Search Results

Search found 81412 results on 3257 pages for 'file search'.

Page 56/3257 | < Previous Page | 52 53 54 55 56 57 58 59 60 61 62 63  | Next Page >

  • Search a variable for an address

    - by chrissygormley
    Hello, I am trying to match information stored in a variable. I have a list of uuid's and ip addresses beside them. The code I have is: r = re.compile(r'urn:uuid:5EEF382F-JSQ9-3c45-D5E0-K15X8M8K76') m = r.match(str(serv)) if m1: print'Found' The string serv contains is: urn:uuid:7FDS890A-KD9E-3h53-G7E8-BHJSD6789D:[u'http://10.10.10.20:12365/7FDS890A-KD9E-3h53-G7E8-BHJSD6789D/'] --------------------------------------------- urn:uuid:5EEF382F-JSQ9-3c45-D5E0-K15X8M8K76:[u'http://10.10.10.10:42365'] --------------------------------------------- urn:uuid:8DSGF89S-FS90-5c87-K3DF-SDFU890US9:[u'http://10.10.10.40:5234'] --------------------------------------------- So basically I am wanting to find the uuid string and find out what it's address is and store it as a variable. So far I have just tried to get it to match the string to no avail. Can anyone point out a solution to this. Thanks

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Need a tool to search large structure text documents for words, phrases and related phrases

    - by pitosalas
    I have to keep up with structured documents containing things such as requests for proposals, government program reports, threat models and all kinds of things like that. They are in techno-legalese as I would call them: highly structured, with section numbering and 3, 4 and 5 levels of nesting. All in English I need a more efficient way to locate those paragraphs of nuggets that matter to me. So what I’d like is kind of a local document index/repository, that would allow me to have some standing queries and easily locate sections in documents that talk about my queries. Here’s an example: I’d like to load in 10 large PDF files, each of say 100 pages. Each PDF contains English text, formatted very nicely into paragraphs and sections. I’d like to specify that I am interested in “blogging platforms”, “weaknesses in Ruby”, “localization and internationalization” Ideally then look at a list that showed the section of text, the name of the document, and other information that seemed to be related to and/or include the words and phrases I specified. I am sure something like this exists. I would call it something like document indexing, document comprehension or structured searching.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Google search box

    - by user343282
    I am working on a google box, something like this, http://mytwentyfive.com/blog/wp-content/uploads/byme/Google%20Search%20Appliances.jpg I am pointing the crawler to a folder where there are html files. before the crawler was crawling the files and indexing them but right now it finds the pattern or the folder but not following any html files within the folder. I have tried everything I could and know but, can't think of anything else. Can someone help? thanks

    Read the article

  • Recursive Binary Search Tree Insert

    - by Nick Sinklier
    So this is my first java program, but I've done c++ for a few years. I wrote what I think should work, but in fact it does not. So I had a stipulation of having to write a method for this call: tree.insertNode(value); where value is an int. I wanted to write it recursively, for obvious reasons, so I had to do a work around: public void insertNode(int key) { Node temp = new Node(key); if(root == null) root = temp; else insertNode(temp); } public void insertNode(Node temp) { if(root == null) root = temp; else if(temp.getKey() <= root.getKey()) insertNode(root.getLeft()); else insertNode(root.getRight()); } Thanks for any advice.

    Read the article

  • XPath ordered priority attribute search

    - by user94000
    I want to write an XPath that can return some link elements on an HTML DOM. The syntax is wrong, but here is the gist of what I want: //web:link[@text='Login' THEN_TRY @href='login.php' THEN_TRY @index=0] THEN_TRY is a made-up operator, because I can't find what operator(s) to use. If many links exist on the page for the given set of [attribute=name] pairs, the link which matches the most left-most attribute(s) should be returned instead of any others. For example, consider a case where the above example XPath finds 3 links that match any of the given attributes: link A: text='Sign In', href='Login.php', index=0 link B: text='Login', href='Signin.php', index=15 link C: text='Login', href='Login.php', index=22 Link C ranks as the best match because it matches the First and Second attributes. Link B ranks second because it only matches the First attribute. Link A ranks last because it does not match the First attribute; it only matches the Second and Third attributes. The XPath should return the best match, Link C. If more than one link were tied for "best match", the XPath should return the first best link that it found on the page.

    Read the article

  • Radial Grid Search Algorithm

    - by grey
    I'm sure there's a clean way to do this, but I'm probably not using the right keywords for find it. So let's say I have a grid. Starting from a position on the grid, return all of the grid coordinates that fall within a given distance. So I call something like: getCoordinates( currentPosition, distance ) And for each coordinate, starting from the initial position, add all cardinal directions, and then add the spaces around those and so forth until the distance is reached. I imagine that on a grid this would look like a diamond.

    Read the article

  • Breadth first search all paths

    - by Amndeep7
    First of all, thank you for looking at this question. For a school assignment we're supposed to create a BFS algorithm and use it to do various things. One of these things is that we're supposed to find all of the paths between the root and the goal nodes of a graph. I have no idea how to do this as I can't find a way to keep track of all of the alternate routes without also including copies/cycles. Here is my BFS code: def makePath(predecessors, last): return makePath(predecessors, predecessors[last]) + [last] if last else [] def BFS1b(node, goal): Q = [node] predecessor = {node:None} while Q: current = Q.pop(0) if current[0] == goal: return makePath(predecessor, goal) for subnode in graph[current[0]][2:]: if subnode[0] not in predecessor: predecessor[subnode[0]] = current[0] Q.append(subnode[0]) A conceptual push in the right direction would be greatly appreciated. tl;dr How do I use BFS to find all of the paths between two nodes?

    Read the article

  • Exploring search options for PHP

    - by Joshua
    I have innoDB table using numerous foreign keys, but we just want to look up some basic info out of it. I've done some research but still lost. 1) How can I tell if my host has Sphinx installed already? I don't see it as an option for table storage method (i.e. innodb, myisam). 2) Zend_Search_Lucene, responsive enough for AJAX functionality of millions of records? 3) Mirror my innoDB with a myisam? Make every innodb transaction end with a write to the myisam, then use 1:1 lookups? How would I do this automagically? This should make MyISAM ACID-compliant and free(er) from corruption no? 4) PostgreSQL fulltext queries don't even look like SQL to me wtf, I don't have time to learn a new SQL syntax I need noob options 5) ???????????????????? This is high volume site on a decently-equipped VPS Thanks very much for any ideas.

    Read the article

  • How to index and search .doc files

    - by Jared
    I have an application that needs to have .doc files uploaded to it. These documents should then be index and the whole collection of documents should be searchable. This will run on a Windows Server, without Word installed, using IIS and SqlServer, but I'd rather not be tied to SqlServer's full text indexing. I was thinking of using Lucene.Net for the indexing part and was wondering what the best way to get the text out of the .doc files would be. I could probably extract the text by reading in the whole stream and then using a regEx to pull out any regular characters, but that seems hefty and prone to error. I saw an article on using iFilters that sounds promising, but I thought I'd put this out there since it's not something I'm familiar with. P.S. If it matters, these .doc files will have mail-merge fields in them and there's no other current alternative for the .doc format.

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Select distinct... in fulltext search

    - by lam3r4370
    <?php session_start(); $user =$_GET['user']; $conn = mysql_connect("localhost","...","..."); mysql_select_db("..."); $sql= "SELECT filter FROM userfilter WHERE user='$user'"; $mksql = mysql_query($sql); while($row =mysql_fetch_assoc($mksql)) { $filter=$row['filter']; $sql2 = "SELECT DISTINCT * FROM rss WHERE MATCH(content,title) AGAINST ('$filter')"; $mksql2 = mysql_query($sql2) or die(mysql_error()); while($rows=mysql_fetch_assoc($mksql2)) { echo ..... } ?> If I have two rows content that contains the $filter ,it outputs me that content but it's repeating. For example: title|content asd |This is a sample content ,number one das |This is a sample content ,number two .... And if my keywords are "sample" and "number" ,it outputs me twice the title and the content.How to prevent that?

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • Best way to search for a saturation value in a sorted list

    - by AB Kolan
    A question from Math Battle. This particular question was also asked to me in one of my job interviews. " A monkey has two coconuts. It is fooling around by throwing coconut down from the balconies of M-storey building. The monkey wants to know the lowest floor when coconut is broken. What is the minimal number of attempts needed to establish that fact? " Conditions: if a coconut is broken, you cannot reuse the same. You are left with only with the other coconut Possible approaches/strategies I can think of are Binary break ups & once you find the floor on which the coconut breaks use upcounting from the last found Binary break up lower index. Window/Slices of smaller sets of floors & use binary break up within the Window/Slice (but on the down side this would require a Slicing algorithm of it's own.) Wondering if there are any other way to do this.

    Read the article

  • findNode in binary search tree

    - by Weadadada Awda
    Does this look right? I mean I am trying to implement the delete function. Node* BST::findNode(int tofind) { Node* node = new Node; node = root; while (node != NULL) { if (node->val == tofind) { return node; } else if (tofind < node->val) { node = node->left; } else { node = node->right; } } } Here is the delete, it's not even close to done but, void BST::Delete(int todelete) { // bool found = false; Node* toDelete = new Node(); toDelete=findNode(todelete); if(toDelete->val!=NULL) { cout << toDelete->val << endl; } } This causes a segmentation fault just running that, any ideas?

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • Binary Search Tree can't delete the root

    - by Ali Zahr
    Everything is working fine in this function, but the problem is that I can't delete the root, I couldn't figure out what's the bug here.I've traced the "else part" it works fine until the return, it returns the old value I don't know why. Plz Help! node *removeNode(node *Root, int key) { node *tmp = new node; if(key > Root->value) Root->right = removeNode(Root->right,key); else if(key < Root->value) Root->left = removeNode(Root->left, key); else if(Root->left != NULL && Root->right != NULL) { node *minNode = findNode(Root->right); Root->value = minNode->value; Root->right = removeNode(Root->right,Root->value); } else { tmp = Root; if(Root->left == NULL) Root = Root->right; else if(Root->right == NULL) Root = Root->left; delete tmp; } return Root; }

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

< Previous Page | 52 53 54 55 56 57 58 59 60 61 62 63  | Next Page >