserSaveCanExecute { get { //This is where I would like to know whether the currently selected item has been edited and is thus "dirty" return false; } } //constructor public UserViewModel() { } } } The "RelayCommand" is just a simple wrapper class, as is the "ViewModelBase". (I'll attach the latter though just for clarity) using System; using System.ComponentModel; namespace Test.ViewModel { public abstract class ViewModelBase : INotifyPropertyChanged, IDisposable { protected ViewModelBase() { } public event PropertyChangedEventHandler PropertyChanged; protected virtual void OnPropertyChanged(string propertyName) { PropertyChangedEventHandler handler = this.PropertyChanged; if (handler != null) { var e = new PropertyChangedEventArgs(propertyName); handler(this, e); } } public void Dispose() { this.OnDispose(); } protected virtual void OnDispose() { } } } Finally - the XAML <Window x:Class="Test.MainWindow" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:vm="clr-namespace:Test.ViewModel" Title="MainWindow" Height="350" Width="525"> <Window.DataContext> <vm:UserViewModel/> </Window.DataContext> <Grid> <ListBox Height="238" HorizontalAlignment="Left" Margin="12,12,0,0" Name="listBox1" VerticalAlignment="Top" Width="197" ItemsSource="{Binding Path=User}" IsSynchronizedWithCurrentItem="True"> <ListBox.ItemTemplate> <DataTemplate> <StackPanel> <TextBlock Text="{Binding Path=Firstname}"/> <TextBlock Text="{Binding Path=Surname}"/> </StackPanel> </DataTemplate> </ListBox.ItemTemplate> </ListBox> <Label Content="Username" Height="28" HorizontalAlignment="Left" Margin="232,16,0,0" Name="label1" VerticalAlignment="Top" /> <TextBox Height="23" HorizontalAlignment="Left" Margin="323,21,0,0" Name="textBox1" VerticalAlignment="Top" Width="120" Text="{Binding Path=User/UserName}" /> <Label Content="Surname" Height="28" HorizontalAlignment="Left" Margin="232,50,0,0" Name="label2" VerticalAlignment="Top" /> <TextBox Height="23" HorizontalAlignment="Left" Margin="323,52,0,0" Name="textBox2" VerticalAlignment="Top" Width="120" Text="{Binding Path=User/Surname}" /> <Label Content="Firstname" Height="28" HorizontalAlignment="Left" Margin="232,84,0,0" Name="label3" VerticalAlignment="Top" /> <TextBox Height="23" HorizontalAlignment="Left" Margin="323,86,0,0" Name="textBox3" VerticalAlignment="Top" Width="120" Text="{Binding Path=User/Firstname}" /> <Button Content="Button" Height="23" HorizontalAlignment="Left" Margin="368,159,0,0" Name="button1" VerticalAlignment="Top" Width="75" Command="{Binding Path=UserSave}" /> </Grid> </Window> So basically, when I edit a surname, the Save button should be enabled; and if I undo my edit - well then it should be Disabled again as nothing has changed. I have seen this in many examples, but have not yet found out how to do it. Any help would be much appreciated! Brendan

    Read the article

  • Partner Blog Series: PwC Perspectives - Looking at R2 for Customer Organizations

    - by Tanu Sood
    Welcome to the first of our partner blog series. November Mondays are all about PricewaterhouseCoopers' perespective on Identity and R2. In this series, we have identity management experts from PricewaterhouseCoopers (PwC) share their perspective on (and experiences with) the recent identity management release, Oracle Identity Management R2. The purpose of the series is to discuss real world identity use cases that helped shape the innovations in the recent R2 release and the implementation strategies that customers are employing today with expertise from PwC. Part 1: Looking at R2 for Customer Organizations In this inaugural post, we will discuss some of the new features of the R2 release of Oracle Identity Manager that some of our customer organizations are implementing today and the business rationale for those. Oracle's R2 Security portfolio represents a solid step forward for a platform that is already market-leading.  Prior to R2, Oracle was an industry titan in security with reliable products, expansive compatibility, and a large customer base.  Oracle has taken their identity platform to the next level in their latest version, R2.  The new features include a customizable UI, a request catalog, flexible security, and enhancements for its connectors, and more. Oracle customers will be impressed by the new Oracle Identity Manager (OIM) business-friendly UI.  Without question, Oracle has invested significant time in responding to customer feedback about making access requests and related activities easier for non-IT users.  The flexibility to add information to screens, hide fields that are not important to a particular customer, and adjust web themes to suit a company's preference make Oracle's Identity Manager stand out among its peers.  Customers can also expect to carry UI configurations forward with minimal migration effort to future versions of OIM.  Oracle's flexible UI will benefit many organizations looking for a customized feel with out-of-the-box configurations. Organizations looking to extend their services to end users will benefit significantly from new usability features like OIM’s ‘Catalog.’  Customers familiar with Oracle Identity Analytics' 'Glossary' feature will be able to relate to the concept.  It will enable Roles, Entitlements, Accounts, and Resources to be requested through the out-of-the-box UI.  This is an industry-changing feature as customers can make the process to request access easier than ever.  For additional ease of use, Oracle has introduced a shopping cart style request interface that further simplifies the experience for end users.  Common requests can be setup as profiles to save time.  All of this is combined with the approval workflow engine introduced in R1 that provides the flexibility customers need to meet their compliance requirements. Enhanced security was also on the list of features Oracle wanted to deliver to its customers.  The new end-user UI provides additional granular access controls.  Common Help Desk use cases can be implemented with ease by updating the application profiles.  Access can be rolled out so that administrators can only manage a certain department or organization.  Further, OIM can be more easily configured to select which fields can be read-only vs. updated.  Finally, this security model can be used to limit search results for roles and entitlements intended for a particular department.  Every customer has a different need for access and OIM now matches this need with a flexible security model. One of the important considerations when selecting an Identity Management platform is compatibility.  The number of supported platform connectors and how well it can integrate with non-supported platforms is a key consideration for selecting an identity suite.  Oracle has a long list of supported connectors.  When a customer has a requirement for a platform not on that list, Oracle has a solution too.  Oracle is introducing a simplified architecture called Identity Connector Framework (ICF), which holds the potential to simplify custom connectors.  Finally, Oracle has introduced a simplified process to profile new disconnected applications from the web browser.  This is a useful feature that enables administrators to profile applications quickly as well as empowering the application owner to fulfill requests from their web browser.  Support will still be available for connectors based on previous versions in R2. Oracle Identity Manager's new R2 version has delivered many new features customers have been asking for.  Oracle has matured their platform with R2, making it a truly distinctive platform among its peers. In our next post, expect a deep dive into use cases for a customer considering R2 as their new Enterprise identity solution. In the meantime, we look forward to hearing from you about the specific challenges you are facing and your experience in solving those. Meet the Writers Dharma Padala is a Director in the Advisory Security practice within PwC.  He has been implementing medium to large scale Identity Management solutions across multiple industries including utility, health care, entertainment, retail and financial sectors.   Dharma has 14 years of experience in delivering IT solutions out of which he has been implementing Identity Management solutions for the past 8 years. Scott MacDonald is a Director in the Advisory Security practice within PwC.  He has consulted for several clients across multiple industries including financial services, health care, automotive and retail.   Scott has 10 years of experience in delivering Identity Management solutions. John Misczak is a member of the Advisory Security practice within PwC.  He has experience implementing multiple Identity and Access Management solutions, specializing in Oracle Identity Manager and Business Process Engineering Language (BPEL). Jenny (Xiao) Zhang is a member of the Advisory Security practice within PwC.  She has consulted across multiple industries including financial services, entertainment and retail. Jenny has three years of experience in delivering IT solutions out of which she has been implementing Identity Management solutions for the past one and a half years. Praveen Krishna is a Manager in the Advisory  Security practice within PwC.  Over the last decade Praveen has helped clients plan, architect and implement Oracle identity solutions across diverse industries.  His experience includes delivering security across diverse topics like network, infrastructure, application and data where he brings a holistic point of view to problem solving.

    Read the article

  • java: how to get a string representation of a compressed byte array ?

    - by Guillaume
    I want to put some compressed data into a remote repository. To put data on this repository I can only use a method that take the name of the resource and its content as a String. (like data.txt + "hello world"). The repository is moking a filesystem but is not, so I can not use File directly. I want to be able to do the following: client send to server a file 'data.txt' server compress 'data.txt' into a compressed file 'data.zip' server send a string representation of data.zip to the repository repository store data.zip client download from repository data.zip and his able to open it with its favorite zip tool The problem arise at step 3 when I try to get a string representation of my compressed file. Here is a sample class, using the zip*stream and that emulate the repository showcasing my problem. The created zip file is working, but after its 'serialization' it's get corrupted. (the sample class use jakarta commons.io ) Many thanks for your help. package zip; import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.util.zip.ZipEntry; import java.util.zip.ZipInputStream; import java.util.zip.ZipOutputStream; import org.apache.commons.io.FileUtils; /** * Date: May 19, 2010 - 6:13:07 PM * * @author Guillaume AME. */ public class ZipMe { public static void addOrUpdate(File zipFile, File ... files) throws IOException { File tempFile = File.createTempFile(zipFile.getName(), null); // delete it, otherwise you cannot rename your existing zip to it. tempFile.delete(); boolean renameOk = zipFile.renameTo(tempFile); if (!renameOk) { throw new RuntimeException("could not rename the file " + zipFile.getAbsolutePath() + " to " + tempFile.getAbsolutePath()); } byte[] buf = new byte[1024]; ZipInputStream zin = new ZipInputStream(new FileInputStream(tempFile)); ZipOutputStream out = new ZipOutputStream(new FileOutputStream(zipFile)); ZipEntry entry = zin.getNextEntry(); while (entry != null) { String name = entry.getName(); boolean notInFiles = true; for (File f : files) { if (f.getName().equals(name)) { notInFiles = false; break; } } if (notInFiles) { // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(name)); // Transfer bytes from the ZIP file to the output file int len; while ((len = zin.read(buf)) > 0) { out.write(buf, 0, len); } } entry = zin.getNextEntry(); } // Close the streams zin.close(); // Compress the files if (files != null) { for (File file : files) { InputStream in = new FileInputStream(file); // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(file.getName())); // Transfer bytes from the file to the ZIP file int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } // Complete the entry out.closeEntry(); in.close(); } // Complete the ZIP file } tempFile.delete(); out.close(); } public static void main(String[] args) throws IOException { final String zipArchivePath = "c:/temp/archive.zip"; final String tempFilePath = "c:/temp/data.txt"; final String resultZipFile = "c:/temp/resultingArchive.zip"; File zipArchive = new File(zipArchivePath); FileUtils.touch(zipArchive); File tempFile = new File(tempFilePath); FileUtils.writeStringToFile(tempFile, "hello world"); addOrUpdate(zipArchive, tempFile); //archive.zip exists and contains a compressed data.txt that can be read using winrar //now simulate writing of the zip into a in memory cache String archiveText = FileUtils.readFileToString(zipArchive); FileUtils.writeStringToFile(new File(resultZipFile), archiveText); //resultingArchive.zip exists, contains a compressed data.txt, but it can not //be read using winrar: CRC failed in data.txt. The file is corrupt } }

    Read the article

  • Inheritance Mapping Strategies with Entity Framework Code First CTP5: Part 2 – Table per Type (TPT)

    - by mortezam
    In the previous blog post you saw that there are three different approaches to representing an inheritance hierarchy and I explained Table per Hierarchy (TPH) as the default mapping strategy in EF Code First. We argued that the disadvantages of TPH may be too serious for our design since it results in denormalized schemas that can become a major burden in the long run. In today’s blog post we are going to learn about Table per Type (TPT) as another inheritance mapping strategy and we'll see that TPT doesn’t expose us to this problem. Table per Type (TPT)Table per Type is about representing inheritance relationships as relational foreign key associations. Every class/subclass that declares persistent properties—including abstract classes—has its own table. The table for subclasses contains columns only for each noninherited property (each property declared by the subclass itself) along with a primary key that is also a foreign key of the base class table. This approach is shown in the following figure: For example, if an instance of the CreditCard subclass is made persistent, the values of properties declared by the BillingDetail base class are persisted to a new row of the BillingDetails table. Only the values of properties declared by the subclass (i.e. CreditCard) are persisted to a new row of the CreditCards table. The two rows are linked together by their shared primary key value. Later, the subclass instance may be retrieved from the database by joining the subclass table with the base class table. TPT Advantages The primary advantage of this strategy is that the SQL schema is normalized. In addition, schema evolution is straightforward (modifying the base class or adding a new subclass is just a matter of modify/add one table). Integrity constraint definition are also straightforward (note how CardType in CreditCards table is now a non-nullable column). Another much more important advantage is the ability to handle polymorphic associations (a polymorphic association is an association to a base class, hence to all classes in the hierarchy with dynamic resolution of the concrete class at runtime). A polymorphic association to a particular subclass may be represented as a foreign key referencing the table of that particular subclass. Implement TPT in EF Code First We can create a TPT mapping simply by placing Table attribute on the subclasses to specify the mapped table name (Table attribute is a new data annotation and has been added to System.ComponentModel.DataAnnotations namespace in CTP5): public abstract class BillingDetail {     public int BillingDetailId { get; set; }     public string Owner { get; set; }     public string Number { get; set; } } [Table("BankAccounts")] public class BankAccount : BillingDetail {     public string BankName { get; set; }     public string Swift { get; set; } } [Table("CreditCards")] public class CreditCard : BillingDetail {     public int CardType { get; set; }     public string ExpiryMonth { get; set; }     public string ExpiryYear { get; set; } } public class InheritanceMappingContext : DbContext {     public DbSet<BillingDetail> BillingDetails { get; set; } } If you prefer fluent API, then you can create a TPT mapping by using ToTable() method: protected override void OnModelCreating(ModelBuilder modelBuilder) {     modelBuilder.Entity<BankAccount>().ToTable("BankAccounts");     modelBuilder.Entity<CreditCard>().ToTable("CreditCards"); } Generated SQL For QueriesLet’s take an example of a simple non-polymorphic query that returns a list of all the BankAccounts: var query = from b in context.BillingDetails.OfType<BankAccount>() select b; Executing this query (by invoking ToList() method) results in the following SQL statements being sent to the database (on the bottom, you can also see the result of executing the generated query in SQL Server Management Studio): Now, let’s take an example of a very simple polymorphic query that requests all the BillingDetails which includes both BankAccount and CreditCard types: projects some properties out of the base class BillingDetail, without querying for anything from any of the subclasses: var query = from b in context.BillingDetails             select new { b.BillingDetailId, b.Number, b.Owner }; -- var query = from b in context.BillingDetails select b; This LINQ query seems even more simple than the previous one but the resulting SQL query is not as simple as you might expect: -- As you can see, EF Code First relies on an INNER JOIN to detect the existence (or absence) of rows in the subclass tables CreditCards and BankAccounts so it can determine the concrete subclass for a particular row of the BillingDetails table. Also the SQL CASE statements that you see in the beginning of the query is just to ensure columns that are irrelevant for a particular row have NULL values in the returning flattened table. (e.g. BankName for a row that represents a CreditCard type) TPT ConsiderationsEven though this mapping strategy is deceptively simple, the experience shows that performance can be unacceptable for complex class hierarchies because queries always require a join across many tables. In addition, this mapping strategy is more difficult to implement by hand— even ad-hoc reporting is more complex. This is an important consideration if you plan to use handwritten SQL in your application (For ad hoc reporting, database views provide a way to offset the complexity of the TPT strategy. A view may be used to transform the table-per-type model into the much simpler table-per-hierarchy model.) SummaryIn this post we learned about Table per Type as the second inheritance mapping in our series. So far, the strategies we’ve discussed require extra consideration with regard to the SQL schema (e.g. in TPT, foreign keys are needed). This situation changes with the Table per Concrete Type (TPC) that we will discuss in the next post. References ADO.NET team blog Java Persistence with Hibernate book a { text-decoration: none; } a:visited { color: Blue; } .title { padding-bottom: 5px; font-family: Segoe UI; font-size: 11pt; font-weight: bold; padding-top: 15px; } .code, .typeName { font-family: consolas; } .typeName { color: #2b91af; } .padTop5 { padding-top: 5px; } .padTop10 { padding-top: 10px; } p.MsoNormal { margin-top: 0in; margin-right: 0in; margin-bottom: 10.0pt; margin-left: 0in; line-height: 115%; font-size: 11.0pt; font-family: "Calibri" , "sans-serif"; }

    Read the article

  • Jquery Live Function

    - by marharépa
    Hi! I want to make this script to work as LIVE() function. Please help me! $(".img img").each(function() { $(this).cjObjectScaler({ destElem: $(this).parent(), method: "fit" }); }); the cjObjectScaler script (called in the html header) is this: (thanks for Doug Jones) (function ($) { jQuery.fn.imagesLoaded = function (callback) { var elems = this.filter('img'), len = elems.length; elems.bind('load', function () { if (--len <= 0) { callback.call(elems, this); } }).each(function () { // cached images don't fire load sometimes, so we reset src. if (this.complete || this.complete === undefined) { var src = this.src; // webkit hack from http://groups.google.com/group/jquery-dev/browse_thread/thread/eee6ab7b2da50e1f this.src = '#'; this.src = src; } }); }; })(jQuery); /* CJ Object Scaler */ (function ($) { jQuery.fn.cjObjectScaler = function (options) { /* user variables (settings) ***************************************/ var settings = { // must be a jQuery object method: "fill", // the parent object to scale our object into destElem: null, // fit|fill fade: 0 // if positive value, do hide/fadeIn }; /* system variables ***************************************/ var sys = { // function parameters version: '2.1.1', elem: null }; /* scale the image ***************************************/ function scaleObj(obj) { // declare some local variables var destW = jQuery(settings.destElem).width(), destH = jQuery(settings.destElem).height(), ratioX, ratioY, scale, newWidth, newHeight, borderW = parseInt(jQuery(obj).css("borderLeftWidth"), 10) + parseInt(jQuery(obj).css("borderRightWidth"), 10), borderH = parseInt(jQuery(obj).css("borderTopWidth"), 10) + parseInt(jQuery(obj).css("borderBottomWidth"), 10), objW = jQuery(obj).width(), objH = jQuery(obj).height(); // check for valid border values. IE takes in account border size when calculating width/height so just set to 0 borderW = isNaN(borderW) ? 0 : borderW; borderH = isNaN(borderH) ? 0 : borderH; // calculate scale ratios ratioX = destW / jQuery(obj).width(); ratioY = destH / jQuery(obj).height(); // Determine which algorithm to use if (!jQuery(obj).hasClass("cf_image_scaler_fill") && (jQuery(obj).hasClass("cf_image_scaler_fit") || settings.method === "fit")) { scale = ratioX < ratioY ? ratioX : ratioY; } else if (!jQuery(obj).hasClass("cf_image_scaler_fit") && (jQuery(obj).hasClass("cf_image_scaler_fill") || settings.method === "fill")) { scale = ratioX < ratioY ? ratioX : ratioY; } // calculate our new image dimensions newWidth = parseInt(jQuery(obj).width() * scale, 10) - borderW; newHeight = parseInt(jQuery(obj).height() * scale, 10) - borderH; // Set new dimensions & offset jQuery(obj).css({ "width": newWidth + "px", "height": newHeight + "px"//, // "position": "absolute", // "top": (parseInt((destH - newHeight) / 2, 10) - parseInt(borderH / 2, 10)) + "px", // "left": (parseInt((destW - newWidth) / 2, 10) - parseInt(borderW / 2, 10)) + "px" }).attr({ "width": newWidth, "height": newHeight }); // do our fancy fade in, if user supplied a fade amount if (settings.fade > 0) { jQuery(obj).fadeIn(settings.fade); } } /* set up any user passed variables ***************************************/ if (options) { jQuery.extend(settings, options); } /* main ***************************************/ return this.each(function () { sys.elem = this; // if they don't provide a destObject, use parent if (settings.destElem === null) { settings.destElem = jQuery(sys.elem).parent(); } // need to make sure the user set the parent's position. Things go bonker's if not set. // valid values: absolute|relative|fixed if (jQuery(settings.destElem).css("position") === "static") { jQuery(settings.destElem).css({ "position": "relative" }); } // if our object to scale is an image, we need to make sure it's loaded before we continue. if (typeof sys.elem === "object" && typeof settings.destElem === "object" && typeof settings.method === "string") { // if the user supplied a fade amount, hide our image if (settings.fade > 0) { jQuery(sys.elem).hide(); } if (sys.elem.nodeName === "IMG") { // to fix the weird width/height caching issue we set the image dimensions to be auto; jQuery(sys.elem).width("auto"); jQuery(sys.elem).height("auto"); // wait until the image is loaded before scaling jQuery(sys.elem).imagesLoaded(function () { scaleObj(this); }); } else { scaleObj(jQuery(sys.elem)); } } else { console.debug("CJ Object Scaler could not initialize."); return; } }); }; })(jQuery);

    Read the article

  • Problems in php coding

    - by anwar
    Hi there everyone im new to PHP and Joomla and I have developed a component in Joomla but my code is giving me errors. I have tried to solve the problem but I’am unable to solve it. So can anyone suggest me what is the problem with my code? Thanks in advance. Here are my two files: 1st view.html.php defined('_JEXEC') or die('=;)'); jimport('joomla.application.component.view'); class namnamViewlistrestaurant extends JView { function display($tpl = null) { $item = 'item'; RestUser::RestrictDirectAccess(); //-- Custom css JHTML::stylesheet( 'style.css', 'components/com_namnam/assets/css/' ); $cuisine=Lookups::getLookup('cuisine'); $lists['cuisine'] = JHTML::_('select.genericlist', $cuisine, 'idcuisine[]', 'class="inputbox" size="7"', 'value', 'text', $item->idcuisine); $category=Lookups::getLookup('restcategory'); $lists['category'] = JHTML::_('select.genericlist', $category, 'idcategory[]', 'class="inputbox" multiple="multiple" size="7"', 'value', 'text', $item->idcategory); $items = & $this->get('Data'); $pagination =& $this->get('Pagination'); $lists = & $this->get('List'); $this->assignRef('items', $items); $this->assignRef('pagination', $pagination); $this->assignRef('lists', $lists); parent::display($tpl); }//function }//class And 2nd is listrestaurant.php defined('_JEXEC') or die('=;)'); jimport('joomla.application.component.model'); class namnamModellistrestaurant extends JModel { var $_data; var $_total = null; var $_pagination = null; function __construct() { parent::__construct(); global $mainframe, $option; $limit = $mainframe->getUserStateFromRequest( 'global.list.limit', 'limit', $mainframe->getCfg('list_limit'), 'int' ); $limitstart = $mainframe->getUserStateFromRequest( $option.'.limitstart', 'limitstart', 0, 'int' ); $limitstart = ($limit != 0 ? (floor($limitstart / $limit) * $limit) : 0); $this->setState('limit', $limit); $this->setState('limitstart', $limitstart); } function _buildQuery() { $where = array(); $where[]=" idowner=".RestUser::getUserID()." "; if ($this->search) { $where[] = 'LOWER(name) LIKE \''. $this->search. '\''; } $where =( count($where) ) ? ' WHERE ' . implode( ' AND ', $where ) : ''; $orderby = ''; #_ECR_MAT_FILTER_MODEL1_ if (($this->filter_order) && ($this->filter_order_Dir)) { $orderby = ' ORDER BY '. $this->filter_order .' '. $this->filter_order_Dir; } $this->_query = ' SELECT *' . ' FROM #__namnam_restaurants ' . $where . $orderby ; return $this->_query; } function getData() { if (empty($this->_data)) { $query = $this->_buildQuery(); $this->_data = $this->_getList($query, $this->getState('limitstart'), $this->getState('limit')); } return $this->_data; } function getList() { // table ordering $lists['order_Dir'] = $this->filter_order_Dir; $lists['order'] = $this->filter_order; // search filter $lists['search']= $this->search; return $lists; } function getTotal() { // Load the content if it doesn't already exist if (empty($this->_total)) { $query = $this->_buildQuery(); $this->_total = $this->_getListCount($query); } return $this->_total; } function getPagination() { // Load the content if it doesn't already exist if (empty($this->_pagination)) { jimport('joomla.html.pagination'); $this->_pagination = new JPagination($this->getTotal(), $this->getState('limitstart'), $this->getState('limit') ); } return $this->_pagination; } }//class And the errors are: Notice: Trying to get property of non-object in C:\wamp\www\namnam.com\components\com_namnam\views\listrestaurant\view.html.php on line 26 Notice: Trying to get property of non-object in C:\wamp\www\namnam.com\components\com_namnam\views\listrestaurant\view.html.php on line 29 Notice: Undefined property: namnamModellistrestaurant::$search in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 38 Notice: Undefined property: namnamModellistrestaurant::$filter_order in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 48 Notice: Undefined property: namnamModellistrestaurant::$search in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 38 Notice: Undefined property: namnamModellistrestaurant::$filter_order in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 48 Notice: Undefined property: namnamModellistrestaurant::$filter_order_Dir in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 76 Notice: Undefined property: namnamModellistrestaurant::$filter_order in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 77 Notice: Undefined property: namnamModellistrestaurant::$search in C:\wamp\www\namnam.com\components\com_namnam\models\listrestaurant.php on line 80

    Read the article

  • problem in displaying list using array adapters

    - by Rahul Varma
    Hi, I am trying to display the list of songs using array adapters. But the problem is i couldnt display the list and only empty screen with preset background is showing up. Here's the code...All the thee are seperate classes... Plz help me... public class SongsAdapter extends ArrayAdapter<SongsList>{ private Context context; TextView tvTitle; TextView tvMovie; TextView tvSinger; String s; public SongsAdapter(Context context, int resource, int textViewResourceId, String title) { super(context, resource, textViewResourceId); this.context=context; } public View getView(int position, View convertView, ViewGroup parent) { final int i=position; List<SongsList> listSongs = new ArrayList<SongsList>(); String title = listSongs.get(i).gettitleName().toString(); String album = listSongs.get(i).getmovieName().toString(); String artist = listSongs.get(i).getsingerName().toString(); String imgal = listSongs.get(i).gettitleName().toString(); LayoutInflater inflater = ((Activity) context).getLayoutInflater(); View v = inflater.inflate(R.layout.row, null); tvTitle=(TextView)v.findViewById(R.id.text2); tvMovie=(TextView)v.findViewById(R.id.text3); tvSinger=(TextView)v.findViewById(R.id.text1); tvTitle.setText(title); tvMovie.setText(album); tvSinger.setText(artist); final ImageView im=(ImageView)v.findViewById(R.id.image); s="http://www.gorinka.com/"+imgal; String imgPath=s; AsyncImageLoaderv asyncImageLoaderv=new AsyncImageLoaderv(); Bitmap cachedImage = asyncImageLoaderv.loadDrawable(imgPath, new AsyncImageLoaderv.ImageCallback() { public void imageLoaded(Bitmap imageDrawable, String imageUrl) { im.setImageBitmap(imageDrawable); } }); im.setImageBitmap(cachedImage); return v; } public class imageloader implements Runnable{ private String ss; private ImageView im; public imageloader(String s, ImageView im) { this.ss=s; this.im=im; Thread thread = new Thread(this); thread.start(); } public void run(){ try { HttpGet httpRequest = null; httpRequest = new HttpGet(ss); HttpClient httpclient = new DefaultHttpClient(); HttpResponse response = (HttpResponse) httpclient.execute(httpRequest); HttpEntity entity = response.getEntity(); BufferedHttpEntity bufHttpEntity = new BufferedHttpEntity(entity); InputStream is = bufHttpEntity.getContent(); Bitmap bm = BitmapFactory.decodeStream(is); Log.d("img","img"); is.close(); im.setImageBitmap(bm); } catch (Exception t) { Log.e("bitmap url", "Exception in updateStatus()", t); } } } } public class SongsList { private String titleName; private String movieName; private String singerName; private String imagePath; private String mediaPath; // Constructor for the SongsList class public SongsList(String titleName, String movieName, String singerName,String imagePath,String mediaPath ) { super(); this.titleName = titleName; this.movieName = movieName; this.singerName = singerName; this.imagePath = imagePath; this.mediaPath = mediaPath; } public String gettitleName() { return titleName; } public void settitleName(String titleName) { this.titleName = titleName; } public String getmovieName() { return movieName; } public void setmovieName(String movieName) { this.movieName = movieName; } public String getsingerName() { return singerName; } public void setsingerName(String singerName) { this.singerName = singerName; } public String getimagePath() { return imagePath; } public void setimagePath(String imagePath) { this.imagePath = imagePath; } public String getmediaPath() { return mediaPath; } public void setmediaPath(String mediaPath) { this.mediaPath = mediaPath; } } public class MusicListActivity extends Activity { @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.openadiuofile); ListView list = (ListView)findViewById(R.id.list1); SongsAdapter adapter = new SongsAdapter(this,R.layout.row, R.id.text2, null); list.setAdapter(adapter); } }

    Read the article

  • HttpTransportSE requestDump gives NullPointerException

    - by Chamila
    Hi, I'm trying to access a webservice in Android via Ksoap2 for android. The SoapObject is created ok, the S.o.p of the bodyOut outputs the desired strings. But when I do a requestDump of the HttpTransportSE object I create to make the call, a NullPointerException happens. In other words, the transport object is null. How can this happen? Web Service is at http://srilanka.lk:9080/services/CropServiceProxy?wsdl This service works very well with SoapUI. SoapUI Request <soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:v1="http://schemas.icta.lk/xsd/crop/handler/v1/"> <soap:Header/> <soap:Body> <v1:getCropDataList> <v1:code>ABK</v1:code> </v1:getCropDataList> </soap:Body> </soap:Envelope> SoapUI Response <soapenv:Envelope xmlns:soapenv="http://www.w3.org/2003/05/soap-envelope"> <soapenv:Body> <ns1:getCropDataListResponse xmlns:ns1="http://schemas.icta.lk/xsd/crop/handler/v1/"> <ns1:cropInfo> <ns1:name>Ambul Kesel</ns1:name> <ns1:price>35.0</ns1:price> <ns1:location>Dambulla</ns1:location> </ns1:cropInfo> <ns1:cropInfo> <ns1:name>Ambul Kesel</ns1:name> <ns1:price>40.0</ns1:price> <ns1:location>Dambulla</ns1:location> </ns1:cropInfo> </ns1:getCropDataListResponse> </soapenv:Body> </soapenv:Envelope> Client Side Complex Type KvmSerializable implementation public class CropInfo implements KvmSerializable { private String name; private float price; private String location; @Override public Object getProperty(int arg0) { switch (arg0){ case 0: return name; case 1: return price; case 2: return location; default: return null; } } @Override public int getPropertyCount() { return 3; } @Override public void getPropertyInfo(int arg0, Hashtable arg1, PropertyInfo arg2) { switch (arg0){ case 0: arg2.type = PropertyInfo.STRING_CLASS; arg2.name = "Name"; break; case 1: arg2.type = Float.class; arg2.name = "Price"; break; case 2: arg2.type = PropertyInfo.STRING_CLASS; arg2.name = "Location"; break; default: break; } } @Override public void setProperty(int arg0, Object arg1) { switch(arg0){ case 0: name = arg1.toString(); break; case 1: price = Float.parseFloat(arg1.toString()); case 2: location = arg1.toString(); default: break; } } } Web Service Call public void btnOnClick(View v){ String NAMESPACE = "http://schemas.icta.lk/xsd/crop/handler/v1/"; String URL = "http://220.247.225.202:9080/services/CropServiceProxy.CropServiceProxyHttpSoap12Endpoint"; String method_name = "getCropDataList"; String SOAP_ACTION = "http://schemas.icta.lk/xsd/crop/handler/v1/getCropDataList"; SoapObject soap_request = new SoapObject(NAMESPACE, method_name); soap_request.addProperty("code", "ABK" ); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.setOutputSoapObject(soap_request); envelope.addMapping(NAMESPACE, "cropInfo", CropInfo.class); //envelope.dotNet=true; Marshal floatMarshal = new MarshalFloat(); floatMarshal.register(envelope); System.out.println("body out : " + envelope.bodyOut.toString()); //AndroidHttpTransport http_transport = new AndroidHttpTransport(URL); HttpTransportSE http_transport = new HttpTransportSE(URL); try { //NullPointerException HERE System.out.println(http_transport.requestDump); http_transport.call(SOAP_ACTION, envelope); //because we should expect a vector, two kinds of prices are given Vector<CropInfo> result_array = (Vector<CropInfo>)envelope.getResponse(); if(result_array != null){ for (CropInfo current_crop: result_array){ System.out.println(current_crop.getName()); System.out.println(Float.toString(current_crop.getPrice())); } } } catch (Exception e) { e.printStackTrace(); answer.setText("error caught"); //System.out.println(http_transport.responseDump); } // String result_string[] = (String[])result; //answer.setText("returned"); } Can anyone explain this?

    Read the article

  • PHP submit problem

    - by TaG
    I'm trying to check if the username is available and display it for the user to see when they check there account settings, which I have done. BUT when the user tries to fill out another field I get the Your username is unavailable! which should not pop up because its the users username already. I want to know how can I fix this problem using PHP so that the users name is displayed every time the user views their account settings and it wont cause problems when a user submits additional info? Here is the PHP code. if (isset($_POST['submitted'])) { require_once '../htmlpurifier/library/HTMLPurifier.auto.php'; $config = HTMLPurifier_Config::createDefault(); $config->set('Core.Encoding', 'UTF-8'); $config->set('HTML.Doctype', 'XHTML 1.0 Strict'); $config->set('HTML.TidyLevel', 'heavy'); $config->set('HTML.SafeObject', true); $config->set('HTML.SafeEmbed', true); $purifier = new HTMLPurifier($config); $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"SELECT users.* FROM users WHERE user_id=3"); $first_name = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['first_name'])))); $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if($_POST['username']) { $u = "SELECT user_id FROM users WHERE username = '$username'"; $r = mysqli_query ($mysqli, $u) or trigger_error("Query: $q\n<br />MySQL Error: " . mysqli_error($mysqli)); if (mysqli_num_rows($r) == TRUE) { $username = NULL; echo '<p class="error">Your username is unavailable!</p>'; } else if(mysqli_num_rows($r) == 0) { $username = mysqli_real_escape_string($mysqli, $purifier->purify(htmlentities(strip_tags($_POST['username'])))); if ($_POST['password1'] == $_POST['password2']) { $sha512 = hash('sha512', $_POST['password1']); $password = mysqli_real_escape_string($mysqli, $purifier->purify(strip_tags($sha512))); } else { $password = NULL; } if($password == NULL) { echo '<p class="error">Your password did not match the confirmed password!</p>'; } else { if (mysqli_num_rows($dbc) == 0) { $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"INSERT INTO users (user_id, first_name, username, password) VALUES ('$user_id', '$first_name', '$username', '$password')"); } if ($dbc == TRUE) { $dbc = mysqli_query($mysqli,"UPDATE users SET first_name = '$first_name', username = '$username', password = '$password' WHERE user_id = '$user_id'"); echo '<p class="changes-saved">Your changes have been saved!</p>'; } if (!$dbc) { print mysqli_error($mysqli); return; } } } } } Here is the html form. <form method="post" action="index.php"> <fieldset> <ul> <li><label for="first_name">First Name: </label><input type="text" name="first_name" id="first_name" size="25" class="input-size" value="<?php if (isset($_POST['first_name'])) { echo stripslashes(htmlentities(strip_tags($_POST['first_name']))); } else if(!empty($first_name)) { echo stripslashes(htmlentities(strip_tags($first_name))); } ?>" /></li> <li><label for="username">UserName: </label><input type="text" name="username" id="username" size="25" class="input-size" value="<?php if (isset($_POST['username'])) { echo stripslashes(htmlentities(strip_tags($_POST['username']))); } else if(!empty($username)) { echo stripslashes(htmlentities(strip_tags($username))); } ?>" /><br /><span>(ex: CSSKing, butterball)</span></li> <li><label for="password1">Password: </label><input type="password" name="password1" id="password1" size="25" class="input-size" value="<?php if (isset($_POST['password1'])) { echo stripslashes(htmlentities(strip_tags($_POST['password1']))); } ?>" /></li> <li><label for="password2">Confirm Password: </label><input type="password" name="password2" id="password2" size="25" class="input-size" value="<?php if (isset($_POST['password2'])) { echo stripslashes(htmlentities(strip_tags($_POST['password2']))); } ?>" /></li> <li><input type="submit" name="submit" value="Save Changes" class="save-button" /> <input type="hidden" name="submitted" value="true" /> <input type="submit" name="submit" value="Preview Changes" class="preview-changes-button" /></li> </ul> </fieldset> </form>

    Read the article

  • Spritebatch drawing sprite with jagged borders

    - by Mutoh
    Alright, I've been on the making of a sprite class and a sprite sheet manager, but have come across this problem. Pretty much, the project is acting like so; for example: Let's take this .png image, with a transparent background. Note how it has alpha-transparent pixels around it in the lineart. Now, in the latter link's image, in the left (with CornflowerBlue background) it is shown the image drawn in another project (let's call it "Project1") with a simpler sprite class - there, it works. The right (with Purple background for differentiating) shows it drawn with a different class in "Project2" - where the problem manifests itself. This is the Sprite class of Project1: using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace WindowsGame2 { class Sprite { Vector2 pos = new Vector2(0, 0); Texture2D image; Rectangle size; float scale = 1.0f; // --- public float X { get { return pos.X; } set { pos.X = value; } } public float Y { get { return pos.Y; } set { pos.Y = value; } } public float Width { get { return size.Width; } } public float Height { get { return size.Height; } } public float Scale { get { return scale; } set { if (value < 0) value = 0; scale = value; if (image != null) { size.Width = (int)(image.Width * scale); size.Height = (int)(image.Height * scale); } } } // --- public void Load(ContentManager Man, string filename) { image = Man.Load<Texture2D>(filename); size = new Rectangle( 0, 0, (int)(image.Width * scale), (int)(image.Height * scale) ); } public void Become(Texture2D frame) { image = frame; size = new Rectangle( 0, 0, (int)(image.Width * scale), (int)(image.Height * scale) ); } public void Draw(SpriteBatch Desenhista) { // Desenhista.Draw(image, pos, Color.White); Desenhista.Draw( image, pos, new Rectangle( 0, 0, image.Width, image.Height ), Color.White, 0.0f, Vector2.Zero, scale, SpriteEffects.None, 0 ); } } } And this is the code in Project2, a rewritten, pretty much, version of the previous class. In this one I added sprite sheet managing and, in particular, removed Load and Become, to allow for static resources and only actual Sprites to be instantiated. using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace Mobby_s_Adventure { // Actually, I might desconsider this, and instead use static AnimationLocation[] and instanciated ID and Frame; // For determining the starting frame of an animation in a sheet and being able to iterate through // the Rectangles vector of the Sheet; class AnimationLocation { public int Location; public int FrameCount; // --- public AnimationLocation(int StartingRow, int StartingColumn, int SheetWidth, int NumberOfFrames) { Location = (StartingRow * SheetWidth) + StartingColumn; FrameCount = NumberOfFrames; } public AnimationLocation(int PositionInSheet, int NumberOfFrames) { Location = PositionInSheet; FrameCount = NumberOfFrames; } public static int CalculatePosition(int StartingRow, int StartingColumn, SheetManager Sheet) { return ((StartingRow * Sheet.Width) + StartingColumn); } } class Sprite { // The general stuff; protected SheetManager Sheet; protected Vector2 Position; public Vector2 Axis; protected Color _Tint; public float Angle; public float Scale; protected SpriteEffects _Effect; // --- // protected AnimationManager Animation; // For managing the animations; protected AnimationLocation[] Animation; public int AnimationID; protected int Frame; // --- // Properties for easy accessing of the position of the sprite; public float X { get { return Position.X; } set { Position.X = Axis.X + value; } } public float Y { get { return Position.Y; } set { Position.Y = Axis.Y + value; } } // --- // Properties for knowing the size of the sprite's frames public float Width { get { return Sheet.FrameWidth * Scale; } } public float Height { get { return Sheet.FrameHeight * Scale; } } // --- // Properties for more stuff; public Color Tint { set { _Tint = value; } } public SpriteEffects Effect { set { _Effect = value; } } public int FrameID { get { return Frame; } set { if (value >= (Animation[AnimationID].FrameCount)) value = 0; Frame = value; } } // --- // The only things that will be constantly modified will be AnimationID and FrameID, anything else only // occasionally; public Sprite(SheetManager SpriteSheet, AnimationLocation[] Animations, Vector2 Location, Nullable<Vector2> Origin = null) { // Assign the sprite's sprite sheet; // (Passed by reference! To allow STATIC sheets!) Sheet = SpriteSheet; // Define the animations that the sprite has available; // (Passed by reference! To allow STATIC animation boundaries!) Animation = Animations; // Defaulting some numerical values; Angle = 0.0f; Scale = 1.0f; _Tint = Color.White; _Effect = SpriteEffects.None; // If the user wants a default Axis, it is set in the middle of the frame; if (Origin != null) Axis = Origin.Value; else Axis = new Vector2( Sheet.FrameWidth / 2, Sheet.FrameHeight / 2 ); // Now that we have the axis, we can set the position with no worries; X = Location.X; Y = Location.Y; } // Simply put, draw the sprite with all its characteristics; public void Draw(SpriteBatch Drafter) { Drafter.Draw( Sheet.Texture, Position, Sheet.Rectangles[Animation[AnimationID].Location + FrameID], // Find the rectangle which frames the wanted image; _Tint, Angle, Axis, Scale, _Effect, 0.0f ); } } } And, in any case, this is the SheetManager class found in the previous code: using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace Mobby_s_Adventure { class SheetManager { protected Texture2D SpriteSheet; // For storing the sprite sheet; // Number of rows and frames in each row in the SpriteSheet; protected int NumberOfRows; protected int NumberOfColumns; // Size of a single frame; protected int _FrameWidth; protected int _FrameHeight; public Rectangle[] Rectangles; // For storing each frame; // --- public int Width { get { return NumberOfColumns; } } public int Height { get { return NumberOfRows; } } // --- public int FrameWidth { get { return _FrameWidth; } } public int FrameHeight { get { return _FrameHeight; } } // --- public Texture2D Texture { get { return SpriteSheet; } } // --- public SheetManager (Texture2D Texture, int Rows, int FramesInEachRow) { // Normal assigning SpriteSheet = Texture; NumberOfRows = Rows; NumberOfColumns = FramesInEachRow; _FrameHeight = Texture.Height / NumberOfRows; _FrameWidth = Texture.Width / NumberOfColumns; // Framing everything Rectangles = new Rectangle[NumberOfRows * NumberOfColumns]; int ID = 0; for (int i = 0; i < NumberOfRows; i++) { for (int j = 0; j < NumberOfColumns; j++) { Rectangles[ID] = new Rectangle ( _FrameWidth * j, _FrameHeight * i, _FrameWidth, _FrameHeight ); ID++; } } } public SheetManager (Texture2D Texture, int NumberOfFrames): this(Texture, 1, NumberOfFrames) { } } } For even more comprehending, if needed, here is how the main code looks like (it's just messing with the class' capacities, nothing actually; the result is a disembodied feet walking in place animation on the top-left of the screen and a static axe nearby): using System; using System.Collections.Generic; using System.Linq; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Audio; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.GamerServices; using Microsoft.Xna.Framework.Graphics; using Microsoft.Xna.Framework.Input; using Microsoft.Xna.Framework.Media; using System.Threading; namespace Mobby_s_Adventure { /// <summary> /// This is the main type for your game /// </summary> public class Game1 : Microsoft.Xna.Framework.Game { GraphicsDeviceManager graphics; SpriteBatch spriteBatch; static List<Sprite> ToDraw; static Texture2D AxeSheet; static Texture2D FeetSheet; static SheetManager Axe; static Sprite Jojora; static AnimationLocation[] Hack = new AnimationLocation[1]; static SheetManager Feet; static Sprite Mutoh; static AnimationLocation[] FeetAnimations = new AnimationLocation[2]; public Game1() { graphics = new GraphicsDeviceManager(this); Content.RootDirectory = "Content"; this.TargetElapsedTime = TimeSpan.FromMilliseconds(100); this.IsFixedTimeStep = true; } /// <summary> /// Allows the game to perform any initialization it needs to before starting to run. /// This is where it can query for any required services and load any non-graphic /// related content. Calling base.Initialize will enumerate through any components /// and initialize them as well. /// </summary> protected override void Initialize() { // TODO: Add your initialization logic here base.Initialize(); } /// <summary> /// LoadContent will be called once per game and is the place to load /// all of your content. /// </summary> protected override void LoadContent() { // Create a new SpriteBatch, which can be used to draw textures. spriteBatch = new SpriteBatch(GraphicsDevice); // Loading logic ToDraw = new List<Sprite>(); AxeSheet = Content.Load<Texture2D>("Sheet"); FeetSheet = Content.Load<Texture2D>("Feet Sheet"); Axe = new SheetManager(AxeSheet, 1); Hack[0] = new AnimationLocation(0, 1); Jojora = new Sprite(Axe, Hack, new Vector2(100, 100), new Vector2(5, 55)); Jojora.AnimationID = 0; Jojora.FrameID = 0; Feet = new SheetManager(FeetSheet, 8); FeetAnimations[0] = new AnimationLocation(1, 7); FeetAnimations[1] = new AnimationLocation(0, 1); Mutoh = new Sprite(Feet, FeetAnimations, new Vector2(0, 0)); Mutoh.AnimationID = 0; Mutoh.FrameID = 0; } /// <summary> /// UnloadContent will be called once per game and is the place to unload /// all content. /// </summary> protected override void UnloadContent() { // TODO: Unload any non ContentManager content here } /// <summary> /// Allows the game to run logic such as updating the world, /// checking for collisions, gathering input, and playing audio. /// </summary> /// <param name="gameTime">Provides a snapshot of timing values.</param> protected override void Update(GameTime gameTime) { // Allows the game to exit if (GamePad.GetState(PlayerIndex.One).Buttons.Back == ButtonState.Pressed) this.Exit(); // Update logic Mutoh.FrameID++; ToDraw.Add(Mutoh); ToDraw.Add(Jojora); base.Update(gameTime); } /// <summary> /// This is called when the game should draw itself. /// </summary> /// <param name="gameTime">Provides a snapshot of timing values.</param> protected override void Draw(GameTime gameTime) { GraphicsDevice.Clear(Color.Purple); // Drawing logic spriteBatch.Begin(); foreach (Sprite Element in ToDraw) { Element.Draw(spriteBatch); } spriteBatch.Draw(Content.Load<Texture2D>("Sheet"), new Rectangle(50, 50, 55, 60), Color.White); spriteBatch.End(); base.Draw(gameTime); } } } Please help me find out what I'm overlooking! One thing that I have noticed and could aid is that, if inserted the equivalent of this code spriteBatch.Draw( Content.Load<Texture2D>("Image Location"), new Rectangle(X, Y, images width, height), Color.White ); in Project2's Draw(GameTime) of the main loop, it works. EDIT Ok, even if the matter remains unsolved, I have made some more progress! As you see, I managed to get the two kinds of rendering in the same project (the aforementioned Project2, with the more complex Sprite class). This was achieved by adding the following code to Draw(GameTime): protected override void Draw(GameTime gameTime) { GraphicsDevice.Clear(Color.Purple); // Drawing logic spriteBatch.Begin(); foreach (Sprite Element in ToDraw) { Element.Draw(spriteBatch); } // Starting here spriteBatch.Draw( Axe.Texture, new Vector2(65, 100), new Rectangle ( 0, 0, Axe.FrameWidth, Axe.FrameHeight ), Color.White, 0.0f, new Vector2(0, 0), 1.0f, SpriteEffects.None, 0.0f ); // Ending here spriteBatch.End(); base.Draw(gameTime); } (Supposing that Axe is the SheetManager containing the texture, sorry if the "jargons" of my code confuse you :s) Thus, I have noticed that the problem is within the Sprite class. But I only get more clueless, because even after modifying its Draw function to this: public void Draw(SpriteBatch Drafter) { /*Drafter.Draw( Sheet.Texture, Position, Sheet.Rectangles[Animation[AnimationID].Location + FrameID], // Find the rectangle which frames the wanted image; _Tint, Angle, Axis, Scale, _Effect, 0.0f );*/ Drafter.Draw( Sheet.Texture, Position, new Rectangle( 0, 0, Sheet.FrameWidth, Sheet.FrameHeight ), Color.White, 0.0f, Vector2.Zero, Scale, SpriteEffects.None, 0 ); } to make it as simple as the patch of code that works, it still draws the sprite jaggedly!

    Read the article

  • Connecting SceneBuilder edited FXML to Java code

    - by daniel
    Recently I had to answer several questions regarding how to connect an UI built with the JavaFX SceneBuilder 1.0 Developer Preview to Java Code. So I figured out that a short overview might be helpful. But first, let me state the obvious. What is FXML? To make it short, FXML is an XML based declaration format for JavaFX. JavaFX provides an FXML loader which will parse FXML files and from that construct a graph of Java object. It may sound complex when stated like that but it is actually quite simple. Here is an example of FXML file, which instantiate a StackPane and puts a Button inside it: -- <?xml version="1.0" encoding="UTF-8"?> <?import java.lang.*?> <?import java.util.*?> <?import javafx.scene.control.*?> <?import javafx.scene.layout.*?> <?import javafx.scene.paint.*?> <StackPane prefHeight="150.0" prefWidth="200.0" xmlns:fx="http://javafx.com/fxml"> <children> <Button mnemonicParsing="false" text="Button" /> </children> </StackPane> ... and here is the code I would have had to write if I had chosen to do the same thing programatically: import javafx.scene.control.*; import javafx.scene.layout.*; ... final Button button = new Button("Button"); button.setMnemonicParsing(false); final StackPane stackPane = new StackPane(); stackPane.setPrefWidth(200.0); stackPane.setPrefHeight(150.0); stacPane.getChildren().add(button); As you can see - FXML is rather simple to understand - as it is quite close to the JavaFX API. So OK FXML is simple, but why would I use it?Well, there are several answers to that - but my own favorite is: because you can make it with SceneBuilder. What is SceneBuilder? In short SceneBuilder is a layout tool that will let you graphically build JavaFX user interfaces by dragging and dropping JavaFX components from a library, and save it as an FXML file. SceneBuilder can also be used to load and modify JavaFX scenegraphs declared in FXML. Here is how I made the small FXML file above: Start the JavaFX SceneBuilder 1.0 Developer Preview In the Library on the left hand side, click on 'StackPane' and drag it on the content view (the white rectangle) In the Library, select a Button and drag it onto the StackPane on the content view. In the Hierarchy Panel on the left hand side - select the StackPane component, then invoke 'Edit > Trim To Selected' from the menubar That's it - you can now save, and you will obtain the small FXML file shown above. Of course this is only a trivial sample, made for the sake of the example - and SceneBuilder will let you create much more complex UIs. So, I have now an FXML file. But what do I do with it? How do I include it in my program? How do I write my main class? Loading an FXML file with JavaFX Well, that's the easy part - because the piece of code you need to write never changes. You can download and look at the SceneBuilder samples if you need to get convinced, but here is the short version: Create a Java class (let's call it 'Main.java') which extends javafx.application.Application In the same directory copy/save the FXML file you just created using SceneBuilder. Let's name it "simple.fxml" Now here is the Java code for the Main class, which simply loads the FXML file and puts it as root in a stage's scene. /* * Copyright (c) 2012, Oracle and/or its affiliates. All rights reserved. */ package simple; import java.util.logging.Level; import java.util.logging.Logger; import javafx.application.Application; import javafx.fxml.FXMLLoader; import javafx.scene.Scene; import javafx.scene.layout.StackPane; import javafx.stage.Stage; public class Main extends Application { /** * @param args the command line arguments */ public static void main(String[] args) { Application.launch(Main.class, (java.lang.String[])null); } @Override public void start(Stage primaryStage) { try { StackPane page = (StackPane) FXMLLoader.load(Main.class.getResource("simple.fxml")); Scene scene = new Scene(page); primaryStage.setScene(scene); primaryStage.setTitle("FXML is Simple"); primaryStage.show(); } catch (Exception ex) { Logger.getLogger(Main.class.getName()).log(Level.SEVERE, null, ex); } } } Great! Now I only have to use my favorite IDE to compile the class and run it. But... wait... what does it do? Well nothing. It just displays a button in the middle of a window. There's no logic attached to it. So how do we do that? How can I connect this button to my application logic? Here is how: Connection to code First let's define our application logic. Since this post is only intended to give a very brief overview - let's keep things simple. Let's say that the only thing I want to do is print a message on System.out when the user clicks on my button. To do that, I'll need to register an action handler with my button. And to do that, I'll need to somehow get a handle on my button. I'll need some kind of controller logic that will get my button and add my action handler to it. So how do I get a handle to my button and pass it to my controller? Once again - this is easy: I just need to write a controller class for my FXML. With each FXML file, it is possible to associate a controller class defined for that FXML. That controller class will make the link between the UI (the objects defined in the FXML) and the application logic. To each object defined in FXML we can associate an fx:id. The value of the id must be unique within the scope of the FXML, and is the name of an instance variable inside the controller class, in which the object will be injected. Since I want to have access to my button, I will need to add an fx:id to my button in FXML, and declare an @FXML variable in my controller class with the same name. In other words - I will need to add fx:id="myButton" to my button in FXML: -- <Button fx:id="myButton" mnemonicParsing="false" text="Button" /> and declare @FXML private Button myButton in my controller class @FXML private Button myButton; // value will be injected by the FXMLLoader Let's see how to do this. Add an fx:id to the Button object Load "simple.fxml" in SceneBuilder - if not already done In the hierarchy panel (bottom left), or directly on the content view, select the Button object. Open the Properties sections of the inspector (right panel) for the button object At the top of the section, you will see a text field labelled fx:id. Enter myButton in that field and validate. Associate a controller class with the FXML file Still in SceneBuilder, select the top root object (in our case, that's the StackPane), and open the Code section of the inspector (right hand side) At the top of the section you should see a text field labelled Controller Class. In the field, type simple.SimpleController. This is the name of the class we're going to create manually. If you save at this point, the FXML will look like this: -- <?xml version="1.0" encoding="UTF-8"?> <?import java.lang.*?> <?import java.util.*?> <?import javafx.scene.control.*?> <?import javafx.scene.layout.*?> <?import javafx.scene.paint.*?> <StackPane prefHeight="150.0" prefWidth="200.0" xmlns:fx="http://javafx.com/fxml" fx:controller="simple.SimpleController"> <children> <Button fx:id="myButton" mnemonicParsing="false" text="Button" /> </children> </StackPane> As you can see, the name of the controller class has been added to the root object: fx:controller="simple.SimpleController" Coding the controller class In your favorite IDE, create an empty SimpleController.java class. Now what does a controller class looks like? What should we put inside? Well - SceneBuilder will help you there: it will show you an example of controller skeleton tailored for your FXML. In the menu bar, invoke View > Show Sample Controller Skeleton. A popup appears, displaying a suggestion for the controller skeleton: copy the code displayed there, and paste it into your SimpleController.java: /** * Sample Skeleton for "simple.fxml" Controller Class * Use copy/paste to copy paste this code into your favorite IDE **/ package simple; import java.net.URL; import java.util.ResourceBundle; import javafx.fxml.FXML; import javafx.fxml.Initializable; import javafx.scene.control.Button; public class SimpleController implements Initializable { @FXML // fx:id="myButton" private Button myButton; // Value injected by FXMLLoader @Override // This method is called by the FXMLLoader when initialization is complete public void initialize(URL fxmlFileLocation, ResourceBundle resources) { assert myButton != null : "fx:id=\"myButton\" was not injected: check your FXML file 'simple.fxml'."; // initialize your logic here: all @FXML variables will have been injected } } Note that the code displayed by SceneBuilder is there only for educational purpose: SceneBuilder does not create and does not modify Java files. This is simply a hint of what you can use, given the fx:id present in your FXML file. You are free to copy all or part of the displayed code and paste it into your own Java class. Now at this point, there only remains to add our logic to the controller class. Quite easy: in the initialize method, I will register an action handler with my button: () { @Override public void handle(ActionEvent event) { System.out.println("That was easy, wasn't it?"); } }); ... -- ... // initialize your logic here: all @FXML variables will have been injected myButton.setOnAction(new EventHandler<ActionEvent>() { @Override public void handle(ActionEvent event) { System.out.println("That was easy, wasn't it?"); } }); ... That's it - if you now compile everything in your IDE, and run your application, clicking on the button should print a message on the console! Summary What happens is that in Main.java, the FXMLLoader will load simple.fxml from the jar/classpath, as specified by 'FXMLLoader.load(Main.class.getResource("simple.fxml"))'. When loading simple.fxml, the loader will find the name of the controller class, as specified by 'fx:controller="simple.SimpleController"' in the FXML. Upon finding the name of the controller class, the loader will create an instance of that class, in which it will try to inject all the objects that have an fx:id in the FXML. Thus, after having created '<Button fx:id="myButton" ... />', the FXMLLoader will inject the button instance into the '@FXML private Button myButton;' instance variable found on the controller instance. This is because The instance variable has an @FXML annotation, The name of the variable exactly matches the value of the fx:id Finally, when the whole FXML has been loaded, the FXMLLoader will call the controller's initialize method, and our code that registers an action handler with the button will be executed. For a complete example, take a look at the HelloWorld SceneBuilder sample. Also make sure to follow the SceneBuilder Get Started guide, which will guide you through a much more complete example. Of course, there are more elegant ways to set up an Event Handler using FXML and SceneBuilder. There are also many different ways to work with the FXMLLoader. But since it's starting to be very late here, I think it will have to wait for another post. I hope you have enjoyed the tour! --daniel

    Read the article

  • Animation issue caused by C# parameters passed by reference rather than value, but where?

    - by Jordan Roher
    I'm having trouble with sprite animation in XNA that appears to be caused by a struct passed as a reference value. But I'm not using the ref keyword anywhere. I am, admittedly, a C# noob, so there may be some shallow bonehead error in here, but I can't see it. I'm creating 10 ants or bees and animating them as they move across the screen. I have an array of animation structs, and each time I create an ant or bee, I send it the animation array value it requires (just [0] or [1] at this time). Deep inside the animation struct is a timer that is used to change frames. The ant/bee class stores the animation struct as a private variable. What I'm seeing is that each ant or bee uses the same animation struct, the one I thought I was passing in and copying by value. So during Update(), when I advance the animation timer for each ant/bee, the next ant/bee has its animation timer advanced by that small amount. If there's 1 ant on screen, it animates properly. 2 ants, it runs twice as fast, and so on. Obviously, not what I want. Here's an abridged version of the code. How is BerryPicking's ActorAnimationGroupData[] getting shared between the BerryCreatures? class BerryPicking { private ActorAnimationGroupData[] animations; private BerryCreature[] creatures; private Dictionary<string, Texture2D> creatureTextures; private const int maxCreatures = 5; public BerryPickingExample() { this.creatures = new BerryCreature[maxCreatures]; this.creatureTextures = new Dictionary<string, Texture2D>(); } public void LoadContent() { // Returns data from an XML file Reader reader = new Reader(); animations = reader.LoadAnimations(); CreateCreatures(); } // This is called from another function I'm not including because it's not relevant to the problem. // In it, I remove any creature that passes outside the viewport by setting its creatures[] spot to null. // Hence the if(creatures[i] == null) test is used to recreate "dead" creatures. Inelegant, I know. private void CreateCreatures() { for (int i = 0; i < creatures.Length; i++) { if (creatures[i] == null) { // In reality, the name selection is randomized creatures[i] = new BerryCreature("ant"); // Load content and texture (which I create elsewhere) creatures[i].LoadContent( FindAnimation(creatures[i].Name), creatureTextures[creatures[i].Name]); } } } private ActorAnimationGroupData FindAnimation(string animationName) { int yourAnimation = -1; for (int i = 0; i < animations.Length; i++) { if (animations[i].name == animationName) { yourAnimation = i; break; } } return animations[yourAnimation]; } public void Update(GameTime gameTime) { for (int i = 0; i < creatures.Length; i++) { creatures[i].Update(gameTime); } } } class Reader { public ActorAnimationGroupData[] LoadAnimations() { ActorAnimationGroupData[] animationGroup; XmlReader file = new XmlTextReader(filename); // Do loading... // Then later file.Close(); return animationGroup; } } class BerryCreature { private ActorAnimation animation; private string name; public BerryCreature(string name) { this.name = name; } public void LoadContent(ActorAnimationGroupData animationData, Texture2D sprite) { animation = new ActorAnimation(animationData); animation.LoadContent(sprite); } public void Update(GameTime gameTime) { animation.Update(gameTime); } } class ActorAnimation { private ActorAnimationGroupData animation; public ActorAnimation(ActorAnimationGroupData animation) { this.animation = animation; } public void LoadContent(Texture2D sprite) { this.sprite = sprite; } public void Update(GameTime gameTime) { animation.Update(gameTime); } } struct ActorAnimationGroupData { // There are lots of other members of this struct, but the timer is the only one I'm worried about. // TimerData is another struct private TimerData timer; public ActorAnimationGroupData() { timer = new TimerData(2); } public void Update(GameTime gameTime) { timer.Update(gameTime); } } struct TimerData { public float currentTime; public float maxTime; public TimerData(float maxTime) { this.currentTime = 0; this.maxTime = maxTime; } public void Update(GameTime gameTime) { currentTime += (float)gameTime.ElapsedGameTime.TotalSeconds; if (currentTime >= maxTime) { currentTime = maxTime; } } }

    Read the article

  • Anyone succeeded at injecting Interfaces into Entity Framework 4 Entities, using T4?

    - by Ciel
    Hello: POCO sort of leaves me wanting: (how can I say I use DI/IoC, if the Repository is not the only place that is creating the entities?)...hence my desire to lock it down, get rid of the temptation of newing up POCOs or EntityObjects anywhere in the code, and just allowing entity interfaces above the Repository/Factory layer. For a second there, I nearly thought I had it...was editing EF4's T4 in order to inject in an Interface def. Was going swimmingly, compiled and worked, until I got to the Associations... I wrapped them with a ICollection, and renamed the underlying original collection with a prefix of Wrapped. Unfortunately, when run, throws an error: //The Member 'WrappedSubExamples' in the CLR type 'XAct.App.Data.Model.EF4.Example' is not present in the conceptual model type 'XAct.App.Data.Model.Entity.Example'. var examples = context2.CreateObjectSet(); My T4 segment I used was (this may not work, as it's the longest code snippet I've ever posted here...sorry): #region Generic Property Abstraction <# if (navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many) {#> //XAct.App Generic Wrapper: <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> ICollection<I<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> <#=code.Escape(navProperty)#> { get { if (_X<#=code.Escape(navProperty)# == null){ _X<#=code.Escape(navProperty)# = new WrappedCollection,<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#(this.<#=(navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many)?"Wrapped":""#<#=code.Escape(navProperty)#); } return _X<#=code.Escape(navProperty)#; } } private ICollection _X<#=code.Escape(navProperty)#; <# } else { # <#=code.SpaceAfter(NewModifier(navProperty))#<#=Accessibility.ForProperty(navProperty)# I<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)# <#=code.Escape(navProperty)# { get { return (I<#=code.Escape(navProperty)#)this.Wrapped<#=code.Escape(navProperty)#; } set { this.Wrapped<#=code.Escape(navProperty)# = value as <#=code.Escape(navProperty)#; } } <# } # #endregion which then wraps the original collection, renamed with the prefix 'Wrapped': /// <summary> /// <#=SummaryComment(navProperty)#> /// </summary><#=LongDescriptionCommentElement(navProperty, region.CurrentIndentLevel) #> [XmlIgnoreAttribute()] [SoapIgnoreAttribute()] [DataMemberAttribute()] [EdmRelationshipNavigationPropertyAttribute("<#=navProperty.RelationshipType.NamespaceName#>", "<#=navProperty.RelationshipType.Name#>", "<#=navProperty.ToEndMember.Name#>")] <# if (navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many) { #> <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> EntityCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> Wrapped<#=code.Escape(navProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>"); } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { if ((value != null)) { ((IEntityWithRelationships)this).RelationshipManager.InitializeRelatedCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>", value); } } } <# } else { #> <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> <#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#> Wrapped<#=code.Escape(navProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>").Value; } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>").Value = value; } } <# string refPropertyName = navProperty.Name + "Reference"; if (entity.Members.Any(m => m.Name == refPropertyName)) { // 6017 is the same error number that EntityClassGenerator uses. Errors.Add(new System.CodeDom.Compiler.CompilerError(SourceCsdlPath, -1, -1, "6017", String.Format(CultureInfo.CurrentCulture, GetResourceString("Template_ConflictingGeneratedNavPropName"), navProperty.Name, entity.FullName, refPropertyName))); } #> /// <summary> /// <#=SummaryComment(navProperty)#> /// </summary><#=LongDescriptionCommentElement(navProperty, region.CurrentIndentLevel)#> [BrowsableAttribute(false)] [DataMemberAttribute()] <#=Accessibility.ForProperty(navProperty)#> EntityReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> <#=refPropertyName#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>"); } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { if ((value != null)) { ((IEntityWithRelationships)this).RelationshipManager.InitializeRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>", value); } } } <# } The point is...it bugs out. I've tried various solutions...none worked. Any ideas -- or is this just a wild goose chase, and time to give it up?

    Read the article

  • Scheduling thread tiles with C++ AMP

    - by Daniel Moth
    This post assumes you are totally comfortable with, what some of us call, the simple model of C++ AMP, i.e. you could write your own matrix multiplication. We are now ready to explore the tiled model, which builds on top of the non-tiled one. Tiling the extent We know that when we pass a grid (which is just an extent under the covers) to the parallel_for_each call, it determines the number of threads to schedule and their index values (including dimensionality). For the single-, two-, and three- dimensional cases you can go a step further and subdivide the threads into what we call tiles of threads (others may call them thread groups). So here is a single-dimensional example: extent<1> e(20); // 20 units in a single dimension with indices from 0-19 grid<1> g(e);      // same as extent tiled_grid<4> tg = g.tile<4>(); …on the 3rd line we subdivided the single-dimensional space into 5 single-dimensional tiles each having 4 elements, and we captured that result in a concurrency::tiled_grid (a new class in amp.h). Let's move on swiftly to another example, in pictures, this time 2-dimensional: So we start on the left with a grid of a 2-dimensional extent which has 8*6=48 threads. We then have two different examples of tiling. In the first case, in the middle, we subdivide the 48 threads into tiles where each has 4*3=12 threads, hence we have 2*2=4 tiles. In the second example, on the right, we subdivide the original input into tiles where each has 2*2=4 threads, hence we have 4*3=12 tiles. Notice how you can play with the tile size and achieve different number of tiles. The numbers you pick must be such that the original total number of threads (in our example 48), remains the same, and every tile must have the same size. Of course, you still have no clue why you would do that, but stick with me. First, we should see how we can use this tiled_grid, since the parallel_for_each function that we know expects a grid. Tiled parallel_for_each and tiled_index It turns out that we have additional overloads of parallel_for_each that accept a tiled_grid instead of a grid. However, those overloads, also expect that the lambda you pass in accepts a concurrency::tiled_index (new in amp.h), not an index<N>. So how is a tiled_index different to an index? A tiled_index object, can have only 1 or 2 or 3 dimensions (matching exactly the tiled_grid), and consists of 4 index objects that are accessible via properties: global, local, tile_origin, and tile. The global index is the same as the index we know and love: the global thread ID. The local index is the local thread ID within the tile. The tile_origin index returns the global index of the thread that is at position 0,0 of this tile, and the tile index is the position of the tile in relation to the overall grid. Confused? Here is an example accompanied by a picture that hopefully clarifies things: array_view<int, 2> data(8, 6, p_my_data); parallel_for_each(data.grid.tile<2,2>(), [=] (tiled_index<2,2> t_idx) restrict(direct3d) { /* todo */ }); Given the code above and the picture on the right, what are the values of each of the 4 index objects that the t_idx variables exposes, when the lambda is executed by T (highlighted in the picture on the right)? If you can't work it out yourselves, the solution follows: t_idx.global       = index<2> (6,3) t_idx.local          = index<2> (0,1) t_idx.tile_origin = index<2> (6,2) t_idx.tile             = index<2> (3,1) Don't move on until you are comfortable with this… the picture really helps, so use it. Tiled Matrix Multiplication Example – part 1 Let's paste here the C++ AMP matrix multiplication example, bolding the lines we are going to change (can you guess what the changes will be?) 01: void MatrixMultiplyTiled_Part1(vector<float>& vC, const vector<float>& vA, const vector<float>& vB, int M, int N, int W) 02: { 03: 04: array_view<const float,2> a(M, W, vA); 05: array_view<const float,2> b(W, N, vB); 06: array_view<writeonly<float>,2> c(M, N, vC); 07: parallel_for_each(c.grid, 08: [=](index<2> idx) restrict(direct3d) { 09: 10: int row = idx[0]; int col = idx[1]; 11: float sum = 0.0f; 12: for(int i = 0; i < W; i++) 13: sum += a(row, i) * b(i, col); 14: c[idx] = sum; 15: }); 16: } To turn this into a tiled example, first we need to decide our tile size. Let's say we want each tile to be 16*16 (which assumes that we'll have at least 256 threads to process, and that c.grid.extent.size() is divisible by 256, and moreover that c.grid.extent[0] and c.grid.extent[1] are divisible by 16). So we insert at line 03 the tile size (which must be a compile time constant). 03: static const int TS = 16; ...then we need to tile the grid to have tiles where each one has 16*16 threads, so we change line 07 to be as follows 07: parallel_for_each(c.grid.tile<TS,TS>(), ...that means that our index now has to be a tiled_index with the same characteristics as the tiled_grid, so we change line 08 08: [=](tiled_index<TS, TS> t_idx) restrict(direct3d) { ...which means, without changing our core algorithm, we need to be using the global index that the tiled_index gives us access to, so we insert line 09 as follows 09: index<2> idx = t_idx.global; ...and now this code just works and it is tiled! Closing thoughts on part 1 The process we followed just shows the mechanical transformation that can take place from the simple model to the tiled model (think of this as step 1). In fact, when we wrote the matrix multiplication example originally, the compiler was doing this mechanical transformation under the covers for us (and it has additional smarts to deal with the cases where the total number of threads scheduled cannot be divisible by the tile size). The point is that the thread scheduling is always tiled, even when you use the non-tiled model. But with this mechanical transformation, we haven't gained anything… Hint: our goal with explicitly using the tiled model is to gain even more performance. In the next post, we'll evolve this further (beyond what the compiler can automatically do for us, in this first release), so you can see the full usage of the tiled model and its benefits… Comments about this post by Daniel Moth welcome at the original blog.

    Read the article

  • Trying to draw 2 objects on screen and store the selected item names in an array

    - by thefonso
    Ok...this is a homework question, here is what i'm asked to do.... "Allow the user to draw two Shapes, which when instantiated, get put into the array myShapes...(store the shapes in the createShape() method." I want to know if I'm going in the right direction. Do I need to modify only Model.java or GUIDemo.java as well? Am I sufficient in thinking of only storing the values for the array via a loop inside my createShape() method? How do I go a bout checking to see if things work so far. There are many steps for this homework project after this one but i'm stuck here. Please point me in the right direction. The array myShapes lives inside my model class inside Model.java: package model; import java.awt.Color; import java.awt.Container; import shapes.Line; import shapes.Oval; import shapes.Rectangle; import shapes.Shape; import shapes.Triangle; import interfaces.Resettable; public class Model implements Resettable { private Container container; private String message; public final static String DRAW = "Draw"; public final static String MOVE = "Move"; public final static String REMOVE = "Remove"; public final static String RESIZE = "Resize"; public final static String FILL = "Fill"; public final static String CHANGE = "Change"; public final static String RECTANGLE = "Rectangle"; public final static String OVAL = "Oval"; public final static String LINE = "Line"; public final static String TRIANGLE = "Triangle"; private String action = DRAW; private boolean fill = false; public static String[] selections = {"Rectangle", "Oval", "Line", "Triangle"}; //project 9 begin public Shape[] myShapes = new Shape[2]; //project 9 stop private String currentShapeType; private Shape currentShape; public Color lineColor; private Color fillColor = Color.gray; public Shape createShape() { if(currentShapeType == RECTANGLE){ currentShape = new Rectangle(0, 0, 0, 0, lineColor, fillColor, fill); } if(currentShapeType == OVAL) { currentShape = new Oval(0,0,0,0, lineColor, fillColor, fill); } if(currentShapeType == LINE) { currentShape = new Line(0,0,0,0, lineColor, fillColor, fill); } if(currentShapeType == TRIANGLE) { currentShape = new Triangle(0,0,0,0, lineColor, fillColor, fill); } //project 9 start if(myShapes[0] == null) { myShapes[0]=currentShape; } else { myShapes[1]=currentShape; } //project 9 stop return currentShape; } public Shape getCurrentShape() { return currentShape; } public String getCurrentShapeType(){ return currentShapeType; } public void setCurrentShapeType(String shapeType){ currentShapeType = shapeType; } public Model(Container container) { this.container = container; } public void repaint() { container.repaint(); } public void resetComponents() { action = DRAW; currentShape = null; if (container instanceof Resettable) { ((Resettable) container).resetComponents(); } } public String getAction() { return action; } public void setAction(String action) { this.action = action; } public boolean isFill() { return fill; } public void setFill(boolean fill) { this.fill = fill; } public void setMessage(String msg) { this.message = msg; } public String getMessage() { return this.message; } public Color getLineColor() { return this.lineColor; } public void setLineColor(Color c) { this.lineColor = c; } public String toString() { return "Model:\n\tAction: " + action + "\n\tFill: " + fill; } } The application is run from GUIDemo.java: package ui.applet; import interfaces.Resettable; import java.applet.Applet; import java.awt.Graphics; import event.ShapeMouseHandler; import shapes.Shape; //import ui.panels.ButtonPanel; import ui.panels.ChoicePanel; import ui.panels.MainPanel; import model.Model; @SuppressWarnings("serial") public class GUIDemo extends Applet implements Resettable { MainPanel mainPanel; Model model; ChoicePanel choicePanel; public void init() { resize(600,400); model = new Model(this); choicePanel = new ChoicePanel(model); mainPanel = new MainPanel(model); this.add(choicePanel);//this is the drop down list this.add(mainPanel);//these are the radio buttons and reset button ShapeMouseHandler mouseHandler = new ShapeMouseHandler(model); addMouseListener(mouseHandler); addMouseMotionListener(mouseHandler); } public void paint(Graphics g) { Shape shape; shape = model.getCurrentShape(); if(shape != null) { shape.draw(g); } System.out.println(model); System.out.println(shape); } public void resetComponents() { mainPanel.resetComponents(); choicePanel.resetComponents(); } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 541 542 543 544 545 546 547 548 549 550 551 552  | Next Page >