Search Results

Search found 28762 results on 1151 pages for 'go goo go'.

Page 549/1151 | < Previous Page | 545 546 547 548 549 550 551 552 553 554 555 556  | Next Page >

  • Is there a way to watch EyeTV in alarm-clock style "sleep" mode on your iMac?

    - by Mark S.
    My wife likes to watch TV to go to sleep, the only trouble is that the only TV we have in our house is the iMac with the EyeTV Hybrid. I'd like to have the TV turn off after 1.5 hours of watching without changing the channels/volume--sortof like an alarm clock 'sleep' function. Do you know of a way to do this either with an EyeTV plugin or an App that might be able to try to detect such conditions and shut down the display? Right now EyeTV overrides the screensaver. The Power saver functions don't really work because she doesn't start watching at the same time every night and periodically she will want to record a 2 or 3 AM show. All I want to do is "close" (but not quit) EyeTV and shut off the display.

    Read the article

  • Updating Applications in a Corporate Environment

    - by user145133
    I am very new to this subject and was hoping someone could shed some light on it. I am working on creating a corporate network that will obviously have multiple servers and multiple workstations. Let's say a new version of Adobe Flash comes out. I would think that you would want to test this update in a test environment before "pushing it out" to the servers and workstations. How do you guys go about controlling, testing and then pushing the application updates out? (i am not talking about windows updates). Do you use a 3rd party sysadmin tool? Home grown software? Any info will greatly be appreciated :)

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Microsoft mouse screws up my power settings

    - by Patriot
    Running a new computer with Windows 7 and 64-bit OS. Had a wireless Logitech mouse that worked perfectly with this set up. The mouse was old, and the buttons were sticking and causing double clicks, so I bought a new Microsoft Mobile Wireless 3000 mouse to replace it. The new mouse works perfectly, but now my screen saver is disabled and my computer won't go into sleep mode after 15 minutes as per my power setting. If I hook the Logitech mouse back up, screen saver works fine and computer goes to sleep as it should. Am I missing something, or is Microsoft's mouse just junk. Got no software with the new mouse, so no drivers seem available.

    Read the article

  • Can Visual Studio track the "size" or "severity" of my changes in TFS?

    - by anaximander
    I'm working on a sizeable project using VS2012 and TFS (also 2012, I think - I didn't set up the server). A lot of my recent tasks have required making very small changes to a lot of files, so I'm quite used to seeing a lot of items in my Pending Changes list. Is there a way to have VS and/or TFS track how much has been changed and let me know when the differences are becoming significant? Similarly, is there a way to quickly highlight where the major changes are when you get the latest version from TFS? It'd really help with tracking down where certain changes have been made without having to go through and compare every file - the difference highlighting tool might be nice, but when you have to use it on a dozen files to find the block you're looking for, you start to wonder if there's a faster way...

    Read the article

  • How to recover the data from the crashed (external) hard disk drive (NTFS)?

    - by shveerab
    The 300 GB harddisk has 2 partitions,90 GB and 200 GB! I can see the drives in windows(XP) but unable to access them, the file system is shown as RAW, 0 used space and 0 free space!..chkdsk returns the error "unable to determine volume version and date. chkddsk aborted." Is the MBR corrupt? How do I restore it? TestDisk tool isn't recognizing the partitions and says invalid entry for heads/cylinder, 15 and should be 255 and suggests to change it..Should I go ahead and change it? Please advise!

    Read the article

  • Should we install the OS on an SSD or not when running virtual machines?

    - by Raghu Dodda
    I have a new Dell Mobile Precision M6500 laptop with 8 GB RAM. it has two hard drives - 500 GB @7200 RPM and a 128 GB SSD. The main purpose of these laptop is software development in virtual machines. The plan is to install the base OS (Windows 7) and all the programs in the 500 GB drive, and let the SSD only contain the virtual machine images. It is my understanding that the we get most performance from the virtual machines if the images are on a separate hard drive than the base OS. Is this the way to go, or should I install the OS on the SSD as well? What are the pros and cons? The virtual machine images would be between 20 - 30 GB, and I might run 1 or 2 at a time.

    Read the article

  • SQL Cluster install on Hyper V options

    - by Chris W
    I've been reading up on running a SQL Cluster in a Hyper V environment and there seems to be a couple of options: Install guest cluster on 2 VMs that are themselves part of a fail over cluster. Install SQL cluster on 2 VMs but the VMs themselves are not part of an underlying cluster. With option 1, it's little more complex as there's effectively two clusters in play but this adds some flexibility in the sense that I'm free to migrate the VMs between and physical blades in their cluster for physical maintenance without affecting the status of the SQL guest cluster that's running within them. With option 2, the set-up is a bit simpler as there's only 1 cluster in the mix but my VMs are anchored to the physical blades that they're set-up on (I'll ignore the fact I could manually move the VHDs for the purposes of this question). Are there any other factors that I should consider here when deciding which option to go for? I'm free to test out both options and probably will do but if any one has working experience of these set-ups and can offer some input that would be great.

    Read the article

  • PC3200 RAM in Older Computer?

    - by skaz
    Hello all, I am inheriting a Dell Dimension 8200, but it needs RAM to get up and running. I have PC3200 sticks lying around, but I am not sure how to go about figuring out if the RAM is compatible, as RAM has always confused me. Here is the Dell Dimension 8200 Tech Specs: http://support.dell.com/support/edocs/systems/dim8200/specs.htm For RAM, it says: Memory type PC800 (non-ECC) I don't know if that is just the kind that comes with it, and I can put in PC3200 (I think, if it worked, this would run at the lower rating? Is that true?), or if that means only PC800 is compatible. Any help would be appreciated.

    Read the article

  • Backup folder on sometimes attached external usb harddrive

    - by ctrler
    My girlfriend no longer has space her laptops drive to store her photos. The drive she has now is 750GB, so to go to a bigger drive would be expensive, as there isn't many 1.5tb 2.5 inch 9.5mm hdd on the market (as of now, there is only one). Because of that, I am thinking of moving her pictures to a cheap external usb hdd. As of now, I'm automatically backing up her important folders (My Documents, Pictures, etc.) using Windows 7 default backup software to a network drive. My problem is that I don't know of a good solution to automatically backup a folder residing on an usb disk. The usb disk won't be attached to the computer all the time, so I can't just treat it as a normal backup folder. Sometimes the backup would run and the folder would not be there! Anyone knows any software or methodology to backup folders on external usb hard drives that are not always present? Thanks

    Read the article

  • Postfix filter messages and pass to PHP script

    - by John Magnolia
    Each time a user signs up to our website through an external provider we get a basic email with the body contents containing the user details. I want to write a personalised automatic reply to this user. The actual parsing of the email body and reply via PHP I have already wrote but how do I go about configuring this from postfix? At the moment it is configured using a roundcube Sieve plugin where the email gets moved into a folder "Subscribe". Is it possible to create a custom action here? Debain Squeeze, Postfix and Dovecot

    Read the article

  • Vhost in Apache only working locally?

    - by Gasman
    Ok, I have added lines like: 127.0.0.1 somedomain.com Or some other domain that points to my routers IP, and is forwarded, but I get to the main site, but I want it to go to the subfolder I defined in my httpd-vhosts.conf: NameVirtualHost somedomain.com:80 <VirtualHost somedomain.com:80> DocumentRoot "D:/Apps/xampp/htdocs/somedomain" ServerName somedomain.com ServerAlias somedomain.com </VirtualHost> So, locally somedomain.com works, just remotely it goes to the root htdocs. So If I use a *:80 wildcard I works, but then everything points to the subfolder and all the other vhosts seem to get ignored. Any Idea why this is?

    Read the article

  • Option and command keys in Mac OS X are swapped and keyboard preferences do not set them back.

    - by bikesandcode
    On my MacBook Pro, I occasionally use external keyboards, generally Windows ones and things have been fine. Yesterday, I plugged in a new one, remapped the command/option keys so the windows/alt keys were in the same configuration, again, nothing new here. However, this time when I unplugged the USB keyboard, the laptops option/command keys remained switched. More annoying is that if I go into the System Preferences - Keyboards - Modifier keys, remapping the keys to actions does not work. I can use the drop downs to disable any specific keys, but switching the behaviours does nothing. (Cmd/Option obvious, tried remapping anything to caps lock and a few other combinations, no joy. Restore defaults set the configuration to what I'd expect, but the settings are evidently ignored.) So: Any ideas?

    Read the article

  • Ubuntu: On a network with many clients there are two machines that can't access the web via a browser at the same time

    - by ChrisInCambo
    Ok I'm pulling my hair out over this one. We have a wireless network with many clients all working well except two Ubuntu clients running 10.10 that can't access the internet via a browser at the same time. They can both still ping, use Skype etc but can't browse. As soon as the one that can browse exits the network browsing returns for the other and vice versa. As ping and Skype was working I assumed some kind of DNS problem but moving over to OpenDNS didn't solve it, nor did restarting networking or using wired rather than wireless. We also switched out the router, and it still persisted so I'm sure this isn't a network issue. The two clients are both laptops and work fine together on a wireless network at another office (which we don't control). I'm thinking something must be cached from the other network they both use that's causing this but have no idea what. Does anyone have any ideas? I just don't know where to go from here.

    Read the article

  • Unidentified Window OnStartup

    - by CMP
    Every time I start up windows vista lately, I see a random floating window. It is a tiny little window with no title, and only the resize, maximize and restore buttons. I'd post an image, but I don't have reputation here yet. I can close it, and it does indeed go away, but I would love to figure out what it is and stop it from popping up at all. I used Autohotkey's window spy on it and all I learned is that it is a swing window, which doesn't help me out a whole lot. Is there a good way to identify which process it belongs to and figure out how to kill it?

    Read the article

  • How can I organize my video collection and update meta data?

    - by Pieter Breed
    I have a large collection of downloaded video files containing different movies, tv shows and music videos. I have a FreeNAS box set up that uses Fuppes as a UPnP media server. My media player on Windows correctly detects this UPnP collection and can stream from it fine. However, All of my music videos, tv shows and movies are all sorted under the same 'Videos' group. I would like to seperate the different types of video files so that they can correctly go under 'Recorded TV' or whatever the case may be. Any ideas? I guess I am looking for something like an MP3Tagger but for video files?

    Read the article

  • using trickle to slow down browser

    - by tester
    according to trickle's man page, http://linux.die.net/man/1/trickle i can limit the download speed of a process, e.g. trickle -u 10 -d 20 ncftp to Launch ncftp(1) limiting its upload capacity to 10 KB/s, and download capacity at 20 KB/s. how would I go about limiting google-chrome or firefox with trickle? Edit: For those of you asking why I asked such an obvious question, I tried trickle -u 10 -d 20 firefox and I'm getting an error trickle: Could not reach trickled, working independently: No such file or directory firefox opens right after, but is definitely not rate limited...

    Read the article

  • Access a samba mount from an ssh connection

    - by Android
    I have Ubuntu 9.10 on my computer. I have made a samba mount to a windows computer. This works fine when I am on the Ubuntu computer directly. When I go to another computer and connect to Ubuntu with SSH. I can connect fine and everything works but the folder my mount is in appears empty. I have only 1 account and it has permissions on the file etc. When on the computer directly it all works perfectly, it is only when connecting with SSH that isn't visible. What am I doing wrong here? I made the mount with smbmount //computer/folder mount -o username=username,password=password Even if I run this command on the SSH connection then it is the same, visible on the computer directly but not on SSH.

    Read the article

  • Software/internet

    - by Yiannis
    Hi guys, i am using XP SP2, and everything where working fine. Somehow i can go to some web pages, but i cant login to them, for example www.buzzerbeater.com, i cant access my hotmail/msn, outlook doesnt work either, also www.realgm.com, i cant access the forums too. I have tried with IE7/Firefox/Chrome, but same result. I was using avast free edition that i removed, and i dont have any other security software installed. My laptop from the same network works perfectly. Any ideas?

    Read the article

  • First Linux - Ubuntu - should I change anything right away?

    - by Cyrcle
    I'm going to be getting a new system next week. I'm finally going to take the leap and run Linux as the native OS on it. Seems like a standard install of Ubuntu is the way to go for a newbie. I'm planning on 10.04 LTS. Is there anything that I should change right away that will cause me problems down the road? I'll be using this system for web development, mainly programming PHP. I'll be using my old laptop for testing with IE and Safari, at least until I either use Wine or VirtualBox to run them on the new machine. I think I'm going to force myself to learn Vim while I'm at it.

    Read the article

  • Default Program With Multiple Versions Installed

    - by Optimal Solutions
    I have multiple versions of Excel installed. Excel 2010, 2007 and 2003. I have them installed on one hard drive with Windows 7 Ultimate as the OS. When I double-click on an XLS file, Excel 2007 opens. I would like Excel 2010 to open. I read and followed the instructions to go to the Control Panel at "Control Panel\All Control Panel Items\Default Programs" and set the default programs. I changed the default to the physical EXE for Excel 2010 at the proper folder that it is installed. When I double-click on the XLS files, Excel 2007 still opens. So I tried to change it to Excel 2003 just to see if it changed to that and it still opens Excel 2007. What am I missing? I would really like the file extension to open Excel 2010, but can not seem to do that.

    Read the article

  • How to get cells to default to zero or calculate additonal fees, based on selection from a drop-down list

    - by User300479
    I am building a Pay Rate Calculator worksheet with a Flat/Base pay rate & numerous Overtime pay rates. I would like to be able to have the "Overtime" pay rate cells to change depending on my selection from my drop-down list. My list selections are "Flat Rate" and "Compounding". 1) If I select "Flat Rate" how can I make all the "Overtime" cell rates and totals default to zero or calculate to zero, to show the user there is no overtime rates to be applied to this job and to use the one rate to pay? 2)And if I select "Compounding" the Overtime rate cells are updated to add/include additional fees, to show the user Overtime rates apply to the job and penalties have automatically been calculated on top for them. Please explain like I'm a 2 year old - learning as I go. Many thanks :)

    Read the article

  • Thunderbird: 'reply to sent mail' use-case [closed]

    - by BoD
    I seem to have this use-case quite often: Send a mail to A, with B and C in cc Realize you forgot to say something in the mail. You now want to send a 'reply mail' (including your original mail as quotation) to A, with B and C in cc. To do that: go to the 'Sent mails' folder, and press the 'Reply all' button Problem: Now you have yourself in the 'To:' field, and A, B and C in the cc fields. Question: Is there a better way (maybe an extension?) to do step 4, and correctly have A in the To: field, and B and C in cc.

    Read the article

  • transparently set up Windows 7 as remote workstation

    - by Áxel
    Maybe is a very basic question, but I can't find the exact terms to Google for it and find the concrete answer to my doubt. Suppose we have several PCs in which individual employees work. One of them has an extremely powerful CPU, and it's very useful to use that computer to perform heavy computations, but go there and set up your task means its user has to stop working for a while. Is it possible to allow a secondary user account to remotly log in, for example via Remote Desktop, and work with a full user environment, while the main user keeps working under his user session? I've used remote desktop many times in the past, but it always blocked current user session, or even terminated it. Lots of thanks in advance guys.

    Read the article

  • How to delete a faulty FTP connection in Aptana?

    - by Peter
    Hi, I just created an FTP connection in Aptana in which I made a mistake. I told Aptana to remember it anyway while I looked up the correct data (user/password and such). Now I want to edit the FTP connection but as soon as I click it tries to connect which results in an error. If I try to delete it, same story, it tries to connect and I get the error and the delete doesn't go through. So, I have a non working FTP connection that I can't delete nor edit.How do I get rid of this thing? Or how do I correct it? Cheers.

    Read the article

< Previous Page | 545 546 547 548 549 550 551 552 553 554 555 556  | Next Page >