Search Results

Search found 14567 results on 583 pages for 'document converter'.

Page 576/583 | < Previous Page | 572 573 574 575 576 577 578 579 580 581 582 583  | Next Page >

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • plupload variable upload path?

    - by SoulieBaby
    Hi all, I'm using plupload to upload files to my server (http://www.plupload.com/index.php), however I wanted to know if there was any way of making the upload path variable. Basically I need to select the upload path folder first, then choose the files using plupload and then upload to the initially selected folder. I've tried a few different ways but I can't seem to pass along the variable folder path to the upload.php file. I'm using the flash version of plupload. If someone could help me out, that would be fantastic!! :) Here's my plupload jquery: jQuery.noConflict(); jQuery(document).ready(function() { jQuery("#flash_uploader").pluploadQueue({ // General settings runtimes: 'flash', url: '/assets/upload/upload.php', max_file_size: '10mb', chunk_size: '1mb', unique_names: false, // Resize images on clientside if we can resize: {width: 500, height: 350, quality: 100}, // Flash settings flash_swf_url: '/assets/upload/flash/plupload.flash.swf' }); }); And here's the upload.php file: <?php /** * upload.php * * Copyright 2009, Moxiecode Systems AB * Released under GPL License. * * License: http://www.plupload.com/license * Contributing: http://www.plupload.com/contributing */ // HTTP headers for no cache etc header('Content-type: text/plain; charset=UTF-8'); header("Expires: Mon, 26 Jul 1997 05:00:00 GMT"); header("Last-Modified: ".gmdate("D, d M Y H:i:s")." GMT"); header("Cache-Control: no-store, no-cache, must-revalidate"); header("Cache-Control: post-check=0, pre-check=0", false); header("Pragma: no-cache"); // Settings $targetDir = $_SERVER['DOCUMENT_ROOT']."/tmp/uploads"; //temp directory <- need these to be variable $finalDir = $_SERVER['DOCUMENT_ROOT']."/tmp/uploads2"; //final directory <- need these to be variable $cleanupTargetDir = true; // Remove old files $maxFileAge = 60 * 60; // Temp file age in seconds // 5 minutes execution time @set_time_limit(5 * 60); // usleep(5000); // Get parameters $chunk = isset($_REQUEST["chunk"]) ? $_REQUEST["chunk"] : 0; $chunks = isset($_REQUEST["chunks"]) ? $_REQUEST["chunks"] : 0; $fileName = isset($_REQUEST["name"]) ? $_REQUEST["name"] : ''; // Clean the fileName for security reasons $fileName = preg_replace('/[^\w\._]+/', '', $fileName); // Create target dir if (!file_exists($targetDir)) @mkdir($targetDir); // Remove old temp files if (is_dir($targetDir) && ($dir = opendir($targetDir))) { while (($file = readdir($dir)) !== false) { $filePath = $targetDir . DIRECTORY_SEPARATOR . $file; // Remove temp files if they are older than the max age if (preg_match('/\\.tmp$/', $file) && (filemtime($filePath) < time() - $maxFileAge)) @unlink($filePath); } closedir($dir); } else die('{"jsonrpc" : "2.0", "error" : {"code": 100, "message": "Failed to open temp directory."}, "id" : "id"}'); // Look for the content type header if (isset($_SERVER["HTTP_CONTENT_TYPE"])) $contentType = $_SERVER["HTTP_CONTENT_TYPE"]; if (isset($_SERVER["CONTENT_TYPE"])) $contentType = $_SERVER["CONTENT_TYPE"]; if (strpos($contentType, "multipart") !== false) { if (isset($_FILES['file']['tmp_name']) && is_uploaded_file($_FILES['file']['tmp_name'])) { // Open temp file $out = fopen($targetDir . DIRECTORY_SEPARATOR . $fileName, $chunk == 0 ? "wb" : "ab"); if ($out) { // Read binary input stream and append it to temp file $in = fopen($_FILES['file']['tmp_name'], "rb"); if ($in) { while ($buff = fread($in, 4096)) fwrite($out, $buff); } else die('{"jsonrpc" : "2.0", "error" : {"code": 101, "message": "Failed to open input stream."}, "id" : "id"}'); fclose($out); unlink($_FILES['file']['tmp_name']); } else die('{"jsonrpc" : "2.0", "error" : {"code": 102, "message": "Failed to open output stream."}, "id" : "id"}'); } else die('{"jsonrpc" : "2.0", "error" : {"code": 103, "message": "Failed to move uploaded file."}, "id" : "id"}'); } else { // Open temp file $out = fopen($targetDir . DIRECTORY_SEPARATOR . $fileName, $chunk == 0 ? "wb" : "ab"); if ($out) { // Read binary input stream and append it to temp file $in = fopen("php://input", "rb"); if ($in) { while ($buff = fread($in, 4096)){ fwrite($out, $buff); } } else die('{"jsonrpc" : "2.0", "error" : {"code": 101, "message": "Failed to open input stream."}, "id" : "id"}'); fclose($out); } else die('{"jsonrpc" : "2.0", "error" : {"code": 102, "message": "Failed to open output stream."}, "id" : "id"}'); } //Moves the file from $targetDir to $finalDir after receiving the final chunk if($chunk == ($chunks-1)){ rename($targetDir . DIRECTORY_SEPARATOR . $fileName, $finalDir . DIRECTORY_SEPARATOR . $fileName); } // Return JSON-RPC response die('{"jsonrpc" : "2.0", "result" : null, "id" : "id"}'); ?>

    Read the article

  • Twitter Bootstrap Collapsible Navbar Duplicating

    - by sixeightzero
    I am working on a project using Twitter Bootstrap. One thing that I noticed is that my pages have duplicate navbars when they are defined as collapsible and the page is resized smaller. Here is the duplicate NavBar: Here is the normal width NavBar: Code: <!DOCTYPE html> <html lang="en"> <!--[if lt IE 7]> <html class="no-js lt-ie9 lt-ie8 lt-ie7"> <![endif]--> <!--[if IE 7]> <html class="no-js lt-ie9 lt-ie8"> <![endif]--> <!--[if IE 8]> <html class="no-js lt-ie9"> <![endif]--> <!--[if gt IE 8]><!--> <html class="no-js"> <!--<![endif]--> <head> <meta charset="utf-8"> <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1"> <title></title> <meta name="description" content=""> <meta name="viewport" content="width=device-width"> <link rel="stylesheet" href="/assets/css/bootstrap.css"> <style> body { padding-top: 60px; } </style> <link rel="stylesheet" href="/assets/css/bootstrap-responsive.min.css"> <link rel="stylesheet" href="/assets/css/main.css"> <script>window.jQuery || document.write('<script src="/assets/js/vendor/jquery-1.8.1.min.js"><\/script>')</script> <script src="/assets/js/vendor/modernizr-2.6.1-respond-1.1.0.min.js"></script> </head> <body class="dark"> <!--[if lt IE 9]> <p class="chromeframe">You are using an outdated browser. <a href="http://browsehappy.com/">Upgrade your browser today</a> or <a href="http://www.google.com/chromeframe/?redirect=true">install Google Chrome Frame</a> to better experience this site.</p> <![endif]--> <div class="navbar navbar-inverse navbar-fixed-top"> <div class="navbar-inner"> <div class="container"> <a class="btn btn-navbar" data-toggle="collapse" data-target=".nav-collapse"> <span class="icon-bar"></span> <span class="icon-bar"></span> <span class="icon-bar"></span> </a> <a class="brand" href="#">Project name</a> <div class="nav-collapse collapse"> <ul class="nav"> <li class="active"><a href="#">Home</a></li> <li><a href="#about">About</a></li> <li><a href="#contact">Contact</a></li> <li class="dropdown"> <a href="#" class="dropdown-toggle" data-toggle="dropdown">Dropdown <b class="caret"></b></a> <ul class="dropdown-menu"> <li><a href="#">Action</a></li> <li><a href="#">Another action</a></li> <li><a href="#">Something else here</a></li> <li class="divider"></li> <li class="nav-header">Nav header</li> <li><a href="#">Separated link</a></li> <li><a href="#">One more separated link</a></li> </ul> </li> </ul> </div><!--/.nav-collapse --> </div> </div> </div> Has anyone else run into this and have some pointers?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Watching setTimeout loops so that only one is running at a time.

    - by DA
    I'm creating a content rotator in jQuery. 5 items total. Item 1 fades in, pauses 10 seconds, fades out, then item 2 fades in. Repeat. Simple enough. Using setTimeout I can call a set of functions that create a loop and will repeat the process indefinitely. I now want to add the ability to interrupt this rotator at any time by clicking on a navigation element to jump directly to one of the content items. I originally started going down the path of pinging a variable constantly (say every half second) that would check to see if a navigation element was clicked and, if so, abandon the loop, then restart the loop based on the item that was clicked. The challenge I ran into was how to actually ping a variable via a timer. The solution is to dive into JavaScript closures...which are a little over my head but definitely something I need to delve into more. However, in the process of that, I came up with an alternative option that actually seems to be better performance-wise (theoretically, at least). I have a sample running here: http://jsbin.com/uxupi/14 (It's using console.log so have fireBug running) Sample script: $(document).ready(function(){ var loopCount = 0; $('p#hello').click(function(){ loopCount++; doThatThing(loopCount); }) function doThatOtherThing(currentLoopCount) { console.log('doThatOtherThing-'+currentLoopCount); if(currentLoopCount==loopCount){ setTimeout(function(){doThatThing(currentLoopCount)},5000) } } function doThatThing(currentLoopCount) { console.log('doThatThing-'+currentLoopCount); if(currentLoopCount==loopCount){ setTimeout(function(){doThatOtherThing(currentLoopCount)},5000); } } }) The logic being that every click of the trigger element will kick off the loop passing into itself a variable equal to the current value of the global variable. That variable gets passed back and forth between the functions in the loop. Each click of the trigger also increments the global variable so that subsequent calls of the loop have a unique local variable. Then, within the loop, before the next step of each loop is called, it checks to see if the variable it has still matches the global variable. If not, it knows that a new loop has already been activated so it just ends the existing loop. Thoughts on this? Valid solution? Better options? Caveats? Dangers? UPDATE: I'm using John's suggestion below via the clearTimeout option. However, I can't quite get it to work. The logic is as such: var slideNumber = 0; var timeout = null; function startLoop(slideNumber) { ...do stuff here to set up the slide based on slideNumber... slideFadeIn() } function continueCheck(){ if (timeout != null) { // cancel the scheduled task. clearTimeout(timeout); timeout = null; return false; }else{ return true; } }; function slideFadeIn() { if (continueCheck){ // a new loop hasn't been called yet so proceed... // fade in the LI $currentListItem.fadeIn(fade, function() { if(multipleFeatures){ timeout = setTimeout(slideFadeOut,display); } }); }; function slideFadeOut() { if (continueLoop){ // a new loop hasn't been called yet so proceed... slideNumber=slideNumber+1; if(slideNumber==features.length) { slideNumber = 0; }; timeout = setTimeout(function(){startLoop(slideNumber)},100); }; startLoop(slideNumber); The above kicks of the looping. I then have navigation items that, when clicked, I want the above loop to stop, then restart with a new beginning slide: $(myNav).click(function(){ clearTimeout(timeout); timeout = null; startLoop(thisItem); }) If I comment out 'startLoop...' from the click event, it, indeed, stops the initial loop. However, if I leave that last line in, it doesn't actually stop the initial loop. Why? What happens is that both loops seem to run in parallel for a period. So, when I click my navigation, clearTimeout is called, which clears it.

    Read the article

  • jQuery Cycle Plugin - Content not cycling

    - by fmz
    I am setting up a page with jQuery's Cycle plugin and have four divs set to fade. I have the code in place, the images set, but it doesn't cycle properly. Firefox says there is a problem with the following code: <script type="text/javascript"> $(document).ready(function() { $('.slideshow').cycle({ fx: 'fade' }); }); </script> Here is the html: <div class="slideshow"> <div id="mainImg-1" class="slide"> <div class="quote"> <h2>Building Big Relationships with Small Business.</h2> <p>&ldquo;This is quote Number One.<br /> They are there when I need them the most.&rdquo;</p> <p><span class="author">Jane Doe &ndash; Charlotte Flower Shop</span></p> <div class="help"><a href="cb_services.html">Let Us Help You</a></div> </div> </div> <div id="mainImg-2" class="slide"> <div class="quote"> <h2>Building Big Relationships with Small Business.</h2> <p>&ldquo;This is quote Number Two.<br /> They are there when I need them the most.&rdquo;</p> <p><span class="author">Jane Doe &ndash; Charlotte Flower Shop</span></p> <div class="help"><a href="cb_services.html">Let Us Help You</a></div> </div> </div> <div id="mainImg-3" class="slide"> <div class="quote"> <h2>Building Big Relationships with Small Business.</h2> <p>&ldquo;This is quote Number three.<br /> They are there when I need them the most.&rdquo;</p> <p><span class="author">Jane Doe &ndash; Charlotte Flower Shop</span></p> <div class="help"><a href="cb_services.html">Let Us Help You</a></div> </div> </div> <div id="mainImg-4" class="slide"> <div class="quote"> <h2>Building Big Relationships with Small Business.</h2> <p>&ldquo;This is quote Number Fout.<br /> They are there when I need them the most.&rdquo;</p> <p><span class="author">Jane Doe &ndash; Charlotte Flower Shop</span></p> <div class="help"><a href="cb_services.html">Let Us Help You</a></div> </div> </div> Here is the CSS: .slideshow { width: 946px; height: 283px; border: 1px solid #c29c5d; margin: 8px; overflow: hidden; z-index: 1; } #mainImg-1 { width: 946px; height: 283px; background: url(../_images/main.jpg) no-repeat 9px 9px; } #mainImg-2 { width: 946px; height: 283px; background: url(../_images/main.jpg) no-repeat 9px 9px; } #mainImg-3 { width: 946px; height: 283px; background: url(../_images/main.jpg) no-repeat 9px 9px; } #mainImg-4 { width: 946px; height: 283px; background: url(../_images/main.jpg) no-repeat 9px 9px; } #mainImg-1 .quote, #mainImg-2 .quote, #mainImg-3 .quote, #mainImg-4 .quote { width: 608px; height: 168px; float: right; margin: 80px 11px 0 0; background: url(../_images/bg_quoteBox.png) repeat-x; } Before you go off and say, "hey, those images are all the same". You are right, the images are all the same right now, but the text should be rotating as well and there is a slight difference there. In addition, the fade should still show up. Anyway, you can see the dev page here: http://173.201.163.213/projectpath/first_trust/index.html I would appreciate some help to get this cycling through as it should. Thanks!

    Read the article

  • PHP, MySQL, jQuery, AJAX: json data returns correct response but frontend returns error

    - by Devner
    Hi all, I have a user registration form. I am doing server side validation on the fly via AJAX. The quick summary of my problem is that upon validating 2 fields, I get error for the second field validation. If I comment first field, then the 2nd field does not show any error. It has this weird behavior. More details below: The HTML, JS and Php code are below: HTML FORM: <form id="SignupForm" action=""> <fieldset> <legend>Free Signup</legend> <label for="username">Username</label> <input name="username" type="text" id="username" /><span id="status_username"></span><br /> <label for="email">Email</label> <input name="email" type="text" id="email" /><span id="status_email"></span><br /> <label for="confirm_email">Confirm Email</label> <input name="confirm_email" type="text" id="confirm_email" /><span id="status_confirm_email"></span><br /> </fieldset> <p> <input id="sbt" type="button" value="Submit form" /> </p> </form> JS: <script type="text/javascript"> $(document).ready(function() { $("#email").blur(function() { var email = $("#email").val(); var msgbox2 = $("#status_email"); if(email.length > 3) { $.ajax({ type: 'POST', url: 'check_ajax2.php', data: "email="+ email, dataType: 'json', cache: false, success: function(data) { if(data.success == 'y') { alert('Available'); } else { alert('Not Available'); } } }); } return false; }); $("#confirm_email").blur(function() { var confirm_email = $("#confirm_email").val(); var email = $("#email").val(); var msgbox3 = $("#status_confirm_email"); if(confirm_email.length > 3) { $.ajax({ type: 'POST', url: 'check_ajax2.php', data: 'confirm_email='+ confirm_email + '&email=' + email, dataType: 'json', cache: false, success: function(data) { if(data.success == 'y') { alert('Available'); } else { alert('Not Available'); } } , error: function (data) { alert('Some error'); } }); } return false; }); }); </script> PHP code: <?php //check_ajax2.php if(isset($_POST['email'])) { $email = $_POST['email']; $res = mysql_query("SELECT uid FROM members WHERE email = '$email' "); $i_exists = mysql_num_rows($res); if( 0 == $i_exists ) { $success = 'y'; $msg_email = 'Email available'; } else { $success = 'n'; $msg_email = 'Email is already in use.</font>'; } print json_encode(array('success' => $success, 'msg_email' => $msg_email)); } if(isset($_POST['confirm_email'])) { $confirm_email = $_POST['confirm_email']; $email = ( isset($_POST['email']) && trim($_POST['email']) != '' ? $_POST['email'] : '' ); $res = mysql_query("SELECT uid FROM members WHERE email = '$confirm_email' "); $i_exists = mysql_num_rows($res); if( 0 == $i_exists ) { if( isset($email) && isset($confirm_email) && $email == $confirm_email ) { $success = 'y'; $msg_confirm_email = 'Email available and match'; } else { $success = 'n'; $msg_confirm_email = 'Email and Confirm Email do NOT match.'; } } else { $success = 'n'; $msg_confirm_email = 'Email already exists.'; } print json_encode(array('success' => $success, 'msg_confirm_email' => $msg_confirm_email)); } ?> THE PROBLEM: As long as I am validating the $_POST['email'] as well as $_POST['confirm_email'] in the check_ajax2.php file, the validation for confirm_email field always returns an error. With my limited knowledge of Firebug, however, I did find out that the following were the responses when I entered email and confirm_email in the fields: RESPONSE 1: {"success":"y","msg_email":"Email available"} RESPONSE 2: {"success":"y","msg_email":"Email available"}{"success":"n","msg_confirm_email":"Email and Confirm Email do NOT match."} Although the RESPONSE 2 shows that we are receiving the correct message via msg_confirm_email, in the front end, the alert 'Some error' is popping up (I have enabled the alert for debugging). I have spent 48 hours trying to change every part of the code wherever possible, but with only little success. What is weird about this is that if I comment the validation for $_POST['email'] field completely, then the validation for $_POST['confirm_email'] field is displaying correctly without any errors. If I enable it back, it is validating email field correctly, but when it reaches the point of validating confirm_email field, it is again showing me the error. I have also tried renaming success variable in check_ajax2.php page to other different names for both $_POST['email'] and $_POST['confirm_email'] but no success. I will be adding more fields in the form and validating within the check_ajax2.php page. So I am not planning on using different ajax pages for validating each of those fields (and I don't think it's smart to do it that way). I am not a jquery or AJAX guru, so all help in resolving this issue is highly appreciated. Thank you in advance.

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • jQuery not refreshing tabs content in IE

    - by iddimu
    Hi all! I have a page that is using jQuery tabs. Within one of my tabs I have a div that contains a form (initially hidden) that I want to use to add content to the tab. What I have works perfectly in Chrome, Firefox, and Safari. But, in IE 7 the tab will not refresh. The post works and the data gets added to the database, but it simply will not show the new content after submitting it. I don't think it matters - but, just for information I am using the Codeigniter PHP framework as well. Here is my javascript: <script type="text/javascript"> $(document).ready(function(){ // initialize the addChild form as hidden until user requests it open $('#addChild').hide(); // open the form $('#openDialog').click( function(){ $('#addChild').slideToggle(); return false; }); // close the form $('#closeDialog').click( function(){ $('#addChild').slideToggle(); return false; }); // submit the form $('#frmAddChild').submit( function(){ $('#addChild').slideToggle(); $.ajax({ url: '/children/add', type: 'POST', data: $('#frmAddChild').serialize() //cache: false }); //reload the children tab $('#tabs').tabs('load',3); return false; }); }); </script> And, here is my PHP/HTML: <?php // initialize the elements of the form $frmAddChild = array( 'name' => 'frmAddChild', 'id' => 'frmAddChild', 'method' => 'post' ); $child_name = array( 'name' => 'child_name', 'id' => 'child_name', ); $child_dob = array( 'name' => 'child_dob', 'id' => 'child_dob' ); $btnOpenDialog = array( 'name' => 'openDialog', 'id' => 'openDialog', 'value' => 'true', 'content' => 'Add Child' ); $btnCloseDialog = array( 'name' => 'closeDialog', 'id' => 'closeDialog', 'value' => 'true', 'content' => 'Cancel' ); // button that shows the drop down to add echo form_button($btnOpenDialog); ?> <div id="addChild" title="Add Child"> <?php echo form_open('children/add/',$frmAddChild); ?> <table> <tr> <td> <?php echo form_label('Child\'s Name', 'child_name'); ?>: </td> <td> <?php echo form_input($child_name); ?> </td> </tr> <tr> <td> <?php echo form_label('Date of Birth','child_dob'); ?>: </td> <td> <?php echo form_input($child_dob); ?> </td> </tr> <tr> <td colspan="2" align="right"> <?php echo form_submit('submit', 'Add'); ?> <?php echo form_button($btnCloseDialog); ?> </td> </tr> </table> <?php echo form_close(); ?> </div> Does anyone have any ideas how I can get this working correctly in IE? Also, if anyone has any comments about how I have things structured, please let me know. I'm new to Codeigniter and I am by no means a javascript or jQuery expert. Thanks for your help!

    Read the article

  • Creating PHP Forms with show/hide functionality [migrated]

    - by ronquiq
    I want to create two reports and submit the report data to database by using two functions defined in a class: Here I have two buttons: "Create ES" and "Create RP". Rightnow, my forms are working fine, I can insert data successfully, but the problem was when I click on submit after filling the form data, the content is hiding and displays the fist div content "cs_content" and again I need to onclick to submit again. Could anyone give a solution for this. Requirement : When I click on "Create CS", I should be able to fill the form and submit data successfully with a message within "cs_content" and any form input errors, the errors should display within "cs_content". When I click on "Create RP", I should be able to fill the form and submit data successfully with a message within "rp_content" and any form input errors, the errors should display within "rp_content". home.php <?php require 'classes/class.report.php'; $report = new Report($db); ?> <html> <head> <script src="js/jqueryv1.10.2.js"></script> <script> $ (document).ready(function () { //$("#cs_content").show(); $('#cs').click(function () { $('#cs_content').fadeIn('slow'); $('#rp_content').hide(); }); $('#rp').click(function () { $('#rp_content').fadeIn('slow'); $('#cs_content').hide(); }); }); </script> </head> <body> <div class="container2"> <div style="margin:0px 0px;padding:3px 217px;overflow:hidden;"> <div id="cs" style="float:left;margin:0px 0px;padding:7px;"><input type="button" value="CREATE CS"></div> <div id="rp" style="float:left;margin:0px 0px;padding:7px;"><input type="button" value="CREATE RP"></div><br> </div> <div id="cs_content"> <?php $report->create_cs_report(); ?> </div> <div id="rp_content" style="display:none;"> <?php $report->create_rp_report(); ?> </div> </div> </body> </html> class.report.php <?php class Report { private $db; public function __construct($database){ $this->db = $database; } public function create_cs_report() { if (isset($_POST['create_es_report'])) { $report_name = htmlentities($_POST['report_name']); $from_address = htmlentities($_POST['from_address']); $subject = htmlentities($_POST['subject']); $reply_to = htmlentities($_POST['reply_to']); if (empty($_POST['report_name']) || empty($_POST['from_address']) || empty($_POST['subject']) || empty($_POST['reply_to'])) { $errors[] = '<span class="error">All fields are required.</span>'; } else { if (isset($_POST['report_name']) && empty($_POST['report_name'])) { $errors[] = '<span class="error">Report Name is required</span>'; } else if (!ctype_alnum($_POST['report_name'])) { $errors[] = '<span class="error">Report Name: Whitespace is not allowed, only alphabets and numbers are required</span>'; } if (isset($_POST['from_address']) && empty($_POST['from_address'])) { $errors[] = '<span class="error">From address is required</span>'; } else if (filter_var($_POST['from_address'], FILTER_VALIDATE_EMAIL) === false) { $errors[] = '<span class="error">Please enter a valid From address</span>'; } if (isset($_POST['subject']) && empty($_POST['subject'])) { $errors[] = '<span class="error">Subject is required</span>'; } else if (!ctype_alnum($_POST['subject'])) { $errors[] = '<span class="error">Subject: Whitespace is not allowed, only alphabets and numbers are required</span>'; } if (isset($_POST['reply_to']) && empty($_POST['reply_to'])) { $errors[] = '<span class="error">Reply To is required</span>'; } else if (filter_var($_POST['reply_to'], FILTER_VALIDATE_EMAIL) === false) { $errors[] = '<span class="error">Please enter a valid Reply-To address</span>'; } } if (empty($errors) === true) { $query = $this->db->prepare("INSERT INTO report(report_name, from_address, subject, reply_to) VALUES (?, ?, ?, ?) "); $query->bindValue(1, $report_name); $query->bindValue(2, $from_address); $query->bindValue(3, $subject); $query->bindValue(4, $reply_to); try { $query->execute(); } catch(PDOException $e) { die($e->getMessage()); } header('Location:home.php?success'); exit(); } } if (isset($_GET['success']) && empty($_GET['success'])) { header('Location:home.php'); echo '<span class="error">Report is succesfully created</span>'; } ?> <form action="" method="POST" accept-charset="UTF-8"> <div style="font-weight:bold;padding:17px 80px;text-decoration:underline;">Section A</div> <table class="create_report"> <tr><td><label>Report Name</label><span style="color:#A60000">*</span></td> <td><input type="text" name="report_name" required placeholder="Name of the report" value="<?php if(isset($_POST["report_name"])) echo $report_name; ?>" size="30" maxlength="30"> </td></tr> <tr><td><label>From</label><span style="color:#A60000">*</span></td> <td><input type="text" name="from_address" required placeholder="From address" value="<?php if(isset($_POST["from_address"])) echo $from_address; ?>" size="30"> </td></tr> <tr><td><label>Subject</label><span style="color:#A60000">*</span></td> <td><input type="text" name="subject" required placeholder="Subject" value="<?php if(isset($_POST["subject"])) echo $subject; ?>" size="30"> </td></tr> <tr><td><label>Reply To</label><span style="color:#A60000">*</span></td> <td><input type="text" name="reply_to" required placeholder="Reply address" value="<?php if(isset($_POST["reply_to"])) echo $reply_to; ?>" size="30"> </td></tr> <tr><td><input type="submit" value="create report" style="background:#8AC007;color:#080808;padding:6px;" name="create_es_report"></td></tr> </table> </form> <?php //IF THERE ARE ERRORS, THEY WOULD BE DISPLAY HERE if (empty($errors) === false) { echo '<div>' . implode('</p><p>', $errors) . '</div>'; } } public function create_rp_report() { if (isset($_POST['create_rp_report'])) { $report_name = htmlentities($_POST['report_name']); $to_address = htmlentities($_POST['to_address']); $subject = htmlentities($_POST['subject']); $reply_to = htmlentities($_POST['reply_to']); if (empty($_POST['report_name']) || empty($_POST['to_address']) || empty($_POST['subject']) || empty($_POST['reply_to'])) { $errors[] = '<span class="error">All fields are required.</span>'; } else { if (isset($_POST['report_name']) && empty($_POST['report_name'])) { $errors[] = '<span class="error">Report Name is required</span>'; } else if (!ctype_alnum($_POST['report_name'])) { $errors[] = '<span class="error">Report Name: Whitespace is not allowed, only alphabets and numbers are required</span>'; } if (isset($_POST['to_address']) && empty($_POST['to_address'])) { $errors[] = '<span class="error">to address is required</span>'; } else if (filter_var($_POST['to_address'], FILTER_VALIDATE_EMAIL) === false) { $errors[] = '<span class="error">Please enter a valid to address</span>'; } if (isset($_POST['subject']) && empty($_POST['subject'])) { $errors[] = '<span class="error">Subject is required</span>'; } else if (!ctype_alnum($_POST['subject'])) { $errors[] = '<span class="error">Subject: Whitespace is not allowed, only alphabets and numbers are required</span>'; } if (isset($_POST['reply_to']) && empty($_POST['reply_to'])) { $errors[] = '<span class="error">Reply To is required</span>'; } else if (filter_var($_POST['reply_to'], FILTER_VALIDATE_EMAIL) === false) { $errors[] = '<span class="error">Please enter a valid Reply-To address</span>'; } } if (empty($errors) === true) { $query = $this->db->prepare("INSERT INTO report(report_name, to_address, subject, reply_to) VALUES (?, ?, ?, ?) "); $query->bindValue(1, $report_name); $query->bindValue(2, $to_address); $query->bindValue(3, $subject); $query->bindValue(4, $reply_to); try { $query->execute(); } catch(PDOException $e) { die($e->getMessage()); } header('Location:home.php?success'); exit(); } } if (isset($_GET['success']) && empty($_GET['success'])) { header('Location:home.php'); echo '<span class="error">Report is succesfully created</span>'; } ?> <form action="" method="POST" accept-charset="UTF-8"> <div style="font-weight:bold;padding:17px 80px;text-decoration:underline;">Section A</div> <table class="create_report"> <tr><td><label>Report Name</label><span style="color:#A60000">*</span></td> <td><input type="text" name="report_name" required placeholder="Name of the report" value="<?php if(isset($_POST["report_name"])) echo $report_name; ?>" size="30" maxlength="30"> </td></tr> <tr><td><label>to</label><span style="color:#A60000">*</span></td> <td><input type="text" name="to_address" required placeholder="to address" value="<?php if(isset($_POST["to_address"])) echo $to_address; ?>" size="30"> </td></tr> <tr><td><label>Subject</label><span style="color:#A60000">*</span></td> <td><input type="text" name="subject" required placeholder="Subject" value="<?php if(isset($_POST["subject"])) echo $subject; ?>" size="30"> </td></tr> <tr><td><label>Reply To</label><span style="color:#A60000">*</span></td> <td><input type="text" name="reply_to" required placeholder="Reply address" value="<?php if(isset($_POST["reply_to"])) echo $reply_to; ?>" size="30"> </td></tr> <tr><td><input type="submit" value="create report" style="background:#8AC007;color:#080808;padding:6px;" name="create_rp_report"></td></tr> </table> </form> <?php //IF THERE ARE ERRORS, THEY WOULD BE DISPLAY HERE if (empty($errors) === false) { echo '<div>' . implode('</p><p>', $errors) . '</div>'; } } }//Report CLASS ENDS

    Read the article

  • How to enforce a namespace in wsdl for inner elements

    - by wsxedc
    I am looking at an example WSDL <definitions xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:tns="http://mypackage/" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://schemas.xmlsoap.org/wsdl/" targetNamespace="http://mypackage/" name="HelloService"> <types> <xsd:schema> <xsd:import namespace="http://mypackage/" schemaLocation="http://localhost:8081/HelloWebService/HelloService?xsd=1"> </xsd:import> </xsd:schema> </types> <message name="sayHello"> <part name="parameters" element="tns:sayHello"></part> </message> <message name="sayHelloResponse"> <part name="parameters" element="tns:sayHelloResponse"></part> </message> <portType name="Hello"> <operation name="sayHello"> <input message="tns:sayHello"></input> <output message="tns:sayHelloResponse"></output> </operation> </portType> <binding name="HelloPortBinding" type="tns:Hello"> <soap:binding transport="http://schemas.xmlsoap.org/soap/http" style="document"></soap:binding> <operation name="sayHello"> <soap:operation soapAction=""></soap:operation> <input> <soap:body use="literal"></soap:body> </input> <output> <soap:body use="literal"></soap:body> </output> </operation> </binding> <service name="HelloService"> <port name="HelloPort" binding="tns:HelloPortBinding"> <soap:address location="http://localhost:8081/HelloWebService/HelloService"> </soap:address> </port> </service> and the referenced xsd is <?xml version="1.0" encoding="utf-8"?> <xs:schema xmlns:tns="http://mypackage/" xmlns:xs="http://www.w3.org/2001/XMLSchema" version="1.0" targetNamespace="http://mypackage/"> <xs:element name="sayHello" type="tns:sayHello"></xs:element> <xs:element name="sayHelloResponse" type="tns:sayHelloResponse"> </xs:element> <xs:complexType name="sayHello"> <xs:sequence> <xs:element name="arg0" type="xs:string" minOccurs="0"> </xs:element> </xs:sequence> </xs:complexType> <xs:complexType name="sayHelloResponse"> <xs:sequence> <xs:element name="return" type="xs:string" minOccurs="0"> </xs:element> </xs:sequence> </xs:complexType> </xs:schema> When I use SoapUI to generate a request message, it looks like this <soapenv:Envelope xmlns:soapenv="http://schemas.xmlsoap.org/soap/envelope/" xmlns:myp="http://mypackage/"> <soapenv:Header/> <soapenv:Body> <myp:sayHello> <arg0>?</arg0> </myp:sayHello> </soapenv:Body> </soapenv:Envelope> My question is, why doesn't arg0 need a namespace like ?? I am just using this as an example as the element that are children of soapenv always have a namespace prefix, however, the children of these children do not have any prefix. This is the case with soapUI and message sent by Axis2 generated stubs. My questions are: 1. Why aren't there any namespace for arg0? 2. Is there a way to enforce myp prefix on arg0 from WSDL? If so, how? If not, why can't it be done?

    Read the article

  • Selling Federal Enterprise Architecture (EA)

    - by TedMcLaughlan
    Selling Federal Enterprise Architecture A taxonomy of subject areas, from which to develop a prioritized marketing and communications plan to evangelize EA activities within and among US Federal Government organizations and constituents. Any and all feedback is appreciated, particularly in developing and extending this discussion as a tool for use – more information and details are also available. "Selling" the discipline of Enterprise Architecture (EA) in the Federal Government (particularly in non-DoD agencies) is difficult, notwithstanding the general availability and use of the Federal Enterprise Architecture Framework (FEAF) for some time now, and the relatively mature use of the reference models in the OMB Capital Planning and Investment (CPIC) cycles. EA in the Federal Government also tends to be a very esoteric and hard to decipher conversation – early apologies to those who agree to continue reading this somewhat lengthy article. Alignment to the FEAF and OMB compliance mandates is long underway across the Federal Departments and Agencies (and visible via tools like PortfolioStat and ITDashboard.gov – but there is still a gap between the top-down compliance directives and enablement programs, and the bottom-up awareness and effective use of EA for either IT investment management or actual mission effectiveness. "EA isn't getting deep enough penetration into programs, components, sub-agencies, etc.", verified a panelist at the most recent EA Government Conference in DC. Newer guidance from OMB may be especially difficult to handle, where bottom-up input can't be accurately aligned, analyzed and reported via standardized EA discipline at the Agency level – for example in addressing the new (for FY13) Exhibit 53D "Agency IT Reductions and Reinvestments" and the information required for "Cloud Computing Alternatives Evaluation" (supporting the new Exhibit 53C, "Agency Cloud Computing Portfolio"). Therefore, EA must be "sold" directly to the communities that matter, from a coordinated, proactive messaging perspective that takes BOTH the Program-level value drivers AND the broader Agency mission and IT maturity context into consideration. Selling EA means persuading others to take additional time and possibly assign additional resources, for a mix of direct and indirect benefits – many of which aren't likely to be realized in the short-term. This means there's probably little current, allocated budget to work with; ergo the challenge of trying to sell an "unfunded mandate". Also, the concept of "Enterprise" in large Departments like Homeland Security tends to cross all kinds of organizational boundaries – as Richard Spires recently indicated by commenting that "...organizational boundaries still trump functional similarities. Most people understand what we're trying to do internally, and at a high level they get it. The problem, of course, is when you get down to them and their system and the fact that you're going to be touching them...there's always that fear factor," Spires said. It is quite clear to the Federal IT Investment community that for EA to meet its objective, understandable, relevant value must be measured and reported using a repeatable method – as described by GAO's recent report "Enterprise Architecture Value Needs To Be Measured and Reported". What's not clear is the method or guidance to sell this value. In fact, the current GAO "Framework for Assessing and Improving Enterprise Architecture Management (Version 2.0)", a.k.a. the "EAMMF", does not include words like "sell", "persuade", "market", etc., except in reference ("within Core Element 19: Organization business owner and CXO representatives are actively engaged in architecture development") to a brief section in the CIO Council's 2001 "Practical Guide to Federal Enterprise Architecture", entitled "3.3.1. Develop an EA Marketing Strategy and Communications Plan." Furthermore, Core Element 19 of the EAMMF is advised to be applied in "Stage 3: Developing Initial EA Versions". This kind of EA sales campaign truly should start much earlier in the maturity progress, i.e. in Stages 0 or 1. So, what are the understandable, relevant benefits (or value) to sell, that can find an agreeable, participatory audience, and can pave the way towards success of a longer-term, funded set of EA mechanisms that can be methodically measured and reported? Pragmatic benefits from a useful EA that can help overcome the fear of change? And how should they be sold? Following is a brief taxonomy (it's a taxonomy, to help organize SME support) of benefit-related subjects that might make the most sense, in creating the messages and organizing an initial "engagement plan" for evangelizing EA "from within". An EA "Sales Taxonomy" of sorts. We're not boiling the ocean here; the subjects that are included are ones that currently appear to be urgently relevant to the current Federal IT Investment landscape. Note that successful dialogue in these topics is directly usable as input or guidance for actually developing early-stage, "Fit-for-Purpose" (a DoDAF term) Enterprise Architecture artifacts, as prescribed by common methods found in most EA methodologies, including FEAF, TOGAF, DoDAF and our own Oracle Enterprise Architecture Framework (OEAF). The taxonomy below is organized by (1) Target Community, (2) Benefit or Value, and (3) EA Program Facet - as in: "Let's talk to (1: Community Member) about how and why (3: EA Facet) the EA program can help with (2: Benefit/Value)". Once the initial discussion targets and subjects are approved (that can be measured and reported), a "marketing and communications plan" can be created. A working example follows the Taxonomy. Enterprise Architecture Sales Taxonomy Draft, Summary Version 1. Community 1.1. Budgeted Programs or Portfolios Communities of Purpose (CoPR) 1.1.1. Program/System Owners (Senior Execs) Creating or Executing Acquisition Plans 1.1.2. Program/System Owners Facing Strategic Change 1.1.2.1. Mandated 1.1.2.2. Expected/Anticipated 1.1.3. Program Managers - Creating Employee Performance Plans 1.1.4. CO/COTRs – Creating Contractor Performance Plans, or evaluating Value Engineering Change Proposals (VECP) 1.2. Governance & Communications Communities of Practice (CoP) 1.2.1. Policy Owners 1.2.1.1. OCFO 1.2.1.1.1. Budget/Procurement Office 1.2.1.1.2. Strategic Planning 1.2.1.2. OCIO 1.2.1.2.1. IT Management 1.2.1.2.2. IT Operations 1.2.1.2.3. Information Assurance (Cyber Security) 1.2.1.2.4. IT Innovation 1.2.1.3. Information-Sharing/ Process Collaboration (i.e. policies and procedures regarding Partners, Agreements) 1.2.2. Governing IT Council/SME Peers (i.e. an "Architects Council") 1.2.2.1. Enterprise Architects (assumes others exist; also assumes EA participants aren't buried solely within the CIO shop) 1.2.2.2. Domain, Enclave, Segment Architects – i.e. the right affinity group for a "shared services" EA structure (per the EAMMF), which may be classified as Federated, Segmented, Service-Oriented, or Extended 1.2.2.3. External Oversight/Constraints 1.2.2.3.1. GAO/OIG & Legal 1.2.2.3.2. Industry Standards 1.2.2.3.3. Official public notification, response 1.2.3. Mission Constituents Participant & Analyst Community of Interest (CoI) 1.2.3.1. Mission Operators/Users 1.2.3.2. Public Constituents 1.2.3.3. Industry Advisory Groups, Stakeholders 1.2.3.4. Media 2. Benefit/Value (Note the actual benefits may not be discretely attributable to EA alone; EA is a very collaborative, cross-cutting discipline.) 2.1. Program Costs – EA enables sound decisions regarding... 2.1.1. Cost Avoidance – a TCO theme 2.1.2. Sequencing – alignment of capability delivery 2.1.3. Budget Instability – a Federal reality 2.2. Investment Capital – EA illuminates new investment resources via... 2.2.1. Value Engineering – contractor-driven cost savings on existing budgets, direct or collateral 2.2.2. Reuse – reuse of investments between programs can result in savings, chargeback models; avoiding duplication 2.2.3. License Refactoring – IT license & support models may not reflect actual or intended usage 2.3. Contextual Knowledge – EA enables informed decisions by revealing... 2.3.1. Common Operating Picture (COP) – i.e. cross-program impacts and synergy, relative to context 2.3.2. Expertise & Skill – who truly should be involved in architectural decisions, both business and IT 2.3.3. Influence – the impact of politics and relationships can be examined 2.3.4. Disruptive Technologies – new technologies may reduce costs or mitigate risk in unanticipated ways 2.3.5. What-If Scenarios – can become much more refined, current, verifiable; basis for Target Architectures 2.4. Mission Performance – EA enables beneficial decision results regarding... 2.4.1. IT Performance and Optimization – towards 100% effective, available resource utilization 2.4.2. IT Stability – towards 100%, real-time uptime 2.4.3. Agility – responding to rapid changes in mission 2.4.4. Outcomes –measures of mission success, KPIs – vs. only "Outputs" 2.4.5. Constraints – appropriate response to constraints 2.4.6. Personnel Performance – better line-of-sight through performance plans to mission outcome 2.5. Mission Risk Mitigation – EA mitigates decision risks in terms of... 2.5.1. Compliance – all the right boxes are checked 2.5.2. Dependencies –cross-agency, segment, government 2.5.3. Transparency – risks, impact and resource utilization are illuminated quickly, comprehensively 2.5.4. Threats and Vulnerabilities – current, realistic awareness and profiles 2.5.5. Consequences – realization of risk can be mapped as a series of consequences, from earlier decisions or new decisions required for current issues 2.5.5.1. Unanticipated – illuminating signals of future or non-symmetric risk; helping to "future-proof" 2.5.5.2. Anticipated – discovering the level of impact that matters 3. EA Program Facet (What parts of the EA can and should be communicated, using business or mission terms?) 3.1. Architecture Models – the visual tools to be created and used 3.1.1. Operating Architecture – the Business Operating Model/Architecture elements of the EA truly drive all other elements, plus expose communication channels 3.1.2. Use Of – how can the EA models be used, and how are they populated, from a reasonable, pragmatic yet compliant perspective? What are the core/minimal models required? What's the relationship of these models, with existing system models? 3.1.3. Scope – what level of granularity within the models, and what level of abstraction across the models, is likely to be most effective and useful? 3.2. Traceability – the maturity, status, completeness of the tools 3.2.1. Status – what in fact is the degree of maturity across the integrated EA model and other relevant governance models, and who may already be benefiting from it? 3.2.2. Visibility – how does the EA visibly and effectively prove IT investment performance goals are being reached, with positive mission outcome? 3.3. Governance – what's the interaction, participation method; how are the tools used? 3.3.1. Contributions – how is the EA program informed, accept submissions, collect data? Who are the experts? 3.3.2. Review – how is the EA validated, against what criteria?  Taxonomy Usage Example:   1. To speak with: a. ...a particular set of System Owners Facing Strategic Change, via mandate (like the "Cloud First" mandate); about... b. ...how the EA program's visible and easily accessible Infrastructure Reference Model (i.e. "IRM" or "TRM"), if updated more completely with current system data, can... c. ...help shed light on ways to mitigate risks and avoid future costs associated with NOT leveraging potentially-available shared services across the enterprise... 2. ....the following Marketing & Communications (Sales) Plan can be constructed: a. Create an easy-to-read "Consequence Model" that illustrates how adoption of a cloud capability (like elastic operational storage) can enable rapid and durable compliance with the mandate – using EA traceability. Traceability might be from the IRM to the ARM (that identifies reusable services invoking the elastic storage), and then to the PRM with performance measures (such as % utilization of purchased storage allocation) included in the OMB Exhibits; and b. Schedule a meeting with the Program Owners, timed during their Acquisition Strategy meetings in response to the mandate, to use the "Consequence Model" for advising them to organize a rapid and relevant RFI solicitation for this cloud capability (regarding alternatives for sourcing elastic operational storage); and c. Schedule a series of short "Discovery" meetings with the system architecture leads (as agreed by the Program Owners), to further populate/validate the "As-Is" models and frame the "To Be" models (via scenarios), to better inform the RFI, obtain the best feedback from the vendor community, and provide potential value for and avoid impact to all other programs and systems. --end example -- Note that communications with the intended audience should take a page out of the standard "Search Engine Optimization" (SEO) playbook, using keywords and phrases relating to "value" and "outcome" vs. "compliance" and "output". Searches in email boxes, internal and external search engines for phrases like "cost avoidance strategies", "mission performance metrics" and "innovation funding" should yield messages and content from the EA team. This targeted, informed, practical sales approach should result in additional buy-in and participation, additional EA information contribution and model validation, development of more SMEs and quick "proof points" (with real-life testing) to bolster the case for EA. The proof point here is a successful, timely procurement that satisfies not only the external mandate and external oversight review, but also meets internal EA compliance/conformance goals and therefore is more transparently useful across the community. In short, if sold effectively, the EA will perform and be recognized. EA won’t therefore be used only for compliance, but also (according to a validated, stated purpose) to directly influence decisions and outcomes. The opinions, views and analysis expressed in this document are those of the author and do not necessarily reflect the views of Oracle.

    Read the article

  • clicking a button via javascript does not cause a post

    - by Andreas Niedermair
    hi there! <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.1//EN" "http://www.w3.org/TR/xhtml11/DTD/xhtml11.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" > <head> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.js"></script> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jqueryui/1.8.2/jquery-ui.js"></script> </head> <body> <form id="fooForm"> <script type="text/javascript"> function FooMethod() { alert('hello'); } var fooButton; var fooForm; $(document).ready(function() { InitializeVariables(); InitiliazeDialog(); InitiliazeForm(); }); function InitializeVariables() { fooButton = $('#fooButton'); fooForm = $('#fooForm'); } function InitiliazeDialog() { var dialog = $('<div/>'); dialog.css('display', 'none'); var content = $('<p/>'); var icon = $('<span/>'); icon.addClass('ui-icon ui-icon-alert'); icon.css('float', 'left'); icon.css('margin', '0px 7px 20px 0px'); content.text('do you really want to hurt me?'); icon.prependTo(content); content.appendTo(dialog); var dialogOpenMethod = function () { dialog.dialog('open'); return false; }; var dialogOpenHandlerMethod = function (event, ui) { var widget = dialog.dialog('widget'); widget.appendTo(fooForm); var overlay = widget.prev(); overlay.css('z-index', 999); overlay.appendTo(fooForm); widget.css('position', 'fixed'); widget.css('top', '50%'); widget.css('margin-top', widget.height() / 2 * -1); widget.css('left', '50%'); widget.css('margin-left', widget.width() / 2 * -1); }; var submitMethod = function () { dialog.dialog('option', 'closeOnEscape', false); var widget = dialog.dialog('widget'); var yesButton = $(':button:eq(0)', widget); var noButton = $(':button:eq(1)', widget); var closeButton = $('a.ui-dialog-titlebar-close', widget); noButton.remove(); closeButton.remove(); fooButton.unbind('click', dialogOpenMethod); fooButton.click(); }; dialog.dialog({ autoOpen: false, modal: true, buttons: { 'Ja': submitMethod, 'Nein': function () { dialog.dialog('close'); } }, open: dialogOpenHandlerMethod }); fooButton.bind('click', dialogOpenMethod); } function InitiliazeForm() { fooButton.button(); fooForm.submit(function () { alert('doing a submit'); }); } </script> <input type="submit" id="fooButton" value="submit it!" onclick="FooMethod();"></input> </form> </body> </html> what am i doing? i want a modal-confirmation: user clicks on button, confirmation "do you really want to...?", user clicks "yes", this click unbinds the original click-handler and clicks the button again (which should cause a submit). what/why is not working? indeed you need a special case. this demo won't work, unless you set modal: false. interesting to mention: the original handler (onclick="FooMethod();") is called in modal and non-modal dialog. can anybody help me out? thanks in advance! i also opened a ticket on jqueryUI for this

    Read the article

  • How to upgrade your Solaris 11 with the latest available SRUs ?

    - by jim
    1 ) Follow the instructions (*) in the document "Updating the Software on Your Oracle Solaris 11 System" * see and apply "How to Configure the Oracle Solaris support Repository" then run: # pkg update --accept Reboot if necessary (see "why" in STEP 3) Note: it is possible that your "pkg" package is not up to date # pkg update WARNING: pkg(5) appears to be out of date, and should be updated before running update.  Please update pkg(5) using 'pfexec pkg install pkg:/package/pkg' and then retry the update. -> So just upgrade it: # pkg install pkg:/package/pkg Reboot if necessary (see "why" in STEP 3) By the way, note that I am using the DEV tree: # pkg publisher -PPUBLISHER                             TYPE     STATUS   URIsolaris                               origin   online   https://pkg.oracle.com/solaris/dev/ 2 ) Now our system is ready to jump to the latest SRUs so check what is available: # pkg list -af entire NAME (PUBLISHER)                     VERSION                    IFO entire                                            0.5-DOT-11-0.175.1.0.0.24-DOT-2    ---   --> Latest version available in the repository ! entire                                            0.5.11-0.175.1.0.0.24.0    --- entire                                            0.5.11-0.175.1.0.0.23.0    --- entire                                            0.5.11-0.175.1.0.0.22.1    --- entire                                            0.5.11-0.175.1.0.0.21.0    --- entire                                            0.5.11-0.175.1.0.0.20.0    --- entire                                            0.5.11-0.175.1.0.0.19.0    --- entire                                            0.5.11-0.175.1.0.0.18.0    --- entire                                            0.5.11-0.175.1.0.0.17.0    --- entire                                            0.5.11-0.175.1.0.0.16.0    --- entire                                            0.5.11-0.175.1.0.0.15.1    --- entire                                            0.5.11-0.175.1.0.0.14.0    --- entire                                            0.5.11-0.175.1.0.0.13.0    --- entire                                            0.5.11-0.175.1.0.0.12.0    --- entire                                            0.5.11-0.175.1.0.0.11.0    --- entire                                            0.5.11-0.175.1.0.0.10.0    --- entire                                            0.5.11-0.175.0.11.0.4.1    i--   --> this is at what level your OS is ! 3 ) Apply the latest SRU: (don´t forget the --accept parameter) # pkg update --accept entire-AT-0.5.11-0.175.1.0.0.24.2------------------------------------------------------------Package: pkg://solaris/consolidation/osnet/osnet-incorporation-AT-0.5.11,5.11-0.175.1.0.0.24.2:20120919T184141ZLicense: usr/src/pkg/license_files/lic_OTNOracle Technology Network Developer License AgreementOracle Solaris, Oracle Solaris Cluster and Oracle Solaris ExpressEXPORT CONTROLSSelecting the "Accept License Agreement" button is a confirmationof your agreement that you comply, now and during the trial term(if applicable), with each of the following statements:-You are not a citizen, national, or resident of, and are not undercontrol of, the government of Cuba, Iran, Sudan, North Korea, Syria,or any country to which the United States has prohibited export. <....> Packages to remove:  10 Packages to install:  38 Packages to update: 443 Mediators to change:   2 Create boot environment: Yes   --> a reboot is required and a new BE will be created for you !! Create backup boot environment:  No DOWNLOAD                               PKGS       FILES    XFER (MB)Completed                                491/491 23113/23113  504.2/504.2PHASE                                        ACTIONSRemoval Phase                           10359/10359 Install Phase                               15530/15530 Update Phase                              15543/15543 PHASE                                          ITEMSPackage State Update Phase         932/932 Package Cache Update Phase       452/452 Image State Update Phase                    2/2 A clone of solaris-1 exists and has been updated and activated.On the next boot the Boot Environment solaris-2 will bemounted on '/'.  Reboot when ready to switch to this updated BE. 4 ) Reboot your system # reboot  5 ) Resources Solaris 11 Express and Solaris 11 Support Repositories Explained [ID 1021281.1] Oracle Solaris 11 Release Notes Updating the Software on Your Oracle Solaris 11 System

    Read the article

  • xs:choice unbounded list

    - by Matt
    I want to define an XSD schema for an XML document, example below: <?xml version="1.0" encoding="utf-8"?> <view xmlns="http://localhost/model_data" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://localhost/model_data XMLSchemaView.xsd" path="wibble" id="wibble"> <text name="PageTitle">Homepage</text> <text name="Keywords">home foo bar</text> <image name="MainImage"> <description>lolem ipsum</description> <title>i haz it</title> <url>/images/main-image.jpg</url> <type>image/jpeg</type> <alt>alt text for image</alt> <width>400</width> <height>300</height> </image> <link name="TermsAndConditionsLink"> <url>/tnc.html</url> <title>Terms and Conditions</title> <target>_blank</target> </link> </view> There's a view root element and then an unknown number of field elements (of various types). I'm using the following XSD schema: <?xml version="1.0" encoding="utf-8"?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns="http://localhost/model_data" targetNamespace="http://localhost/model_data" id="XMLSchema1"> <xs:element name="text" type="text_field"/> <xs:element name="view" type="model_data"/> <xs:complexType name="model_data"> <xs:choice maxOccurs="unbounded"> <xs:element name="text" type="text_field"/> <xs:element name="image" type="image_field"/> <xs:element name="link" type="link_field"/> </xs:choice> <xs:attribute name="path" type="xs:string"/> <xs:attribute name="id" type="xs:string"/> </xs:complexType> <xs:complexType name="image_field"> <xs:all> <xs:element name="description" type="xs:string"/> <xs:element name="title" type="xs:string"/> <xs:element name="type" type="xs:string"/> <xs:element name="url" type="xs:string"/> <xs:element name="alt" type="xs:string"/> <xs:element name="height" type="xs:int"/> <xs:element name="width" type="xs:int"/> </xs:all> <xs:attribute name="name" type="xs:string"/> </xs:complexType> <xs:complexType name="text_field"> <xs:simpleContent> <xs:extension base="xs:string"> <xs:attribute name="name" type="xs:string"/> </xs:extension> </xs:simpleContent> </xs:complexType> <xs:complexType name="link_field"> <xs:all> <xs:element name="target" type="xs:string"/> <xs:element name="title" type="xs:string"/> <xs:element name="url" type="xs:string"/> </xs:all> <xs:attribute name="name" type="xs:string"/> </xs:complexType> </xs:schema> This looks like it should work to me, but it doesn't and I always get the following error: Element <text> is not allowed under element <view>. Reason: The following elements are expected at this location (see below) <text> <image> <link> Error location: view / text Details cvc-model-group: Element <text> unexpected by type 'model_data' of element <view>. cvc-elt.5.2.1: The element <view> is not valid with respect to the actual type definition 'model_data'. I've never really used XSD schemas before, so I'd really appreciate it if someone could point out where I'm going wrong.

    Read the article

  • 'Step Into' is suddenly not working in Visual Studio

    - by Nick LaMarca
    All of a sudden, I have run into an issue where I cannot step into any code through debugging in Visual Studio. The step over works fine, but it refuses to step into (F11) any of my code. This was working before, now all of a sudden it does not. I've tried some things below, but I still had no success: Delete all bin files in every project in my solution, clean solution, re-build solution. Build projects in solution indivdualy Restart machine It an ASP.NET C# application consuming a WCF sevice locally. It is in debug mode. I have a breakpoint set on the page consuming the service. The breakpoint hits, but it will not step into the service code. The ASP.NET site and the service code is all in the same solution. This all of a sudden does not work, it did work before. How can I fix this problem? Adding a breakpoint to the service project I get a warning: Breakpoint will not currently be hit. No symbols have been loaded for this document. I deleted all the bin folders for all the projects and re-built them one by one. They all succeeded, but still I am getting the symbols won't load on any breakpoint I put into any project in the solution other than the ASP.NET project where the breakpoint works. I was able to debug step into all the projects before, this is an all of a sudden thing. Information from the output window.. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\SMDiagnostics\v4.0_4.0.0.0__b77a5c561934e089\SMDiagnostics.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.Runtime.DurableInstancing\v4.0_4.0.0.0__31bf3856ad364e35\System.Runtime.DurableInstancing.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.Xaml.Hosting\v4.0_4.0.0.0__31bf3856ad364e35\System.Xaml.Hosting.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.NET\Framework\v4.0.30319\Temporary ASP.NET Files\root\2d49cf50\14eee2cf\App_Web_jmow15fw.dll', Symbols loaded. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.Runtime.Serialization\v4.0_4.0.0.0__b77a5c561934e089\System.Runtime.Serialization.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.WorkflowServices\v4.0_4.0.0.0__31bf3856ad364e35\System.WorkflowServices.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.ServiceModel.Web\v4.0_4.0.0.0__31bf3856ad364e35\System.ServiceModel.Web.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.ServiceModel.Discovery\v4.0_4.0.0.0__31bf3856ad364e35\System.ServiceModel.Discovery.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.ServiceModel.Activities\v4.0_4.0.0.0__31bf3856ad364e35\System.ServiceModel.Activities.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.ServiceModel.Routing\v4.0_4.0.0.0__31bf3856ad364e35\System.ServiceModel.Routing.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.ServiceModel.Channels\v4.0_4.0.0.0__31bf3856ad364e35\System.ServiceModel.Channels.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled. 'WebDev.WebServer40.EXE' (Managed (v4.0.30319)): Loaded 'C:\windows\Microsoft.Net\assembly\GAC_MSIL\System.IdentityModel\v4.0_4.0.0.0__b77a5c561934e089\System.IdentityModel.dll', Skipped loading symbols. Module is optimized and the debugger option 'Just My Code' is enabled.

    Read the article

  • A elusive multi level accordion

    - by juanpablo
    Hi, I try make a multi level accordion with jquery: <div class="acordion"> <a href="#"><h1>aaa</h1></a> <div class="acoTitulo"> <h1>aaa</h1> <div class="acoSubTitulo"> <a href="#"><h2>bbb</h2></a> <div class="acoSubSubTitulo"> <h2>bbb</h2> <div class="acoLink"> <a href="#">ccc</a><br> <a href="#">ccc</a> </div> </div> </div> <!-- acoSubTitulo --> </div> <!-- end acoTitulo --> <div class="acoTitulo"> <h1>aaa</h1> <div class="acoSubTitulo"> <a href="#"><h2>bbb</h2></a> <div class="acoSubSubTitulo"> <h2>bbb</h2> <div class="acoLink"> <a href="#">ccc</a><br> <a href="#">ccc</a> </div> </div> </div> <!-- acoSubTitulo --> </div> <!-- end acoTitulo --> <div class="acoTitulo"> <h1>aaa</h1> <div class="acoSubTitulo"> <a href="#"><h2>bbb</h2></a> <a href="#"><h2>bbb</h2></a> </div> <!-- acoSubTitulo --> </div> <!-- end acoTitulo --> <a href="#"><h1>aaa</h1></a> <a href="#"><h1>aaa</h1></a> <div class="acoTitulo"> <h1>aaa</h1> <div class="acoSubTitulo"> <a href="#"><h2>bbb</h2></a> <a href="#"><h2>bbb</h2></a> </div> <!-- acoSubTitulo --> </div> <!-- end acoTitulo --> <div class="acoTitulo"> <h1>aaa</h1> <div class="acoSubTitulo"> <a href="#"><h2>bbb</h2></a> <a href="#"><h2>bbb</h2></a> </div> <!-- acoSubTitulo --> </div> <!-- end acoTitulo --> </div> <!-- end acordion --> .acordion h1, .acordion h2, .acoLink { font-size: 11px; padding: 8px; } .acoTitulo h2 { margin: 0px; } .acordion * a, .acordion a { text-decoration:none; color: #fff; } .acordion { width: 160px; color: #fff; background-color: #06f; border: 1px solid #06f; } .acoSubTitulo { background-color: #09f; } $(document).ready(function(){ $(".acoSubTitulo").hide(); $(".acoLink").hide(); $(".acoTitulo").hover( function(){ $(this).find(".acoSubTitulo").slideToggle("slow"); },function(){ $(this).find(".acoSubTitulo").slideToggle("slow"); } ); $(".acoSubSubTitulo").hover( function(){ $(this).find(".acoLink").slideToggle(); },function(){ $(this).find(".acoLink").slideToggle(); } ); }); but, this accordion is very elusive with the mouse. any idea? many thanks.

    Read the article

  • jQuery programming style?

    - by Sam Dufel
    I was recently asked to fix something on a site which I haven't worked on before. I haven't really worked with jQuery that much, but I figured I'd take a look and see if I could fix it. I've managed to mostly clear up the problem, but I'm still horrified at the way they chose to build this site. On document load, they replace the click() method of every anchor tag and form element with the same massive function. When clicked, that function then checks if the tag has one of a few different attributes (non-standard attributes, even), and does a variety of different tasks depending on what attributes exist and what their values are. Some hyperlinks have an attribute on them called 'ajaxrel', which makes the click() function look for another (hidden) hyperlink with an ID specified by the ajaxrel attribute, and then calls the click() function for that other hyperlink (which was also modified by this same click() function). On the server side, all the php files are quite long and have absolutely no indentation. This whole site has been a nightmare to debug. Is this standard jQuery practice? This navigation scheme seems terrible. Does anyone else actually use jQuery this way? I'd like to start incorporating it into my projects, but looking at this site is giving me a serious headache. Here's the click() function for hyperlinks: function ajaxBoxA(theElement, urltosend, ajaxbox, dialogbox) { if ($(theElement).attr("href") != undefined) var urltosend = $(theElement).attr("href"); if ($(theElement).attr('toajaxbox') != undefined) var ajaxbox = $(theElement).attr('toajaxbox'); // check to see if dialog box is called for. if ($(theElement).attr('dialogbox') != undefined) var dialogbox = $(theElement).attr('dialogbox'); var dodialog = 0; if (dialogbox != undefined) { // if dialogbox doesn't exist, then flag to create dialog box. var isDiaOpen = $('[ajaxbox="' + ajaxbox + '"]').parent().parent().is(".ui-dialog-container"); dodialog = 1; if (isDiaOpen) { dodialog = 0; } dialogbox = parseUri(dialogbox); dialogoptions = { close: function () { // $("[id^=hierarchy]",this).NestedSortableDestroy(); $(this).dialog('destroy').remove() } }; for ( var keyVar in dialogbox['queryKey'] ) eval( "dialogoptions." + keyVar + " = dialogbox['queryKey'][keyVar]"); }; $("body").append("<div id='TB_load'><img src='"+imgLoader.src+"' /></div>"); $('#TB_load').show(); if (urltosend.search(/\?/) > 0) { urltosend = urltosend + "&-ajax=1"; } else { urltosend = urltosend + "?-ajax=1"; } if ($('[ajaxbox="' + ajaxbox + '"]').length) { $('[ajaxbox="' + ajaxbox + '"]').each( function () { $(this).empty(); }); }; $.ajax({ type: "GET", url: urltosend, data: "", async: false, dataType: "html", success: function (html) { var re = /^<toajaxbox>(.*?)<\/toajaxbox>+(.*)/; if (re.test(html)) { var match = re.exec(html); ajaxbox = match[1]; html = Right(html, String(html).length - String(match[1]).length); } var re = /^<header>(.*?)<\/header>+(.*)/; if (re.test(html)) { var match = re.exec(html); window.location = match[1]; return false; } if (html.length > 0) { var newHtml = $(html); if ($('[ajaxbox="' + ajaxbox + '"]').length) { $('[ajaxbox="' + ajaxbox + '"]').each( function () { $(this).replaceWith(newHtml).ready( function () { ajaxBoxInit(newHtml) if (window.ajaxboxsuccess) ajaxboxsuccess(newHtml); }); }); if ($('[ajaxdialog="' + ajaxbox + '"]').length = 0) { if (dodialog) $(newHtml).wrap("<div class='flora ui-dialog-content' ajaxdialog='" + ajaxbox + "' style='overflow:auto;'></div>").parent().dialog(dialogoptions); } } else { $("body").append(newHtml).ready( function () { ajaxBoxInit(newHtml); if (window.ajaxboxsuccess) ajaxboxsuccess(newHtml); }); if (dodialog) $(newHtml).wrap("<div class='flora ui-dialog-content' ajaxdialog='" + ajaxbox + "' style='overflow:auto;'></div>").parent().dialog(dialogoptions); } } var rel = $(theElement).attr('ajaxtriggerrel'); if (rel != undefined) $('a[ajaxrel="' + rel + '"]').click(); tb_remove(); return false; }, complete: function () { $("#TB_load").remove(); } }); return false; }

    Read the article

  • Google and Bing Map APIs Compared

    - by SGWellens
    At one of the local golf courses I frequent, there is an open grass field next to the course. It is about eight acres in size and mowed regularly. It is permissible to hit golf balls there—you bring and shag our own balls. My golf colleagues and I spend hours there practicing, chatting and in general just wasting time. One of the guys brings Ginger, the amazing, incredible, wonder dog. Ginger is a Portuguese Pointer. She chases squirrels, begs for snacks and supervises us closely to make sure we don't misbehave.     Anyway, I decided to make a dedicated web page to measure distances on the field in yards using online mapping services. I started with Google maps and then did the same application with Bing maps. It is a good way to become familiar with the APIs. Here are images of the final two maps: Google:  Bing:   To start with online mapping services, you need to visit the respective websites and get a developers key. I pared the code down to the minimum to make it easier to compare the APIs. Google maps required this CSS (or it wouldn't work): <style type="text/css">     html     {         height: 100%;     }       body     {         height: 100%;         margin: 0;         padding: 0;     } Here is how the map scripts are included. Google requires the developer Key when loading the JavaScript, Bing requires it when the map object is created: Google: <script type="text/javascript" src="https://maps.googleapis.com/maps/api/js?key=XXXXXXX&libraries=geometry&sensor=false" > </script> Bing: <script  type="text/javascript" src="http://ecn.dev.virtualearth.net/mapcontrol/mapcontrol.ashx?v=7.0"> </script> Note: I use jQuery to manipulate the DOM elements which may be overkill, but I may add more stuff to this application and I didn't want to have to add it later. Plus, I really like jQuery. Here is how the maps are created: Common Code (the same for both Google and Bing Maps):     <script type="text/javascript">         var gTheMap;         var gMarker1;         var gMarker2;           $(document).ready(DocLoaded);           function DocLoaded()         {             // golf course coordinates             var StartLat = 44.924254;             var StartLng = -93.366859;               // what element to display the map in             var mapdiv = $("#map_div")[0];   Google:         // where on earth the map should display         var StartPoint = new google.maps.LatLng(StartLat, StartLng);           // create the map         gTheMap = new google.maps.Map(mapdiv,             {                 center: StartPoint,                 zoom: 18,                 mapTypeId: google.maps.MapTypeId.SATELLITE             });           // place two markers         marker1 = PlaceMarker(new google.maps.LatLng(StartLat, StartLng + .0001));         marker2 = PlaceMarker(new google.maps.LatLng(StartLat, StartLng - .0001));           DragEnd(null);     } Bing:         // where on earth the map should display         var StartPoint = new  Microsoft.Maps.Location(StartLat, StartLng);           // create the map         gTheMap = new Microsoft.Maps.Map(mapdiv,             {                 credentials: 'Asbsa_hzfHl69XF3wxBd_WbW0dLNTRUH3ZHQG9qcV5EFRLuWEaOP1hjWdZ0A0P17',                 center: StartPoint,                 zoom: 18,                 mapTypeId: Microsoft.Maps.MapTypeId.aerial             });             // place two markers         marker1 = PlaceMarker(new Microsoft.Maps.Location(StartLat, StartLng + .0001));         marker2 = PlaceMarker(new Microsoft.Maps.Location(StartLat, StartLng - .0001));           DragEnd(null);     } Note: In the Bing documentation, mapTypeId: was missing from the list of options even though the sample code included it. Note: When creating the Bing map, use the developer Key for the credentials property. I immediately place two markers/pins on the map which is simpler that creating them on the fly with mouse clicks (as I first tried). The markers/pins are draggable and I capture the DragEnd event to calculate and display the distance in yards and draw a line when the user finishes dragging. Here is the code to place a marker: Google: // ---- PlaceMarker ------------------------------------   function PlaceMarker(location) {     var marker = new google.maps.Marker(         {             position: location,             map: gTheMap,             draggable: true         });     marker.addListener('dragend', DragEnd);     return marker; }   Bing: // ---- PlaceMarker ------------------------------------   function PlaceMarker(location) {     var marker = new Microsoft.Maps.Pushpin(location,     {         draggable : true     });     Microsoft.Maps.Events.addHandler(marker, 'dragend', DragEnd);     gTheMap.entities.push(marker);     return marker; } Here is the code than runs when the user stops dragging a marker: Google: // ---- DragEnd -------------------------------------------   var gLine = null;   function DragEnd(Event) {     var meters = google.maps.geometry.spherical.computeDistanceBetween(marker1.position, marker2.position);     var yards = meters * 1.0936133;     $("#message").text(yards.toFixed(1) + ' yards');    // draw a line connecting the points     var Endpoints = [marker1.position, marker2.position];       if (gLine == null)     {         gLine = new google.maps.Polyline({             path: Endpoints,             strokeColor: "#FFFF00",             strokeOpacity: 1.0,             strokeWeight: 2,             map: gTheMap         });     }     else        gLine.setPath(Endpoints); } Bing: // ---- DragEnd -------------------------------------------   var gLine = null;   function DragEnd(Args) {    var Distance =  CalculateDistance(marker1._location, marker2._location);      $("#message").text(Distance.toFixed(1) + ' yards');       // draw a line connecting the points    var Endpoints = [marker1._location, marker2._location];           if (gLine == null)    {        gLine = new Microsoft.Maps.Polyline(Endpoints,            {                strokeColor: new Microsoft.Maps.Color(0xFF, 0xFF, 0xFF, 0),  // aRGB                strokeThickness : 2            });          gTheMap.entities.push(gLine);    }    else        gLine.setLocations(Endpoints);  }   Note: I couldn't find a function to calculate the distance between points in the Bing API, so I wrote my own (CalculateDistance). If you want to see the source for it, you can pick it off the web page. Note: I was able to verify the accuracy of the measurements by using the golf hole next to the field. I put a pin/marker on the center of the green, and then by zooming in, I was able to see the 150 markers on the fairway and put the other pin/marker on one of them. Final Notes: All in all, the APIs are very similar. Both made it easy to accomplish a lot with a minimum amount of code. In one aerial view, there are leaves on the tree, in the other, the trees are bare. I don't know which service has the newer data. Here are links to working pages: Bing Map Demo Google Map Demo I hope someone finds this useful. Steve Wellens   CodeProject

    Read the article

  • Fullscreen image with jquery on window resize?

    - by lauthiamkok
    I am trying to make fullscreen images with jquery when the window resize function is triggered. But I get this kind of result - where you can see a gap at the bottom of the image which I don't know how to fix it. the basic html, <!-- container --> <div id="container" class="container"> <div class="holder-supersize" id="supersize"> <ul class="background-supersize"> <li><a href="#"><img src="styles/images/IMG_0250.jpg" alt="" width="1000" height="667" /></a></li> <li><a href="#"><img src="styles/images/IMG_0255.jpg" alt="" width="667" height="1000" /></a></li> <li class="active"><a href="#"><img src="styles/images/IMG_0323.jpg" alt="" width="1158" height="772" /></a></li> </ul> </div> </div> <!-- container --> jquery for updating image size on window resize, $(document).ready(function(){ $(window).resize(function(){ $(".holder-supersize").each(function() { //Define image ratio & minimum dimensions var minwidth = .5*(640); var minheight = .5*(480); var ratio = 480/640; //Gather browser and current image size var imagewidth = $(this).width(); var imageheight = $(this).height(); var browserwidth = $(window).width(); var browserheight = $(window).height(); //Check for minimum dimensions if ((browserheight < minheight) && (browserwidth < minwidth)){ $(this).height(minheight); $(this).width(minwidth); } else { //When browser is taller if (browserheight > browserwidth){ imageheight = browserheight; $(this).height(browserheight); imagewidth = browserheight/ratio; $(this).width(imagewidth); if (browserwidth > imagewidth){ imagewidth = browserwidth; $(this).width(browserwidth); imageheight = browserwidth * ratio; $(this).height(imageheight); } } //When browser is wider if (browserwidth >= browserheight){ imagewidth = browserwidth; $(this).width(browserwidth); imageheight = browserwidth * ratio; $(this).height(imageheight); if (browserheight > imageheight){ imageheight = browserheight; $(this).height(browserheight); imagewidth = browserheight/ratio; $(this).width(imagewidth); } } } return false; }); }); }); CSS for supersize image /* Supersize -------------------------------------------*/ .holder-supersize { width:100%; height:100%; position:absolute; left:0; top:0; z-index:0; } .background-supersize { width:100%; height:100%; overflow:hidden; position:relative; } .background-supersize li { width:100%; height:100%; overflow:hidden; position:absolute; left:0; top:0; text-align:center; } .background-supersize li img { /* for image with height < width */ /**/ width:100%; height:auto; /* for image with height > width */ /* width:auto; height:100%; */ } .background-supersize li , .background-supersize a, .background-supersize img{ display:none; } .background-supersize .active, .background-supersize .active a, .background-supersize .active img{ display:inline; } This is the link at jsfiddle and this is the link to see the actual product. Any ideas what I have done wrong and how can I fix it?

    Read the article

  • Problem in generation of custom classes at web service client

    - by user443324
    I have a web service which receives an custom object and returns another custom object. It can be deployed successfully on GlassFish or JBoss. @WebMethod(operationName = "providerRQ") @WebResult(name = "BookingInfoResponse" , targetNamespace = "http://tlonewayresprovidrs.jaxbutil.rakes.nhst.com/") public com.nhst.rakes.jaxbutil.tlonewayresprovidrs.BookingInfoResponse providerRQ(@WebParam(name = "BookingInfoRequest" , targetNamespace = "http://tlonewayresprovidrq.jaxbutil.rakes.nhst.com/") com.nhst.rakes.jaxbutil.tlonewayresprovidrq.BookingInfoRequest BookingInfoRequest) { com.nhst.rakes.jaxbutil.tlonewayresprovidrs.BookingInfoResponse BookingInfoResponse = new com.nhst.rakes.jaxbutil.tlonewayresprovidrs.BookingInfoResponse(); return BookingInfoResponse; } But when I create a client for this web service, two instances of BookingInfoRequest and BookingInfoResponse generated even I need only one instance. This time an error is returned that says multiple classes with same name are can not be possible....... Here is wsdl..... <?xml version='1.0' encoding='UTF-8'?><!-- Published by JAX-WS RI at http://jax-ws.dev.java.net. RI's version is JAX-WS RI 2.2.1-hudson-28-. --><!-- Generated by JAX-WS RI at http://jax-ws.dev.java.net. RI's version is JAX-WS RI 2.2.1-hudson-28-. --><definitions xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd" xmlns:wsp="http://www.w3.org/ns/ws-policy" xmlns:wsp1_2="http://schemas.xmlsoap.org/ws/2004/09/policy" xmlns:wsam="http://www.w3.org/2007/05/addressing/metadata" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:tns="http://demo/" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://schemas.xmlsoap.org/wsdl/" targetNamespace="http://demo/" name="DemoJAXBParamService"> <wsp:Policy wsu:Id="DemoJAXBParamPortBindingPolicy"> <ns1:OptimizedMimeSerialization xmlns:ns1="http://schemas.xmlsoap.org/ws/2004/09/policy/optimizedmimeserialization" /> </wsp:Policy> <types> <xsd:schema> <xsd:import namespace="http://tlonewayresprovidrs.jaxbutil.rakes.nhst.com/" schemaLocation="http://localhost:31133/DemoJAXBParamService/DemoJAXBParamService?xsd=1" /> </xsd:schema> <xsd:schema> <xsd:import namespace="http://tlonewayresprovidrs.jaxbutil.rakes.nhst.com" schemaLocation="http://localhost:31133/DemoJAXBParamService/DemoJAXBParamService?xsd=2" /> </xsd:schema> <xsd:schema> <xsd:import namespace="http://tlonewayresprovidrq.jaxbutil.rakes.nhst.com/" schemaLocation="http://localhost:31133/DemoJAXBParamService/DemoJAXBParamService?xsd=3" /> </xsd:schema> <xsd:schema> <xsd:import namespace="http://tlonewayresprovidrq.jaxbutil.rakes.nhst.com" schemaLocation="http://localhost:31133/DemoJAXBParamService/DemoJAXBParamService?xsd=4" /> </xsd:schema> <xsd:schema> <xsd:import namespace="http://demo/" schemaLocation="http://localhost:31133/DemoJAXBParamService/DemoJAXBParamService?xsd=5" /> </xsd:schema> </types> <message name="providerRQ"> <part name="parameters" element="tns:providerRQ" /> </message> <message name="providerRQResponse"> <part name="parameters" element="tns:providerRQResponse" /> </message> <portType name="DemoJAXBParam"> <operation name="providerRQ"> <input wsam:Action="http://demo/DemoJAXBParam/providerRQRequest" message="tns:providerRQ" /> <output wsam:Action="http://demo/DemoJAXBParam/providerRQResponse" message="tns:providerRQResponse" /> </operation> </portType> <binding name="DemoJAXBParamPortBinding" type="tns:DemoJAXBParam"> <wsp:PolicyReference URI="#DemoJAXBParamPortBindingPolicy" /> <soap:binding transport="http://schemas.xmlsoap.org/soap/http" style="document" /> <operation name="providerRQ"> <soap:operation soapAction="" /> <input> <soap:body use="literal" /> </input> <output> <soap:body use="literal" /> </output> </operation> </binding> <service name="DemoJAXBParamService"> <port name="DemoJAXBParamPort" binding="tns:DemoJAXBParamPortBinding"> <soap:address location="http://localhost:31133/DemoJAXBParamService/DemoJAXBParamService" /> </port> </service> </definitions> So, I want to know that how to generate only one instance(I don't know why two instances are generated at client side?). Please help me to move in right direction.

    Read the article

  • Linux C: "Interactive session" with separate read and write named pipes?

    - by ~sd-imi
    Hi all, I am trying to work with "Introduction to Interprocess Communication Using Named Pipes - Full-Duplex Communication Using Named Pipes", http://developers.sun.com/solaris/articles/named_pipes.html#5 ; in particular fd_server.c (included below for reference) Here is my info and compile line: :~$ cat /etc/issue Ubuntu 10.04 LTS \n \l :~$ gcc --version gcc (Ubuntu 4.4.3-4ubuntu5) 4.4.3 :~$ gcc fd_server.c -o fd_server fd_server.c creates two named pipes, one for reading and one for writing. What one can do, is: in one terminal, run the server and read (through cat) its write pipe: :~$ ./fd_server & 2/dev/null [1] 11354 :~$ cat /tmp/np2 and in another, write (using echo) to server's read pipe: :~$ echo "heeellloooo" /tmp/np1 going back to first terminal, one can see: :~$ cat /tmp/np2 HEEELLLOOOO 0[1]+ Exit 13 ./fd_server 2 /dev/null What I would like to do, is make sort of a "interactive" (or "shell"-like) session; that is, the server is run as usual, but instead of running "cat" and "echo", I'd like to use something akin to screen. What I mean by that, is that screen can be called like screen /dev/ttyS0 38400, and then it makes a sort of a interactive session, where what is typed in terminal is passed to /dev/ttyS0, and its response is written to terminal. Now, of course, I cannot use screen, because in my case the program has two separate nodes, and as far as I can tell, screen can refer to only one. How would one go about to achieve this sort of "interactive" session in this context (with two separate read/write pipes)? Thanks, Cheers! Code below: #include <stdio.h> #include <errno.h> #include <ctype.h> #include <sys/types.h> #include <sys/stat.h> #include <fcntl.h> //#include <fullduplex.h> /* For name of the named-pipe */ #define NP1 "/tmp/np1" #define NP2 "/tmp/np2" #define MAX_BUF_SIZE 255 #include <stdlib.h> //exit #include <string.h> //strlen int main(int argc, char *argv[]) { int rdfd, wrfd, ret_val, count, numread; char buf[MAX_BUF_SIZE]; /* Create the first named - pipe */ ret_val = mkfifo(NP1, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } ret_val = mkfifo(NP2, 0666); if ((ret_val == -1) && (errno != EEXIST)) { perror("Error creating the named pipe"); exit (1); } /* Open the first named pipe for reading */ rdfd = open(NP1, O_RDONLY); /* Open the second named pipe for writing */ wrfd = open(NP2, O_WRONLY); /* Read from the first pipe */ numread = read(rdfd, buf, MAX_BUF_SIZE); buf[numread] = '0'; fprintf(stderr, "Full Duplex Server : Read From the pipe : %sn", buf); /* Convert to the string to upper case */ count = 0; while (count < numread) { buf[count] = toupper(buf[count]); count++; } /* * Write the converted string back to the second * pipe */ write(wrfd, buf, strlen(buf)); } Edit: Right, just to clarify - it seems I found a document discussing something very similar, it is http://en.wikibooks.org/wiki/Serial_Programming/Serial_Linux#Configuration_with_stty - a modification of the script there ("For example, the following script configures the device and starts a background process for copying all received data from the serial device to standard output...") for the above program is below: # stty raw # ( ./fd_server 2>/dev/null; )& bgPidS=$! ( cat < /tmp/np2 ; )& bgPid=$! # Read commands from user, send them to device echo $(kill -0 $bgPidS 2>/dev/null ; echo $?) while [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] && read cmd; do # redirect debug msgs to stderr, as here we're redirected to /tmp/np1 echo "$? - $bgPidS - $bgPid" >&2 echo "$cmd" echo -e "\nproc: $(kill -0 $bgPidS 2>/dev/null ; echo $?)" >&2 done >/tmp/np1 echo OUT # Terminate background read process - if they still exist if [ "$(kill -0 $bgPid 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPid fi if [ "$(kill -0 $bgPidS 2>/dev/null ; echo $?)" -eq "0" ] ; then kill $bgPidS fi # stty cooked So, saving the script as say starter.sh and calling it, results with the following session: $ ./starter.sh 0 i'm typing here and pressing [enter] at end 0 - 13496 - 13497 I'M TYPING HERE AND PRESSING [ENTER] AT END 0~?.N=?(?~? ?????}????@??????~? [garble] proc: 0 OUT which is what I'd call for "interactive session" (ignoring the debug statements) - server waits for me to enter a command; it gives its output after it receives a command (and as in this case it exits after first command, so does the starter script as well). Except that, I'd like to not have buffered input, but sent character by character (meaning the above session should exit after first key press, and print out a single letter only - which is what I expected stty raw would help with, but it doesn't: it just kills reaction to both Enter and Ctrl-C :) ) I was just wandering if there already is an existing command (akin to screen in respect to serial devices, I guess) that would accept two such named pipes as arguments, and establish a "terminal" or "shell" like session through them; or would I have to use scripts as above and/or program own 'client' that will behave as a terminal..

    Read the article

  • Google and Bing Map APIs Compared

    - by SGWellens
    At one of the local golf courses I frequent, there is an open grass field next to the course. It is about eight acres in size and mowed regularly. It is permissible to hit golf balls there—you bring and shag our own balls. My golf colleagues and I spend hours there practicing, chatting and in general just wasting time. One of the guys brings Ginger, the amazing, incredible, wonder dog. Ginger is a Hungarian Vizlas (or Hungarian pointer). She chases squirrels, begs for snacks and supervises us closely to make sure we don't misbehave. Anyway, I decided to make a dedicated web page to measure distances on the field in yards using online mapping services. I started with Google maps and then did the same application with Bing maps. It is a good way to become familiar with the APIs. Here are images of the final two maps: Google:  Bing:   To start with online mapping services, you need to visit the respective websites and get a developers key. I pared the code down to the minimum to make it easier to compare the APIs. Google maps required this CSS (or it wouldn't work): <style type="text/css">     html     {         height: 100%;     }       body     {         height: 100%;         margin: 0;         padding: 0;     } Here is how the map scripts are included. Google requires the developer Key when loading the JavaScript, Bing requires it when the map object is created: Google: <script type="text/javascript" src="https://maps.googleapis.com/maps/api/js?key=XXXXXXX&libraries=geometry&sensor=false" > </script> Bing: <script  type="text/javascript" src="http://ecn.dev.virtualearth.net/mapcontrol/mapcontrol.ashx?v=7.0"> </script> Note: I use jQuery to manipulate the DOM elements which may be overkill, but I may add more stuff to this application and I didn't want to have to add it later. Plus, I really like jQuery. Here is how the maps are created: Common Code (the same for both Google and Bing Maps):     <script type="text/javascript">         var gTheMap;         var gMarker1;         var gMarker2;           $(document).ready(DocLoaded);           function DocLoaded()         {             // golf course coordinates             var StartLat = 44.924254;             var StartLng = -93.366859;               // what element to display the map in             var mapdiv = $("#map_div")[0];   Google:         // where on earth the map should display         var StartPoint = new google.maps.LatLng(StartLat, StartLng);           // create the map         gTheMap = new google.maps.Map(mapdiv,             {                 center: StartPoint,                 zoom: 18,                 mapTypeId: google.maps.MapTypeId.SATELLITE             });           // place two markers         marker1 = PlaceMarker(new google.maps.LatLng(StartLat, StartLng + .0001));         marker2 = PlaceMarker(new google.maps.LatLng(StartLat, StartLng - .0001));           DragEnd(null);     } Bing:         // where on earth the map should display         var StartPoint = new  Microsoft.Maps.Location(StartLat, StartLng);           // create the map         gTheMap = new Microsoft.Maps.Map(mapdiv,             {                 credentials: 'XXXXXXXXXXXXXXXXXXX',                 center: StartPoint,                 zoom: 18,                 mapTypeId: Microsoft.Maps.MapTypeId.aerial             });           // place two markers         marker1 = PlaceMarker(new Microsoft.Maps.Location(StartLat, StartLng + .0001));         marker2 = PlaceMarker(new Microsoft.Maps.Location(StartLat, StartLng - .0001));           DragEnd(null);     } Note: In the Bing documentation, mapTypeId: was missing from the list of options even though the sample code included it. Note: When creating the Bing map, use the developer Key for the credentials property. I immediately place two markers/pins on the map which is simpler that creating them on the fly with mouse clicks (as I first tried). The markers/pins are draggable and I capture the DragEnd event to calculate and display the distance in yards and draw a line when the user finishes dragging. Here is the code to place a marker: Google: // ---- PlaceMarker ------------------------------------   function PlaceMarker(location) {     var marker = new google.maps.Marker(         {             position: location,             map: gTheMap,             draggable: true         });     marker.addListener('dragend', DragEnd);     return marker; } Bing: // ---- PlaceMarker ------------------------------------   function PlaceMarker(location) {     var marker = new Microsoft.Maps.Pushpin(location,     {         draggable : true     });     Microsoft.Maps.Events.addHandler(marker, 'dragend', DragEnd);     gTheMap.entities.push(marker);     return marker; } Here is the code than runs when the user stops dragging a marker: Google: // ---- DragEnd -------------------------------------------   var gLine = null;   function DragEnd(Event) {     var meters = google.maps.geometry.spherical.computeDistanceBetween(marker1.position, marker2.position);     var yards = meters * 1.0936133;     $("#message").text(yards.toFixed(1) + ' yards');    // draw a line connecting the points     var Endpoints = [marker1.position, marker2.position];       if (gLine == null)     {         gLine = new google.maps.Polyline({             path: Endpoints,             strokeColor: "#FFFF00",             strokeOpacity: 1.0,             strokeWeight: 2,             map: gTheMap         });     }     else        gLine.setPath(Endpoints); } Bing: // ---- DragEnd -------------------------------------------   var gLine = null;   function DragEnd(Args) {    var Distance =  CalculateDistance(marker1._location, marker2._location);      $("#message").text(Distance.toFixed(1) + ' yards');       // draw a line connecting the points    var Endpoints = [marker1._location, marker2._location];           if (gLine == null)    {        gLine = new Microsoft.Maps.Polyline(Endpoints,            {                strokeColor: new Microsoft.Maps.Color(0xFF, 0xFF, 0xFF, 0),  // aRGB                strokeThickness : 2            });          gTheMap.entities.push(gLine);    }    else        gLine.setLocations(Endpoints);  }  Note: I couldn't find a function to calculate the distance between points in the Bing API, so I wrote my own (CalculateDistance). If you want to see the source for it, you can pick it off the web page. Note: I was able to verify the accuracy of the measurements by using the golf hole next to the field. I put a pin/marker on the center of the green, and then by zooming in, I was able to see the 150 markers on the fairway and put the other pin/marker on one of them. Final Notes: All in all, the APIs are very similar. Both made it easy to accomplish a lot with a minimum amount of code. In one aerial view, there are leaves on the tree, in the other, the trees are bare. I don't know which service has the newer data. Here are links to working pages: Bing Map Demo Google Map Demo I hope someone finds this useful. Steve Wellens   CodeProject

    Read the article

  • why i am getting popup message when I am tryiing to update user.

    - by kumar
    I am getting Popup mesage something like You have chosen to open Update which is a:application/json From : http://localhost:1234 which ok cancel buttons.. I am using this code to run.. [HttpPost] public JsonResult MEdit(ExpenseBE e) { var cache = CacheFactory.GetCacheManager(); string F_ACTION = "U"; string F_DEBUG = "Y"; var excUpdateStatus = false; for (int i = 0; i <= cache.Count; i++) { var x = (ExpenseBE)cache.GetData("a" + i); if (x != null) { string Resolutioncode = e.Exception.ResolutionCode; string reasoncode = e.Exception.ReasonCode; string actioncode = e.Exception.ActionCode; e.Exception.ExceptionID = x.Exception.ExceptionID; e.Exception.ReasonCode = reasoncode; e.Exception.ReasonCode = Resolutioncode; e.Exception.ActionCode = actioncode; e.Exception.Sequence = x.Exception.Sequence; e.Exception.FollowupDate = x.Exception.FollowupDate; e.Exception.IOL = x.Exception.IOL; e.Exception.LastUpdateUser = User.Identity.Name.ToUpper().Remove(0, 4); excUpdateStatus = common.UpdateException(e.Exception, F_ACTION, F_DEBUG); } } return Json(excUpdateStatus.ToString()); } and my view is <%@ Control Language="C#" Inherits="System.Web.Mvc.ViewUserControl<NorthernTrust.ATP.iTool.Core.Business.Entities.Specialist.ExpenseBE>" %> <% using (Html.BeginForm("MEdit", "expense", FormMethod.Post)) { %> <%= Html.ValidationSummary(true)%> <fieldset class="clearfix" id="fieldset-exception"> <legend>Mass Edit Exception Information</legend> <div class="fiveper"> <label for="ExceptionStatus"> Status: <span> </span> </label> <label for="ResolutionCode"> Resolution: <span> <%=Html.DropDownListFor(model=>model.Exception.ResolutionCode,new SelectList(Model.LookupCodes["C_EXCPT_RESL"], "Key", "Value"))%> </span> </label> <label for="ReasonCode"> Reason: <span><%=Html.DropDownListFor(model => model.Exception.ReasonCode, new SelectList(Model.LookupCodes["C_EXCPT_RSN"], "Key", "Value"))%></span> </label> <label for="ExceptionStatus"> Action Taken: <span><%=Html.DropDownListFor(model => model.Exception.ActionCode, new SelectList(Model.LookupCodes["C_EXCPT_ACT"], "Key", "Value"))%></span> </label> </div> <div class="fiveper"> <label for="FollowupDate"> Follow-up: <span><input type="text" id="exc-flwup-" /></span> <%--<%=Html.EditorFor(model=>model.Exception.FollowupDate) %>--%> </label> <label for="IOL"> Inquiry #: <%=Html.TextBox("Inquiery", ViewData["inq"] ?? "")%> </label> <label>Comment</label> <span> <%=Html.TextArea("value") %> <%=Html.ValidationMessage("value")%> </span> </div> <br /> <br /> <div> <button id="btnSelect" class="button">Select All</button> <button id="btnCancel" class="button">Cancel</button> <input type="submit" class="button" value="Save" /> </div> </fieldset> <% } %> <script type="text/javascript"> $(document).ready(function() { $('#btnSelectAll').click(function() { function validate_excpt(formData, jqForm, options) { var form = jqForm[0]; } $('#btnSelect').click(function() { $('#input [type=checkbox]').attr('checked', 'checked'); }); // post-submit callback function showResponse(responseText, statusText, xhr, $form) { if ('success' == statusText) { $('#error-msg span:last').html('<strong>Update successful.</strong>'); } else { $('#error-msg span:last').html('<strong>Update failed.</strong> ' + responseText); } $('#error-msg').removeClass('hide'); } $('#exc').ajaxForm({ target: '#error-msg', beforeSubmit: validate_excpt, success: showResponse, dataType: 'json' }); $('.button').button(); }); $('.button').button(); $("input[id^='exc-flwup-']").datepicker({ duration: '', showTime: true, constrainInput: true, stepMinutes: 30, stepHours: 1, altTimeField: '', time24h: true, minDate: 0 }); $('#ui-timepicker-div').bgiframe(); }); </script> please correct me if i am doing somwhere wrong? thanks

    Read the article

  • I want to keep the values on textbox after onchange function

    - by user1908045
    hello i have problem with this code..I want to keep the values of the textboxes when the pageload and didnt write again the values. I have two drop down list. the First one is the country when the country selected then the page load and appear the city to select but afte the pageload the values on textbox is empty. I want to keep the values of textbox when the page load. This is the code <head> <script type="text/javascript"> function Load_id() { var Count = document.getElementById("Count").value; var Count_txt = "?Count=" location = Count_txt + Count } </script> <meta charset="UTF-8"> </head> <body> <div class="main"> <div class="headers"> <table> <tr><td rowspan="2"><img alt="unipi" src="/Images/logo.jpeg" height="75" width="52"></td> <td>University</td></tr> <tr><td>Data</td></tr> </table> </div> <div class="form"> <h3>Personal</h3><br/><br/><br/> <form id="Page1" name="Page1" action="Form1Sub.php" method="Post"> <table style="width:520px;text-align:left;"> <tr><td><label>Number:</label></td> <td><input type="text" required="required" id="AM" name="AM" value=""/></td> </tr> <tr><td><label>Name:</label></td> <td><input type="text" required="required" name="Name"/></td> </tr> <?php $host="localhost"; $username=""; $password=""; $dbName="Database"; $connection = mysql_connect($host, $username, $password) or die("Couldn't Connect to the Server"); $db = mysql_select_db($dbName, $connection) or die("cannot select DataBase"); $Count = $_GET['Count']; echo "<tr><td><label>Country</label></td>\n"; $country = mysql_query("select DISTINCT Country FROM lut_country_city "); echo " <td><select id=\"Count\" name=\"cat\" onChange=\"Load_id(this)\">\n"; echo " `<option>Select Country</option>\n"; while($nt=mysql_fetch_array($country)){ $selected = ($nt["Country"] == $Count)? "SELECTED":""; echo"<option value=\"".$nt['Country']."\"". $selected." >".$nt['Country']."</option>"; } echo " </select></td></tr>\n"; echo"<tr><td><label>City:</label></td>\n"; $q2 = mysql_query("Select id,City,Country FROM lut_country_city WHERE Country = '$Count'"); echo"<td><select name=\"SelectCity\">\n"; while($row = mysql_fetch_array($q2)) { echo"<option value=\"".$row['id']."\">".$row['City']."</option>"; } echo " </select></td></tr>\n"; ?> </table> <p> <button type="submit" id="Next">Next</button> </form> <form id="form1" action="index.php"> <button id="Back" type="submit">Back</button> </form> </p> </div> </div> </body> </html>

    Read the article

< Previous Page | 572 573 574 575 576 577 578 579 580 581 582 583  | Next Page >