Search Results

Search found 36003 results on 1441 pages for 'try catch'.

Page 56/1441 | < Previous Page | 52 53 54 55 56 57 58 59 60 61 62 63  | Next Page >

  • Google Web Toolkit Deferred Binding Issue

    - by snctln
    I developed a web app using GWT about 2 years ago, since then the application has evolved. In its current state it relies on fetching a single XML file and parsing the information from it. Overall this works great. A requirement of this app is that it needs to be able to be ran from the filesystem (file:///..) as well as the traditional model of running from a webserver (http://...) Fetching this file from a webserver works exactly as expected using a RequestBuilder object. When running the app from the filesystem Firefox, Opera, Safari, and Chrome all behave as expected. When running the app from the filesystem using IE7 or IE8 the RequestBuilder.send() call fails, the information about the error suggests that there is a problem accessing the file due to violating the same origin policy. The app worked as expected in IE6 but not in IE7 or IE8. So I looked at the source code of RequestBuilder.java and saw that the actual request was being executed with an XMLHttpRequest GWT object. So I looked at the source code for XMLHttpRequest.java and found out some information. Here is the code (starts at line 83 in XMLHttpRequest.java) public static native XMLHttpRequest create() /*-{ if ($wnd.XMLHttpRequest) { return new XMLHttpRequest(); } else { try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } } }-*/; So basically if an XMLHttpRequest cannot be created (like in IE6 because it is not available) an ActiveXObject is used instead. I read up a little bit more on the IE implementation of XMLHttpRequest, and it appears that it is only supported for interacting with files on a webserver. I found a setting in IE8 (Tools-Internet Options-Advanced-Security-Enable native XMLHTTP support), when I uncheck this box my app works. I assume this is because I am more of less telling IE to not use their implementation of XmlHttpRequest, so GWT just uses an ActiveXObject because it doesn't think the native XmlHttpRequest is available. This fixes the problem, but is hardly a long term solution. I can currently catch a failed send request and verify that it was trying to fetch the XML file from the filesystem using normal GWT. What I would like to do in this case is catch the IE7 and IE8 case and have them use a ActiveXObject instead of a native XmlHttpRequest object. There was a posting on the GWT google group that had a supposed solution for this problem (link). Looking at it I can tell that it was created for an older version of GWT. I am using the latest release and think that this is more or less what I would like to do (use GWT deferred binding to detect a specific browser type and run my own implementation of XMLHttpRequest.java in place of the built in GWT implementation). Here is the code that I am trying to use package com.mycompany.myapp.client; import com.google.gwt.xhr.client.XMLHttpRequest; public class XMLHttpRequestIE7or8 extends XMLHttpRequest { // commented out the "override" so that eclipse and the ant build script don't throw errors //@Override public static native XMLHttpRequest create() /*-{ try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } }-*/; // have an empty protected constructor so the ant build script doesn't throw errors // the actual XMLHttpRequest constructor is empty as well so this shouldn't cause any problems protected XMLHttpRequestIE7or8() { } }; And here are the lines that I added to my module xml <replace-with class="com.mycompany.myapp.client.XMLHttpRequestIE7or8"> <when-type-is class="com.google.gwt.xhr.client.XMLHttpRequest"/> <any> <when-property-is name="user.agent" value="ie7" /> <when-property-is name="user.agent" value="ie8" /> </any> </replace-with> From what I can tell this should work, but my code never runs. Does anyone have any idea of what I am doing wrong? Should I not do this via deferred binding and just use native javascript when I catch the fail case instead? Is there a different way of approaching this problem that I have not mentioned? All replies are welcome.

    Read the article

  • Customizing / overriding ComboBox (2 replies)

    Hi, I would override a Windows.Forms.Combobox to have a MyObjectCollection instead of a ObjectCollection as Items property. I've try writing this code, but it seems that items are stored somewhere else (not in Items property). I can add items to collection but when I try to select an item from the combobox (at runtime) an exception tells me that there is no such element in Items (litterally it tel...

    Read the article

  • Should UTF-16 be considered harmful?

    - by Artyom
    I'm going to ask what is probably quite a controversial question: "Should one of the most popular encodings, UTF-16, be considered harmful?" Why do I ask this question? How many programmers are aware of the fact that UTF-16 is actually a variable length encoding? By this I mean that there are code points that, represented as surrogate pairs, take more than one element. I know; lots of applications, frameworks and APIs use UTF-16, such as Java's String, C#'s String, Win32 APIs, Qt GUI libraries, the ICU Unicode library, etc. However, with all of that, there are lots of basic bugs in the processing of characters out of BMP (characters that should be encoded using two UTF-16 elements). For example, try to edit one of these characters: 𝄞 (U+1D11E) MUSICAL SYMBOL G CLEF 𝕥 (U+1D565) MATHEMATICAL DOUBLE-STRUCK SMALL T 𝟶 (U+1D7F6) MATHEMATICAL MONOSPACE DIGIT ZERO 𠂊 (U+2008A) Han Character You may miss some, depending on what fonts you have installed. These characters are all outside of the BMP (Basic Multilingual Plane). If you cannot see these characters, you can also try looking at them in the Unicode Character reference. For example, try to create file names in Windows that include these characters; try to delete these characters with a "backspace" to see how they behave in different applications that use UTF-16. I did some tests and the results are quite bad: Opera has problem with editing them (delete required 2 presses on backspace) Notepad can't deal with them correctly (delete required 2 presses on backspace) File names editing in Window dialogs in broken (delete required 2 presses on backspace) All QT3 applications can't deal with them - show two empty squares instead of one symbol. Python encodes such characters incorrectly when used directly u'X'!=unicode('X','utf-16') on some platforms when X in character outside of BMP. Python 2.5 unicodedata fails to get properties on such characters when python compiled with UTF-16 Unicode strings. StackOverflow seems to remove these characters from the text if edited directly in as Unicode characters (these characters are shown using HTML Unicode escapes). WinForms TextBox may generate invalid string when limited with MaxLength. It seems that such bugs are extremely easy to find in many applications that use UTF-16. So... Do you think that UTF-16 should be considered harmful?

    Read the article

  • bashrc script not accepting space in directory name

    - by faizal
    I have added a variable at the end of my ~/.basrc file : export xyz = /home/faizal/DEV/ADT workspace/xyz But if i open a new terminal, i get the error : bash: export: 'workspace/xyz': not a valid identifier So i try a variety of alternatives : export xyz=/home/faizal/DEV/ADT\ workspace/xyz export xyz="/home/faizal/DEV/ADT workspace/xyz" export xyz="/home/faizal/DEV/ADT\ workspace/xyz" export xyz='/home/faizal/DEV/ADT workspace/xyz' export xyz='/home/faizal/DEV/ADT\ workspace/xyz' They all give me the error when i try cd $xyz: bash: cd: /home/faizal/DEV/ADT: No such file or directory What am i doing wrong?

    Read the article

  • Ubuntu 12.04 GUI doesn't load after Virtualbox crash

    - by Itamar Katz
    I have Ubuntu 12.04 64 bit installed as a virtual OS in Virtualbox (the host is windows 7). The Virtualbox data file is on a usb drive that lost connection to the PC while a session was running. Now when I try to start the Ubuntu virtual OS, I get a terminal login screen, but no GUI. When I try to login I get the message sh: 1: cannot create /var/run/motd.new: Directory nonexistent Any suggestions? Can I recover the system?

    Read the article

  • bumblebee does not work with metacity and KWin, but works with compiz

    - by cpu2
    If I try to launch something with optirun under compiz, it works. If I try to launch something with optirun under KDE or metacity, it gives me: [ 247.384077] [ERROR]Cannot access secondary GPU - error: [XORG] (EE) [ 247.384117] [ERROR]Aborting because fallback start is disabled. If it matters, I'm trying to launch Portal 2 with wine I have: Nvidia GeForce GT540M with optimus Acer Aspire Timeline X Intel core i5 and 3000 Integrated Graphics

    Read the article

  • Customizing / overriding ComboBox (2 replies)

    Hi, I would override a Windows.Forms.Combobox to have a MyObjectCollection instead of a ObjectCollection as Items property. I've try writing this code, but it seems that items are stored somewhere else (not in Items property). I can add items to collection but when I try to select an item from the combobox (at runtime) an exception tells me that there is no such element in Items (litterally it tel...

    Read the article

  • java webservice requires usernametoken over basichttpbinding (3 replies)

    I need to call a Java webservice. I can add a service reference without problems, and I get Intellisense in Visual Studio. However, when I try to call a service method I get an error message saying &quot;Missing (user) Security Information&quot;. I n my code I try to set usercredentials: testWS.WarrantyClaimServiceClient svc new TestClient.testWS.WarrantyClaimServiceClient(); svc.ClientCredentials.UserName....

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • hibernate not picking sessionFactory

    - by Satya
    My application-context.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE beans PUBLIC "-//SPRING//DTD BEAN//EN" "http://www.springframework.org/dtd/spring-beans.dtd"> <beans> <bean id="myDataSource" class="org.apache.commons.dbcp.BasicDataSource" destroy-method="close"> <property name="driverClassName"><value>com.mysql.jdbc.Driver</value></property> <property name="url"><value>jdbc:mysql://localhost:3306/myDB</value></property> <property name="username"><value>myUser</value></property> <property name="password"><value>myUser</value></property> </bean> <bean id="mySessionFactory" class="org.springframework.orm.hibernate3.LocalSessionFactoryBean"> <property name="mappingResources"> <property name="dataSource"><ref bean="myDataSource"/></property> <list> <value>com/x/model/config/hibernate/user.hbm.xml</value> </list> </property> <property name="hibernateProperties" > <value> hibernate.dialect=org.hibernate.dialect.MySQLDialect </value> </property> </bean> <bean id="userdao" class="com.x.y.z.UserDao"> <property name="sessionFactory"><ref bean="mySessionFactory"/></property> </bean> </beans> user.hbm.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="com.cpt.model"> <class name="User" table="user"> <id name="userId" column="id"> <generator class="native"/> </id> <property name="firstname" column="firstName" /> <property name="lastName" column="lastName"/> <property name="login" column="login"/> <property name="pass" column="pass"/> <property name="superemail" column="superEmail"/> </class> </hibernate-mapping> and the UserDao is package com.x.y.z; import java.sql.Connection; import java.sql.DriverManager; import java.sql.SQLException; import java.sql.Statement; import org.hibernate.HibernateException; import org.hibernate.Session; import org.hibernate.SessionFactory; import org.hibernate.cfg.Configuration; import org.springframework.beans.factory.annotation.Autowired; import org.springframework.orm.hibernate.support.HibernateDaoSupport; import org.springframework.stereotype.Component; import com.x.model.User; @Component public class UserDao { private SessionFactory sessionFactory; public void addUser(User user) { Session session; try { try { session = getSessionFactory().openSession(); // session = sessionFactory.openSession(); session.save(user); } catch (RuntimeException e) { // TODO Auto-generated catch block e.printStackTrace(); } } catch (HibernateException e) { // TODO Auto-generated catch block System.out.println("printing in the catch"); e.printStackTrace(); } } public SessionFactory getSessionFactory() { System.out.println("returning session factory ::: sessionFactory == null :: "+sessionFactory.openSession()); return sessionFactory; } public void setSessionFactory(SessionFactory sessionFactory) { System.out.println("this is setting session factory" + sessionFactory.getClass()); System.out.println("setting session factory ::: sessionFactory == null :: "+sessionFactory==null); this.sessionFactory = sessionFactory; System.out.println("setting session factory ::: sessionFactory == null :: "+this.sessionFactory.openSession().getClass()); System.out.println(getSessionFactory().openSession().isOpen()); } } However, I keep getting 14:45:09,929 INFO [org.hibernate.impl.SessionFactoryImpl] building session fact ory 14:45:09,933 WARN [net.sf.ehcache.config.Configurator] No configuration found. Configuring ehcache from ehcache-failsafe.xml found in the classpath: vfs:/C:/jb /server/default/deploy/C.war/WEB-INF/lib/ehcache-1.1.jar/ehcache-failsafe.xml 14:45:10,007 INFO [org.hibernate.impl.SessionFactoryObjectFactory] Not binding factory to JNDI, no JNDI name configured 14:45:10,008 INFO [org.hibernate.impl.SessionFactoryImpl] Checking 0 named quer ies 14:45:10,017 INFO [STDOUT] this is setting session factoryclass $Proxy178 14:45:10,017 INFO [STDOUT] false 14:45:10,019 INFO [STDOUT] setting session factory ::: sessionFactory == null : : class org.hibernate.impl.SessionImpl 14:45:10,020 INFO [STDOUT] returning session factory ::: sessionFactory == null :: org.hibernate.impl.SessionImpl(PersistentContext[entitiesByKey={}] ActionQue ue[insertions=[] updates=[] deletions=[] collectionCreations=[] collectionRemova ls=[] collectionUpdates=[]]) It is giving sessionFactory null . Any Idea where am I failing ? Thanks

    Read the article

  • determine if udp socket can be accessed via external client

    - by JohnMerlino
    I don't have access to company firewall server. but supposedly the port 1720 is open on my one ubuntu server. So I want to test it with netcat: sudo nc -ul 1720 The port is listening on the machine ITSELF: sudo netstat -tulpn | grep nc udp 0 0 0.0.0.0:1720 0.0.0.0:* 29477/nc The port is open and in use on the machine ITSELF: lsof -i -n -P | grep 1720 gateway 980 myuser 8u IPv4 187284576 0t0 UDP *:1720 Checked the firewall on current server: sudo ufw allow 1720/udp Skipping adding existing rule Skipping adding existing rule (v6) sudo ufw status verbose | grep 1720 1720/udp ALLOW IN Anywhere 1720/udp ALLOW IN Anywhere (v6) But I try echoing data to it from another computer (I replaced the x's with the real integers): echo "Some data to send" | nc xx.xxx.xx.xxx 1720 But it didn't write anything. So then I try with telnet from the other computer as well: telnet xx.xxx.xx.xxx 1720 Trying xx.xxx.xx.xxx... telnet: connect to address xx.xxx.xx.xxx: Operation timed out telnet: Unable to connect to remote host Although I don't think telnet works with udp sockets. I ran nmap from another computer within the same local network and this is what I got: sudo nmap -v -A -sU -p 1720 xx.xxx.xx.xx Starting Nmap 5.21 ( http://nmap.org ) at 2013-10-31 15:41 EDT NSE: Loaded 36 scripts for scanning. Initiating Ping Scan at 15:41 Scanning xx.xxx.xx.xx [4 ports] Completed Ping Scan at 15:41, 0.10s elapsed (1 total hosts) Initiating Parallel DNS resolution of 1 host. at 15:41 Completed Parallel DNS resolution of 1 host. at 15:41, 0.00s elapsed Initiating UDP Scan at 15:41 Scanning xtremek.com (xx.xxx.xx.xx) [1 port] Completed UDP Scan at 15:41, 0.07s elapsed (1 total ports) Initiating Service scan at 15:41 Initiating OS detection (try #1) against xtremek.com (xx.xxx.xx.xx) Retrying OS detection (try #2) against xtremek.com (xx.xxx.xx.xx) Initiating Traceroute at 15:41 Completed Traceroute at 15:41, 0.01s elapsed NSE: Script scanning xx.xxx.xx.xx. NSE: Script Scanning completed. Nmap scan report for xtremek.com (xx.xxx.xx.xx) Host is up (0.00013s latency). PORT STATE SERVICE VERSION 1720/udp closed unknown Too many fingerprints match this host to give specific OS details Network Distance: 1 hop TRACEROUTE (using port 1720/udp) HOP RTT ADDRESS 1 0.13 ms xtremek.com (xx.xxx.xx.xx) Read data files from: /usr/share/nmap OS and Service detection performed. Please report any incorrect results at http://nmap.org/submit/ . Nmap done: 1 IP address (1 host up) scanned in 2.04 seconds Raw packets sent: 27 (2128B) | Rcvd: 24 (2248B). The only thing I can think of is a firewall or vpn issue. Is there anything else I can check for before requesting that they look at the firewall server again?

    Read the article

  • How to configure dbus to allow ssh-user to suspend server?

    - by Produnis
    I try to suspend my server using dbus and UPower. The server runs Ubuntu LucidLynx 64bit. While everything works fine if I am sitting directly at the machine, it won't work via ssh. If I connect to the server via ssh and try to suspend the machine using dbus and upower, it gives back dbus.exceptions.DBusException: org.freedesktop.UPower.GeneralError: not authorized Could anyone please tell me how to configure dbus in order to allow ssh-users to suspend the machine?

    Read the article

  • Can not authenticate to run GParted

    - by alfish
    Whenever I try to run a program from gnome gui, I get message Authenticated is required to run the Gparted Partition Editor The same goes for all programs that need root permission and I try to run from 'System tools' in my gnome-fallback. However the same user can become root in gnome terminal with no problem (I added the user to sudoers). I must mention that I've changed the user's password after OS install, so I think I need to update something but don't know what. I appreciate your hints.

    Read the article

  • permission denied to move files

    - by James
    i want to clear space on my computer in order to download drivers for my internet, so i tried moving files to a different location, unfortunately i dont have permission to do this, how do i change this, i should point out that i am not logged in, i think im a guest or something because if i log in i can not gain access to the internet to download the drivers that i need, so im using the cd and using the try ubunt feature to try achieve downloading the drivers. this is very frustrating for me as im new and have not got a clue how to do this

    Read the article

  • Can not authenticate form system tools

    - by alfish
    Whenever I try to run a program from gnome, I get messages like Authenticated is required to run the Gparted Partition Editor The same goes for all programs that need root permission and I try to run from 'System tools' in my gnome-fallback. However the same user can become root in gnome terminal with no problem (I added the user to sudoers). I must mention that I've changed the user's password after OS install, so I think I need to update something but don't know what. I appreciate your hints.

    Read the article

  • install Ubuntu and remove Windows 7

    - by dani
    I'm using Windows 7 on my laptop (2GB RAM, 250 GB HDD). I want to install Ubuntu and remove Windows 7. I have Partitioned my laptop into 2 partitions: , C Drive - 105 GB and D Drive - 145 GB. I want to install Ubuntu on C drive all my data in D drive, no backup I have already selected the "Try something else option " /dev/sdb /dev/sdb1 ntfs 104855 MB unknown C drive /dev/sdb5 ntfs 145192 MB unknown D drive I need help using the "Try Something Else" Option My course of action: laptop power on bootubuntu nextsomething elsepartition.

    Read the article

  • Brocken package manager due to incorrect Banshee package

    - by user54974
    Sup, so, I'm not familiar with linux at all so help is much appreciated. I've been trying to boot my pc up from a live CD unsuccessfully. I get to the stage at which there are the options to test without installing or install or so on where I select 'Install Ubuntu.' Here it relays through some fast DOS commands until it reaches 'end trace' and then, eventually, 'Killed.' I have already got a functional 11.10 version installed, could this be a problem? The reason I am attempting a reinstall is because the package system is damaged inside 11.10, a problem I can't seem to solve. If I try to install any new software from within the software centre it tells me that two banshee extensions must be removed. I try to remove these from inside the terminal, using apt-get remove, which results in:** You might want to run apt-get -f install to correct these: The following packages have unmet dependencies. banshee-extension-ubuntuonemusicstore : Depends: banshee (>= 2.2.1) but 2.2.0-1ubuntu2 is to be installed E: Unmet dependencies. Try 'apt-get -f install' with no packages (or specify a solution). The software centre suggests that I disable all third party repositories and run apt-get install -f I have done so but the package system remains damaged and apt-get install -fattempts to install banshee 2.2.1 but returns: Errors were encountered while processing: /var/cache/apt/archives/banshee_2.2.1-1ubuntu3_i386.deb E: Sub-process /usr/bin/dpkg returned an error code (1) I have also tried apt-get update (runs fine) and apt-get upgrade. The upgrade command apt-get upgrade results in: Reading package lists... Done Building dependency tree Reading state information... Done You might want to run ‘apt-get -f install’ to correct these. The following packages have unmet dependencies. banshee-extension-soundmenu : Depends: banshee (>= 2.2.1) but 2.2.0-1ubuntu2 is installed banshee-extension-ubuntuonemusicstore : Depends: banshee (>= 2.2.1) but 2.2.0-1ubuntu2 is installed E: Unmet dependencies. Try using -f. I seem to be going round and round in circles here! If only I could reinstall successfully. Only proposed updates (oneiric proposed) is not enabled.

    Read the article

  • Deleting Large Number of Records

    Often someone will try to perform a delete on a large number of records and run into a number of problems. Slow performance, log growth, and more. Lynn Pettis shows us how to better handle this situation in SQL Server 2000 and SQL Server 2005 The Future of SQL Server Monitoring "Being web-based, SQL Monitor 2.0 enables you to check on your servers from almost any location" Jonathan Allen.Try SQL Monitor now.

    Read the article

  • ssh: connect to host 192.168.1.7 port 22: Connection refused

    - by Rudra
    I get this error when ever I try to connect my desktop with another desktop using SSH, but I'm able to ping the other desktop successfully. ssh: connect to host 192.168.1.7 port 22: Connection refused When I try to restart sshd, it says sshd : unrecognized service I can connect to remote server using SSH but I'm not able to connect within the local network. Please help me in this regards, Thanks in advance.

    Read the article

  • Netbeans Java SE GUI Builder: private initComponents() problem

    - by maSnun
    When I build a GUI for my Java SE app with Netbeans GUI builder, it puts all the codes in the initComponents() method which is private. I could not change it to public. So, all the components are accessible only to the class containing the UI. I want to access those components from another class so that I can write custom event handlers and everything. Most importantly I want to separate my GUI code and non-GUI from each other. I can copy paste the GUI code and later make them public by hand to achieve what I want. But thats a pain. I have to handcraft a portion whenever I need to re-design the UI. What I tried to do: I used the variable identifier to make the text box public. Now how can I access the text box from the Main class? I think I need the component generated in a public method as well. I am new to Java. Any helps? Here's the sample classes: The UI (uiFrame.java) /* * To change this template, choose Tools | Templates * and open the template in the editor. */ /* * uiFrame.java * * Created on Jun 3, 2010, 9:33:15 PM */ package barcode; import java.util.logging.Level; import java.util.logging.Logger; import javax.swing.JFileChooser; import javax.swing.UIManager; import javax.swing.UnsupportedLookAndFeelException; import net.sourceforge.barbecue.output.OutputException; /** * * @author masnun */ public class uiFrame extends javax.swing.JFrame { /** Creates new form uiFrame */ public uiFrame() { try { try { // Set cross-platform Java L&F (also called "Metal") UIManager.setLookAndFeel(UIManager.getSystemLookAndFeelClassName()); } catch (ClassNotFoundException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (InstantiationException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (IllegalAccessException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (UnsupportedLookAndFeelException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } finally { } initComponents(); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { label1 = new javax.swing.JLabel(); textBox = new javax.swing.JTextField(); saveButton = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); label1.setFont(label1.getFont().deriveFont(label1.getFont().getStyle() | java.awt.Font.BOLD, 13)); label1.setText("Type a text:"); label1.setName("label1"); // NOI18N saveButton.setText("Save"); saveButton.addMouseListener(new java.awt.event.MouseAdapter() { public void mousePressed(java.awt.event.MouseEvent evt) { saveButtonMousePressed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(56, 56, 56) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, 272, javax.swing.GroupLayout.PREFERRED_SIZE) .addContainerGap(72, Short.MAX_VALUE)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(154, Short.MAX_VALUE) .addComponent(saveButton, javax.swing.GroupLayout.PREFERRED_SIZE, 102, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(144, 144, 144)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(140, Short.MAX_VALUE) .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 133, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(127, 127, 127)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 25, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.RELATED) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.UNRELATED) .addComponent(saveButton) .addContainerGap(193, Short.MAX_VALUE)) ); pack(); }// </editor-fold> @SuppressWarnings("static-access") private void saveButtonMousePressed(java.awt.event.MouseEvent evt) { JFileChooser file = new JFileChooser(); file.showSaveDialog(null); String data = file.getSelectedFile().getAbsolutePath(); String text = textBox.getText(); BarcodeGenerator barcodeFactory = new BarcodeGenerator(); try { barcodeFactory.generateBarcode(text, data); } catch (OutputException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } /** * @param args the command line arguments */ // Variables declaration - do not modify private javax.swing.JLabel label1; private javax.swing.JButton saveButton; public javax.swing.JTextField textBox; // End of variables declaration } The Main Class (Main.java) package barcode; import javax.swing.JFrame; public class Main { public static void main(String[] args) { JFrame ui = new uiFrame(); ui.pack(); ui.show(); } }

    Read the article

  • NIS client authentication

    - by Tarun Gupta
    How to configure the nis client on ubuntu? and how to configure system authentication? there is no option for system authentication like system setting system info in my system etc. when ever i go to software center and search them nis authentication then i got one package for nis authentication and i try to install them then one error occur that is remove hostname utility. when i try to remove hostname utility then it does not remove.

    Read the article

  • Can't install a dependency?

    - by Chibueze Opata
    I've been trying to install 'boot-repair' but it keeps saying: The following packages have unmet dependencies: Depends: boot-sav (= 3.196) but 3.196~ppa3~quantal is to be installed E: Unable to correct problems, you have held broken packages. When I try installing 'boot-sav', everything seems okay, but when I try it again, it just shows the same message over and over again. How can I fix such a problem? Thanks.

    Read the article

  • Starting software projects

    - by shox
    Always , when i try to start new project , with what i think new ideas , first of all i search the web to try to find some thing same, most of the time ( if not all ) , i find that my ideas of new project have been implemented hundred of times , i think every one in software industry , feel this every day , the question is : when should i approve an idea and start building it , although its implemented hundred of times around the world . How i can make my way in trying of build something new

    Read the article

  • Java RMI cannot connect to host from external client.

    - by Koe
    I've been using RMI in this project for a while. I've gotten the client program to connect (amongst other things) to the server when running it over my LAN, however when running it over the internet I'm running into the following exception: java.rmi.ConnectException: Connection refused to host: (private IP of host machine); nested exception is: java.net.ConnectException: Connection timed out: connect at sun.rmi.transport.tcp.TCPEndpoint.newSocket(Unknown Source) at sun.rmi.transport.tcp.TCPChannel.createConnection(Unknown Source) at sun.rmi.transport.tcp.TCPChannel.newConnection(Unknown Source) at sun.rmi.server.UnicastRef.invoke(Unknown Source) at java.rmi.server.RemoteObjectInvocationHandler.invokeRemoteMethod(Unknown Source) at java.rmi.server.RemoteObjectInvocationHandler.invoke(Unknown Source) at $Proxy1.ping(Unknown Source) at client.Launcher$PingLabel.runPing(Launcher.java:366) at client.Launcher$PingLabel.<init>(Launcher.java:353) at client.Launcher.setupContentPane(Launcher.java:112) at client.Launcher.<init>(Launcher.java:99) at client.Launcher.main(Launcher.java:59) Caused by: java.net.ConnectException: Connection timed out: connect at java.net.PlainSocketImpl.socketConnect(Native Method) at java.net.PlainSocketImpl.doConnect(Unknown Source) at java.net.PlainSocketImpl.connectToAddress(Unknown Source) at java.net.PlainSocketImpl.connect(Unknown Source) at java.net.SocksSocketImpl.connect(Unknown Source) at java.net.Socket.connect(Unknown Source) at java.net.Socket.connect(Unknown Source) at java.net.Socket.<init>(Unknown Source) at java.net.Socket.<init>(Unknown Source) at sun.rmi.transport.proxy.RMIDirectSocketFactory.createSocket(Unknown Source) at sun.rmi.transport.proxy.RMIMasterSocketFactory.createSocket(Unknown Source) ... 12 more This error is remeniscent of my early implementation of RMI and I can obtain the error verbatum if I run the client locally without the server program running as well. To me Connection Timed Out means a problem with the server's response. Here's the client initiation: public static void main(String[] args) { try { String host = "<WAN IP>"; Registry registry = LocateRegistry.getRegistry(host, 1099); Login lstub = (Login) registry.lookup("Login Server"); Information istub = (Information) registry.lookup("Game Server"); new Launcher(istub, lstub); } catch (RemoteException e) { System.err.println("Client exception: " + e.toString()); e.printStackTrace(); } catch (NotBoundException e) { System.err.println("Client exception: " + e.toString()); e.printStackTrace(); } } Interestingly enough no Remote Exception is thrown here. Here's the server initiation: public static void main(String args[]) { try { GameServer gobj = new GameServer(); Information gstub = (Information) UnicastRemoteObject.exportObject( gobj, 1099); Registry registry = LocateRegistry.createRegistry(1099); registry.bind("Game Server", gstub); LoginServer lobj = new LoginServer(gobj); Login lstub = (Login) UnicastRemoteObject.exportObject(lobj, 7099); // Bind the remote object's stub in the registry registry.bind("Login Server", lstub); System.out.println("Server ready"); } catch (Exception e) { System.err.println("Server exception: " + e.toString()); e.printStackTrace(); } } Bad practice with the catch(Exception e) I know but bear with me. Up to this stage I know it works fine over the LAN, here's where the exception occurs over the WAN and is the first place a method in the server is called: private class PingLabel extends JLabel { private static final long serialVersionUID = 1L; public PingLabel() { super(""); runPing(); } public void setText(String text) { super.setText("Ping: " + text + "ms"); } public void runPing() { try { PingThread pt = new PingThread(); gameServer.ping(); pt.setRecieved(true); setText("" + pt.getTime()); } catch (RemoteException e) { e.printStackTrace(); } } } That's a label placed on the launcher as a ping test. the method ping(), in gameserver does nothing, as in is a null method. It's worth noting also that ports 1099 and 7099 are forwarded to the server machine (which should be obvious from the stack trace). Can anyone see anyting I'm missing/doing wrong? If you need any more information just ask. EDIT: I'm practically certain the problem has nothing to do with my router settings. When disabling my port forwarding settings I get a slightly different error: Client exception: java.rmi.ConnectException: Connection refused to host: (-WAN IP NOT LOCAL IP-); but it appears both on the machine locally connected to the server and on the remote machine. In addition, I got it to work seamlessly when connecting the server straight tho the modem (cutting out the router. I can only conclude the problem is in my router's settings but can't see where (I've checked and double checked the port forwarding page). That's the only answer i can come up with.

    Read the article

  • Can't access windows 7 shared files on Ubuntu 11.10

    - by Corey
    I just set up ubuntu 11.10 and Samba. I got it to access shares on a Vista machine, but when I try to access the shares on a windows 7 machine it asks for a Username, Domain, and Password. I have no password set up on the windows 7 machine so I put in the username, and domain try to connect and the password prompt keeps appearing...also tried guest and admin with no luck...I've tried many different fixes(modifying registry entries & advanced securities on the win 7 machine) with no luck. Thanks

    Read the article

< Previous Page | 52 53 54 55 56 57 58 59 60 61 62 63  | Next Page >