Search Results

Search found 15228 results on 610 pages for 'comment action'.

Page 578/610 | < Previous Page | 574 575 576 577 578 579 580 581 582 583 584 585  | Next Page >

  • Content Box is a Little Off in IE9 ... How to Fix?

    - by Kelsey Nealon
    Hi there! I have a website at www.thetotempole.ca and when viewed in IE9... My websites content box (The green wooden backgrounded box with content inside) is moved slightly over to the left making a space between the actual container and the content box... Is there anyway I can fix this without harming any of the other browsers? Thanks! Screenshot: HTML: <!DOCTYPE html> <head> <title>The Totem Pole News - Movies</title> <!-- Start WOWSlider.com HEAD section --> <link rel="stylesheet" type="text/css" href="engine1/style.css" /> <script type="text/javascript" src="engine1/jquery.js"></script> <!-- End WOWSlider.com HEAD section --> <script type="text/javascript"> var _gaq = _gaq || []; _gaq.push(['_setAccount', 'UA-45342007-1']); _gaq.push(['_trackPageview']); (function() { var ga = document.createElement('script'); ga.type = 'text/javascript'; ga.async = true; ga.src = ('https:' == document.location.protocol ? 'https://ssl' : 'http://www') + '.google-analytics.com/ga.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(ga, s); })(); </script> <meta charset="utf-8"> <meta name="description" content="A totem pole themed news website posting articles on news, music, movies, video games, and health."> <link href="thecss2.css" rel="stylesheet" type="text/css"> <link rel="icon" type="image/ico" href="images/favicon.ico"> <meta http-equiv="X-UA-Compatible" content="IE=8" /> </head> <body> <div id="container"> <div id="contentbox" align="Center"> <a href="index.html"><div id="banner" align="Center"> </div></a> <div id="navbar"> <p><a href="index.html"><img src="images/home.png" width="65" height="54" alt="picture of a house to relate to the home page (content)" style="position: absolute; left: 23px; top: 16px; width: 57px; height: 48px;"><span style="position: absolute; left: 24px; z-index:2; top: 71px; height: 23px;">Content</span></a> <a href="#"><img src="images/eagleicon.gif" width="73" height="39" alt="An Eagle icon for the News section of the Totem Pole" style="position: absolute; left: 111px; top: 28px;"><span style="position: absolute; z-index: 2; left: 127px; top: 72px;">News</span></a> <a href="#"><img src="images/owlicon.gif" width="81" height="61" alt="An Owl icon for the Music section of the totem pole" style="position: absolute; left: 210px; top: 11px;"><span style="position: absolute; z-index:2; left: 226px; top: 73px;"><strong>Music</strong></span></a><a href="movies.html"><img src="images/wolficon.gif" width="88" height="54" alt="A Wolf icon for the Movies section of the totem pole" style="position: absolute; left: 320px; top: 15px;"><span style="position: absolute; left: 336px; top: 72px; z-index:2;"><strong>Movies</strong></span></a> <a href="#"><img src="images/hareimage.gif" width="60" height="56" alt="A Hare icon for Video Game section of the Totem Pole" style="position: absolute; left: 441px; top: 13px;"><span style="position: absolute; z-index:2; left: 428px; top: 73px;"><strong>Video Games</strong></span></a> <a href="#"><img src="images/bearicon.gif" width="91" height="57" alt="A bear icon for the Health section of The Totem Pole" style="position: absolute; left: 551px; top: 13px;"><span style="position: absolute; left: 580px; top: 72px; z-index:2;">Health</span></a></p> </div> <!--Nav Bar 2--> <div id="navbar2"> <a href="#">About Us</a> <a href="#">Feedback</a> <a href="#">Subscribe</a> </div> <!-- Atomz HTML for Search --> <div id="searchbar"> <form method="get" action="http://search.atomz.com/search/"> <input id="searchbox" size="13" name="sp_q" value="Search..." onFocus="if (this.value == 'Search...') {this.value=''}"> <input class="css_btn_class" type="submit" value="Search"> <input type="hidden" name="sp_a" value="sp1005092e"> <input type="hidden" name="sp_p" value="all"> <input type="hidden" name="sp_f" value="UTF-8"> </form> </div> <!-- Start WOWSlider.com BODY section --> <div id="mywowslider"> <div id="wowslider-container1"> <div class="ws_images"> <ul> <li><img src="images/anchor.jpg" alt="Ron Burgundy" title="Ron Burgundy" id="wows1_0"/>Played by Will Ferrell</li> <li><img src="images/anchor2.jpg" alt="Brian Fantana" title="Brian Fantana" id="wows1_1"/>Played by Paul Rudd</li> <li><img src="images/anchor3.jpg" alt="Brick Tamland" title="Brick Tamland" id="wows1_2"/>Played by Steve Carrell</li> <li><img src="images/anchor4.jpg" alt="Champ Kind" title="Champ Kind" id="wows1_3"/>Played by David Koechner</li> </ul> </div> <div class="ws_bullets"><div> <a href="#" title="Ron Burgundy"><img src="images/anchor.jpg" alt="Ron Burgundy"/>1</a> <a href="#" title="Brian Fantana"><img src="images/anchor2.jpg" alt="Brian Fantana"/>2</a> <a href="#" title="Brick Tamland"><img src="images/anchor3.jpg" alt="Brick Tamland"/>3</a> <a href="#" title="Champ Kind"><img src="images/anchor4.jpg" alt="Champ Kind"/>4</a> </div> </div> <span class="wsl"><a href="http://wowslider.com"></a></span> <div class="ws_shadow"></div> </div> <script type="text/javascript" src="engine1/wowslider.js"></script> <script type="text/javascript" src="engine1/script.js"></script> </div> <!-- End WOWSlider.com BODY section --> <!-- AddThis Smart Layers BEGIN --> <!-- Go to http://www.addthis.com/get/smart-layers to customize --> <script type="text/javascript" src="//s7.addthis.com/js/300/addthis_widget.js#pubid=ra-5279b96309e7df24"></script> <script type="text/javascript"> addthis.layers({ 'theme' : 'transparent', 'share' : { 'position' : 'left', 'numPreferredServices' : 5 } }); </script> <!-- AddThis Smart Layers END --> <div id="sources"><p> Source(s): <a href="http://en.wikipedia.org/wiki/Anchorman_2:_The_Legend_Continues">wikipedia.com</a></p></div> <div id="infocontent"> <p align="left"><em><strong> &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;Anchorman 2: The Legend Continues</strong></em> is an upcoming American comedy film being released on December 20, 2013, also a sequel to the 2004 film <em>Anchorman: The Legend of Ron Burgandy</em>. On March 28, 2012, actor Will Ferrell officially announced the sequel dressed in character as Ron Burgundy on the late-night talk-show <em>Conan</em>. As with the original film, it is directed by Adam McKay, produced by Judd Apatow, stars Will Ferrell and is written by Adam McKay and Will Ferrell. Unlike the original film, which was distributed by DreamWorks Pictures, <em>The Legend Continues</em> will be distributed by Paramount Pictures.</p> <p align="left"><em><strong>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</strong></em>The movie now has a website at <a href="www.anchormanmovie.com">www.anchormanmovie.com</a> where a countdown for the release of this film can be seen. By the looks of these images, I think we can expect big things when the movie comes out this December. Enjoy the poster photos and trailers all posted below, and don't forget to submit your vote in the poll!</p> </div> <div id="trailer1"><iframe width="560" height="315" src="//www.youtube.com/embed/Elczv0ghqw0?rel=0" frameborder="0" allowfullscreen></iframe></div> <div id="trailer2"> <iframe width="560" height="315" src="//www.youtube.com/embed/mZ-JX-7B3uM?rel=0" frameborder="0" allowfullscreen></iframe> </div> <div id="poll"> <form method="post" action="http://poll.pollcode.com/763294"><table style="border: black 1px solid;" border="1" width="175" bgcolor="EEEEEE" cellspacing="2" cellpadding="0"><tr><td colspan="2" height="10"><font face="Verdana" size="2" color="000000"><b>What Rating Do You Think This Will Recieve</b></font></td></tr><tr><td width="5"><input type="radio" name="answer" value="1" id="763294answer1"></td><td>&nbsp;<font face="Verdana" size="2" color="000000"><label for="763294answer1">10</label></font></td></tr><tr><td width="5"><input type="radio" name="answer" value="2" id="763294answer2"></td><td>&nbsp;<font face="Verdana" size="2" color="000000"><label for="763294answer2">9</label></font></td></tr><tr><td width="5"><input type="radio" name="answer" value="3" id="763294answer3"></td><td>&nbsp;<font face="Verdana" size="2" color="000000"><label for="763294answer3">8</label></font></td></tr><tr><td width="5"><input type="radio" name="answer" value="4" id="763294answer4"></td><td>&nbsp;<font face="Verdana" size="2" color="000000"><label for="763294answer4">7</label></font></td></tr><tr><td width="5"><input type="radio" name="answer" value="5" id="763294answer5"></td><td>&nbsp;<font face="Verdana" size="2" color="000000"><label for="763294answer5">6</label></font></td></tr><tr><td width="5"><input type="radio" name="answer" value="6" id="763294answer6"></td><td>&nbsp;<font face="Verdana" size="2" color="000000"><label for="763294answer6">5</label></font></td></tr><tr><td width="5"><input type="radio" name="answer" value="7" id="763294answer7"></td><td>&nbsp;<font face="Verdana" size="2" color="000000"><label for="763294answer7">4</label></font></td></tr><tr><td width="5"><input type="radio" name="answer" value="8" id="763294answer8"></td><td>&nbsp;<font face="Verdana" size="2" color="000000"><label for="763294answer8">3</label></font></td></tr><tr><td width="5"><input type="radio" name="answer" value="9" id="763294answer9"></td><td>&nbsp;<font face="Verdana" size="2" color="000000"><label for="763294answer9">2</label></font></td></tr><tr><td width="5"><input type="radio" name="answer" value="10" id="763294answer10"></td><td>&nbsp;<font face="Verdana" size="2" color="000000"><label for="763294answer10">1</label></font></td></tr><tr><td colspan="2" height="10"><center><input type="submit" value=" Vote ">&nbsp;&nbsp;<input title="Clicking this will send you to a new page" type="submit" name="view" value=" View "></center></td></tr><tr><td colspan="2" align="right"><font face="Verdana" height="5" size="1" color="000000"></font></td></tr></table></form></div> <span style="position: absolute; left: 0px; top: 225px; width: 1000px; border-bottom: 2px black double; height: 58px;"> <h1 style="font-weight: normal; font-size:28px"><em>Anchorman 2 Arrives Soon</em></h1></span> <div id="contentbox2"></div> <!--Footer Div --> <center><div id="footer"><a href="#">Sitemap</a> <a href="#">About Us</a> <a href="#">Feedback</a></div></center> <div id="disqus"><div id="disqus_thread"></div> <script type="text/javascript"> /* * * CONFIGURATION VARIABLES: EDIT BEFORE PASTING INTO YOUR WEBPAGE * * */ var disqus_shortname = 'thetotempoleanchorman2'; // required: replace example with your forum shortname /* * * DON'T EDIT BELOW THIS LINE * * */ (function() { var dsq = document.createElement('script'); dsq.type = 'text/javascript'; dsq.async = true; dsq.src = '//' + disqus_shortname + '.disqus.com/embed.js'; (document.getElementsByTagName('head')[0] || document.getElementsByTagName('body')[0]).appendChild(dsq); })(); </script> <noscript>Please enable JavaScript to view the <a href="http://disqus.com/?ref_noscript">comments powered by Disqus.</a></noscript> <a href="http://disqus.com" class="dsq-brlink">comments powered by <span class="logo-disqus">Disqus</span></a></div> <!-- This is the end of the contentbox --></div> <!-- This is the end of the container div --> </div> </body> </html> CSS: html { background: url(images/pine.jpg) no-repeat center center fixed; -webkit-background-size: cover; -moz-background-size: cover; -o-background-size: cover; background-size: cover; filter: progid:DXImageTransform.Microsoft.AlphaImageLoader(src='images/pine.jpg', sizingMethod='scale'); -ms-filter: "progid:DXImageTransform.Microsoft.AlphaImageLoader(src='images/pine.jpg', sizingMethod='scale')"; } body { margin-bottom:0px; font-family: Verdana, Geneva, sans-serif; } a { outline : none; border: none; } a:hover { color: #0FC; } #container { width: 1000px; height:1924px; position:relative; margin-right: auto; margin-left: auto; z-index:1; margin-bottom: 50px; } #facebook { position:fixed; right:100px; z-index:15; } #twitter { position:fixed; z-index:16; right:120px; } #google { position:fixed; top:7px; right: 135px; } #socialmediaplugins { text-align: right; position: fixed; background: rgb(125,126,125); /* Old browsers */ background: -moz-linear-gradient(top, rgba(125,126,125,1) 0%, rgba(247,247,247,1) 100%); /* FF3.6+ */ background: -webkit-gradient(linear, left top, left bottom, color-stop(0%,rgba(125,126,125,1)), color-stop(100%,rgba(247,247,247,1))); /* Chrome,Safari4+ */ background: -webkit-linear-gradient(top, rgba(125,126,125,1) 0%,rgba(247,247,247,1) 100%); /* Chrome10+,Safari5.1+ */ background: -o-linear-gradient(top, rgba(125,126,125,1) 0%,rgba(247,247,247,1) 100%); /* Opera 11.10+ */ background: -ms-linear-gradient(top, rgba(125,126,125,1) 0%,rgba(247,247,247,1) 100%); /* IE10+ */ background: linear-gradient(to bottom, rgba(125,126,125,1) 0%,rgba(247,247,247,1) 100%); /* W3C */ filter: progid:DXImageTransform.Microsoft.gradient( startColorstr='#7d7e7d', endColorstr='#f7f7f7',GradientType=0 ); /* IE6-9 */ margin: 0px; top: 0px; left: 0px; right: 0px; z-index:14; } #searchbox { background-color:#01bff6; border-radius:4px; } #searchbox:hover { background-color:#76b618; border-radius:4px; } #searchbox:active { background-color:#01bff6; border-radius:4px; } #contentbox { background-color:black; background-image:url(images/wooden.jpg); width: 1000px; margin-bottom:50px; height: 1924px; box-shadow:2px 2px 10px 10px #060606; -webkit-box-shadow:2px 2px 10px 10px #060606; -moz-box-shadow:2px 2px 10px 10px #060606; /* For IE<9 */ filter: progid:DXImageTransform.Microsoft.Shadow(color=#060606,direction=0,strength=5), progid:DXImageTransform.Microsoft.Shadow(color=#060606,direction=45,strength=2), progid:DXImageTransform.Microsoft.Shadow(color=#060606,direction=90,strength=5), progid:DXImageTransform.Microsoft.Shadow(color=#060606,direction=135,strength=5), progid:DXImageTransform.Microsoft.Shadow(color=#060606,direction=180,strength=10), progid:DXImageTransform.Microsoft.Shadow(color=#060606,direction=225,strength=5), progid:DXImageTransform.Microsoft.Shadow(color=#060606,direction=270,strength=5), progid:DXImageTransform.Microsoft.Shadow(color=#060606,direction=315,strength=2); } #contentbox2 { background-image:url(images/woodenmovies.jpg); top:299px; width: 1000px; margin-bottom:50px; height: 1625px; position: absolute; } #banner { background-image:url(images/totempolebanner.gif); position:absolute; top:25px; width:768px; height:120px; left:116px; } #navbar { float: left; position: absolute; top: 146px; left: 76px; width: 844px; height: 158px; font-weight:bold; } #navbar a { color:#0C6; font-size: 13px; } #navbar a:hover { color:#0F9; font-size: 13px; } #navbar2 a:hover { color:#0F9; } #navbar2 a{ text-decoration:none; color:#0C6; } #navbar2 { position: absolute; top: 4px; left: 766px; width: 273px; height: 24px; font-size: 11px; } #searchbar { position: absolute; top: 23px; left: 885px; width: 118px; height: 69px; } .css_btn_class { font-size:9px; position: relative; top:0px; right:4px; width:90px; height:25px; font-family:Verdana; font-weight:normal; -moz-border-radius:7px; -webkit-border-radius:7px; border-radius:7px; border:1px solid #35d914; padding:7px 24px; text-decoration:none; background:-webkit-gradient( linear, left top, left bottom, color-stop(5%, #ff9d00), color-stop(100%, #ffe711) ); background:-moz-linear-gradient( center top, #ff9d00 5%, #ffe711 100% ); background:-ms-linear-gradient( top, #ff9d00 5%, #ffe711 100% ); background-color:#ff9d00; color:#ff0000; display:inline-block; text-shadow:0px 0px 1px #117cff; -webkit-box-shadow: 0px 0px 0px 0px #117cff; -moz-box-shadow: 0px 0px 0px 0px #117cff; box-shadow: 0px 0px 0px 0px #117cff; background-image: url(images/unnamed.gif); background-repeat:no-repeat; background-position:right; }.css_btn_class:hover { width:90px; background:-webkit-gradient( linear, left top, left bottom, color-stop(5%, #ffe711), color-stop(100%, #ff9d00) ); background:-moz-linear-gradient( center top, #ffe711 5%, #ff9d00 100% ); background:-ms-linear-gradient( top, #ffe711 5%, #ff9d00 100% ); background-color:#ffe711; background-image: url(images/unnamed.gif); background-repeat:no-repeat; background-position:right; }.css_btn_class:active { position:relative; width:90px; top:1px; background-image: url(images/unnamed.gif); background-repeat:no-repeat; background-position:right; } /* This css button was generated by css-button-generator.com */ img {border:none;} #eagle { position:relative; right: 144px; top:299px; } #owl { top:624px; position:absolute; left:0px; } #wolf { top:949px; position:absolute; right:0px; } #hare { top:1274px; position:absolute; left:0px; } #bear { top:1599px; position:absolute; right:0px; } #footer { position: absolute; left: 393px; top: 1941px; width: 251px; color: #0F9; } #footer a { color: #0f9; } .atss { left: 0; } #infocontent { position: absolute; z-index: 3; left: 15px; top: 333px; height: 348px; width: 789px; } #mywowslider { position: absolute; z-index: 3; left: 640px; top: 684px; } #poll { position: absolute; z-index: 3; left: 815px; top: 344px; } #trailer1 { position: absolute; z-index: 3; left: 40px; top: 598px; } #trailer2 { position: absolute; z-index: 3; left: 40px; top: 948px; } #trailer1header { position: absolute; z-index: 3; left: 200px; top: 550px; width: 240px; font-style: italic; font-weight: normal; } #trailer2header { position: absolute; z-index: 3; left: 200px; top: 898px; width: 241px; height: 51px; font-style: italic; font-weight: normal; } #disqus { position: absolute; z-index: 3; left: 0px; top: 1340px; } #sources { position: absolute; z-index: 3; left: 394px; top: 1249px; width: 212px; }

    Read the article

  • How to determine whether a class has a particular templated member function?

    - by Aozine
    I was wondering if it's possible to extend the SFINAE approach to detecting whether a class has a certain member function (as discussed here: "Is there a Technique in C++ to know if a class has a member function of a given signature?" http://stackoverflow.com/questions/87372/is-there-a-technique-in-c-to-know-if-a-class-has-a-member-function-of-a-given-s ) to support templated member functions? E.g. to be able to detect the function foo in the following class: struct some_class { template < int _n > void foo() { } }; I thought it might be possible to do this for a particular instantiation of foo, (e.g. check to see if void foo< 5 >() is a member) as follows: template < typename _class, int _n > class foo_int_checker { template < typename _t, void (_t::*)() > struct sfinae { }; template < typename _t > static big test( sfinae< _t, &_t::foo< _n > > * ); template < typename _t > static small test( ... ); public: enum { value = sizeof( test< _class >( 0 ) ) == sizeof( big ) }; }; Then do foo_int_checker< some_class, 5 >::value to check whether some_class has the member void foo< 5 >(). However on MSVC++ 2008 this always returns false while g++ gives the following syntax errors at the line test( sfinae< _t, &_t::foo< _n > > ); test.cpp:24: error: missing `>' to terminate the template argument list test.cpp:24: error: template argument 2 is invalid test.cpp:24: error: expected unqualified-id before '<' token test.cpp:24: error: expected `,' or `...' before '<' token test.cpp:24: error: ISO C++ forbids declaration of `parameter' with no type Both seem to fail because I'm trying to get the address of a template function instantiation from a type that is itself a template parameter. Does anyone know whether this is possible or if it's disallowed by the standard for some reason? EDIT: It seems that I missed out the ::template syntax to get g++ to compile the above code correctly. If I change the bit where I get the address of the function to &_t::template foo< _n > then the program compiles, but I get the same behaviour as MSVC++ (value is always set to false). If I comment out the ... overload of test to force the compiler to pick the other one, I get the following compiler error in g++: test.cpp: In instantiation of `foo_int_checker<A, 5>': test.cpp:40: instantiated from here test.cpp:32: error: invalid use of undefined type `class foo_int_checker<A, 5>' test.cpp:17: error: declaration of `class foo_int_checker<A, 5>' test.cpp:32: error: enumerator value for `value' not integer constant where line 32 is the enum { value = sizeof( test< _class >( 0 ) ) == sizeof( big ) }; line. Unfortunately this doesn't seem to help me diagnose the problem :(. MSVC++ gives a similar nondescript error: error C2770: invalid explicit template argument(s) for 'clarity::meta::big checker<_checked_type>::test(checker<_checked_type>::sfinae<_t,&_t::template foo<5>> *)' on the same line. What's strange is that if I get the address from a specific class and not a template parameter (i.e. rather than &_t::template foo< _n > I do &some_class::template foo< _n >) then I get the correct result, but then my checker class is limited to checking a single class (some_class) for the function. Also, if I do the following: template < typename _t, void (_t::*_f)() > void f0() { } template < typename _t > void f1() { f0< _t, &_t::template foo< 5 > >(); } and call f1< some_class >() then I DON'T get a compile error on &_t::template foo< 5 >. This suggests that the problem only arises when getting the address of a templated member function from a type that is itself a template parameter while in a SFINAE context. Argh!

    Read the article

  • Performance of delegate and method group

    - by BlueFox
    Hi I was investigating the performance hit of creating Cachedependency objects, so I wrote a very simple test program as follows: using System; using System.Collections.Generic; using System.Diagnostics; using System.Web.Caching; namespace Test { internal class Program { private static readonly string[] keys = new[] {"Abc"}; private static readonly int MaxIteration = 10000000; private static void Main(string[] args) { Debug.Print("first set"); test7(); test6(); test5(); test4(); test3(); test2(); Debug.Print("second set"); test2(); test3(); test4(); test5(); test6(); test7(); } private static void test2() { DateTime start = DateTime.Now; var list = new List<CacheDependency>(); for (int i = 0; i < MaxIteration; i++) { list.Add(new CacheDependency(null, keys)); } Debug.Print("test2 Time: " + (DateTime.Now - start)); } private static void test3() { DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(() => new CacheDependency(null, keys)); } Debug.Print("test3 Time: " + (DateTime.Now - start)); } private static void test4() { var p = new Program(); DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(p.GetDep); } Debug.Print("test4 Time: " + (DateTime.Now - start)); } private static void test5() { var p = new Program(); DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(() => { return p.GetDep(); }); } Debug.Print("test5 Time: " + (DateTime.Now - start)); } private static void test6() { DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(GetDepSatic); } Debug.Print("test6 Time: " + (DateTime.Now - start)); } private static void test7() { DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(() => { return GetDepSatic(); }); } Debug.Print("test7 Time: " + (DateTime.Now - start)); } private CacheDependency GetDep() { return new CacheDependency(null, keys); } private static CacheDependency GetDepSatic() { return new CacheDependency(null, keys); } } } But I can't understand why these result looks like this: first set test7 Time: 00:00:00.4840277 test6 Time: 00:00:02.2041261 test5 Time: 00:00:00.1910109 test4 Time: 00:00:03.1401796 test3 Time: 00:00:00.1820105 test2 Time: 00:00:08.5394884 second set test2 Time: 00:00:07.7324423 test3 Time: 00:00:00.1830105 test4 Time: 00:00:02.3561347 test5 Time: 00:00:00.1750100 test6 Time: 00:00:03.2941884 test7 Time: 00:00:00.1850106 In particular: 1. Why is test4 and test6 much slower than their delegate version? I also noticed that Resharper specifically has a comment on the delegate version suggesting change test5 and test7 to "Covert to method group". Which is the same as test4 and test6 but they're actually slower? 2. I don't seem a consistent performance difference when calling test4 and test6, shouldn't static calls to be always faster?

    Read the article

  • $_GET loading content before head tag instead of in specified div.

    - by s32ialx
    NOT EDITING BELOW BUT THANKS TO SOME REALLY NICE PEOPLE I CAN'T POST AN IMAGE ANYMORE BECAUSE I HAD a 15 Rep but NOW ONLY A 5 becuase my question wasn't what they wanted help with they gave me a neg rep. The problem is that the content loads it displays UNDER the div i placed #CONTENT# inside so the styles are being ignored and it's posting #CONTENT# outside the divs at positions 0,0 any suggestions? Found out whats happening by using "View Source" seems that it's putting all of the #CONTENT#, content that's being loaded in front of the <head> tag. Like this <doctype...> <div class="home"> \ blah blah #CONTENT# bot being loaded in correct specified area </div> / <head> <script src=""></script> </head> <body> <div class="header"></div> <div class="contents"> #CONTENT# < where content SHOULD load </div> <div class="footer"></div> </body> so anyone got a fix? OK so a better description I'll add relevant screen-shots Whats happening is /* file.class.php */ <?php $file = new file(); class file{ var $path = "templates/clean"; var $ext = "tpl"; function loadfile($filename){ return file_get_contents($this->path . "/" . $filename . "." . $this->ext); } function setcontent($content,$newcontent,$vartoreplace='#CONTENT#'){ $val = str_replace($vartoreplace,$newcontent,$content); return $val; } function p($content) { $v = $content; $v = str_replace('#CONTENT#','',$v); print $v; } } if(!isset($_GET['page'])){ // if not, lets load our index page(you can change home.php to whatever you want: include("main.txt"); // else $_GET['page'] was set so lets do stuff: } else { // lets first check if the file exists: if(file_exists($_GET['page'].'.txt')){ // and lets include that then: include($_GET['page'].'.txt'); // sorry mate, could not find it: } else { echo 'Sorry, could not find <strong>' . $_GET['page'] .'.txt</strong>'; } } ?> is calling for a file_get_contents at the bottom which I use in /* index.php */ <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <?php include('classes/file.class.php'); // load the templates $header = $file->loadfile('header'); $body = $file->loadfile('body'); $footer = $file->loadfile('footer'); // fill body.tpl #CONTENT# slot with $content $body = $file->setcontent($body, $content); // cleanup and output the full page $file->p($header . $body . $footer); ?> and loads into /* body.tpl */ <div id="bodys"> <div id="bodt"></div> <div id="bodm"> <div id="contents"> #CONTENT# </div> </div> <div id="bodb"></div> </div> but the issue is as follows the $content loads properly img tags etc <h2> tags etc but CSS styling is TOTALY ignored for position width z-index etc. and as follows here's the screen-shot My Firefox Showing The Problem In Action REPOSTED DUE TO PEOPLE NOT HELPING AND JUST BEING ARROGANT AND GIVING NEGATIVE VOTES and not even saying a word. DO NOT COMMENT UNLESS YOU PLAN TO HELP god I'm a beginner and with you people giving me bad reviews this won't make me help you out when the chance comes.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why is .NET faster than C++ in this case?

    - by acidzombie24
    -edit- I LOVE SLaks comment. "The amount of misinformation in these answers is staggering." :D Calm down guys. Pretty much all of you were wrong. I DID make optimizations. It turns out whatever optimizations I made wasn't good enough. I ran the code in GCC using gettimeofday (I'll paste code below) and used g++ -O2 file.cpp and got slightly faster results then C#. Maybe MS didn't create the optimizations needed in this specific case but after downloading and installing mingw I was tested and found the speed to be near identical. Justicle Seems to be right. I could have sworn I use clock on my PC and used that to count and found it was slower but problem solved. C++ speed isn't almost twice as slower in the MS compiler. When my friend informed me of this I couldn't believe it. So I took his code and put some timers onto it. Instead of Boo I used C#. I constantly got faster results in C#. Why? The .NET version was nearly half the time no matter what number I used. C++ version: #include <iostream> #include <stdio.h> #include <intrin.h> #include <windows.h> using namespace std; int fib(int n) { if (n < 2) return n; return fib(n - 1) + fib(n - 2); } int main() { __int64 time = 0xFFFFFFFF; while (1) { int n; //cin >> n; n = 41; if (n < 0) break; __int64 start = __rdtsc(); int res = fib(n); __int64 end = __rdtsc(); cout << res << endl; cout << (float)(end-start)/1000000<<endl; break; } return 0; } C# version: using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Runtime.InteropServices; using System.ComponentModel; using System.Threading; using System.IO; using System.Diagnostics; namespace fibCSTest { class Program { static int fib(int n) { if (n < 2)return n; return fib(n - 1) + fib(n - 2); } static void Main(string[] args) { //var sw = new Stopwatch(); //var timer = new PAB.HiPerfTimer(); var timer = new Stopwatch(); while (true) { int n; //cin >> n; n = 41; if (n < 0) break; timer.Start(); int res = fib(n); timer.Stop(); Console.WriteLine(res); Console.WriteLine(timer.ElapsedMilliseconds); break; } } } } GCC version: #include <iostream> #include <stdio.h> #include <sys/time.h> using namespace std; int fib(int n) { if (n < 2) return n; return fib(n - 1) + fib(n - 2); } int main() { timeval start, end; while (1) { int n; //cin >> n; n = 41; if (n < 0) break; gettimeofday(&start, 0); int res = fib(n); gettimeofday(&end, 0); int sec = end.tv_sec - start.tv_sec; int usec = end.tv_usec - start.tv_usec; cout << res << endl; cout << sec << " " << usec <<endl; break; } return 0; }

    Read the article

  • Watching setTimeout loops so that only one is running at a time.

    - by DA
    I'm creating a content rotator in jQuery. 5 items total. Item 1 fades in, pauses 10 seconds, fades out, then item 2 fades in. Repeat. Simple enough. Using setTimeout I can call a set of functions that create a loop and will repeat the process indefinitely. I now want to add the ability to interrupt this rotator at any time by clicking on a navigation element to jump directly to one of the content items. I originally started going down the path of pinging a variable constantly (say every half second) that would check to see if a navigation element was clicked and, if so, abandon the loop, then restart the loop based on the item that was clicked. The challenge I ran into was how to actually ping a variable via a timer. The solution is to dive into JavaScript closures...which are a little over my head but definitely something I need to delve into more. However, in the process of that, I came up with an alternative option that actually seems to be better performance-wise (theoretically, at least). I have a sample running here: http://jsbin.com/uxupi/14 (It's using console.log so have fireBug running) Sample script: $(document).ready(function(){ var loopCount = 0; $('p#hello').click(function(){ loopCount++; doThatThing(loopCount); }) function doThatOtherThing(currentLoopCount) { console.log('doThatOtherThing-'+currentLoopCount); if(currentLoopCount==loopCount){ setTimeout(function(){doThatThing(currentLoopCount)},5000) } } function doThatThing(currentLoopCount) { console.log('doThatThing-'+currentLoopCount); if(currentLoopCount==loopCount){ setTimeout(function(){doThatOtherThing(currentLoopCount)},5000); } } }) The logic being that every click of the trigger element will kick off the loop passing into itself a variable equal to the current value of the global variable. That variable gets passed back and forth between the functions in the loop. Each click of the trigger also increments the global variable so that subsequent calls of the loop have a unique local variable. Then, within the loop, before the next step of each loop is called, it checks to see if the variable it has still matches the global variable. If not, it knows that a new loop has already been activated so it just ends the existing loop. Thoughts on this? Valid solution? Better options? Caveats? Dangers? UPDATE: I'm using John's suggestion below via the clearTimeout option. However, I can't quite get it to work. The logic is as such: var slideNumber = 0; var timeout = null; function startLoop(slideNumber) { ...do stuff here to set up the slide based on slideNumber... slideFadeIn() } function continueCheck(){ if (timeout != null) { // cancel the scheduled task. clearTimeout(timeout); timeout = null; return false; }else{ return true; } }; function slideFadeIn() { if (continueCheck){ // a new loop hasn't been called yet so proceed... // fade in the LI $currentListItem.fadeIn(fade, function() { if(multipleFeatures){ timeout = setTimeout(slideFadeOut,display); } }); }; function slideFadeOut() { if (continueLoop){ // a new loop hasn't been called yet so proceed... slideNumber=slideNumber+1; if(slideNumber==features.length) { slideNumber = 0; }; timeout = setTimeout(function(){startLoop(slideNumber)},100); }; startLoop(slideNumber); The above kicks of the looping. I then have navigation items that, when clicked, I want the above loop to stop, then restart with a new beginning slide: $(myNav).click(function(){ clearTimeout(timeout); timeout = null; startLoop(thisItem); }) If I comment out 'startLoop...' from the click event, it, indeed, stops the initial loop. However, if I leave that last line in, it doesn't actually stop the initial loop. Why? What happens is that both loops seem to run in parallel for a period. So, when I click my navigation, clearTimeout is called, which clears it.

    Read the article

  • Android: who can help me with setting up this google maps class please??

    - by Capsud
    Hi, Firstly this has turned out to be quite a long post so please bear with me as its not too difficult but you may need to clarify something with me if i haven't explained it correctly. So with some help the other day from guys on this forum, i managed to partially set up my 'mapClass' class, but i'm having trouble with it and its not running correctly so i would like some help if possible. I will post the code below so you can see. What Ive got is a 'Dundrum' class which sets up the listView for an array of items. Then ive got a 'dundrumSelector' class which I use to set up the setOnClickListener() methods on the listItems and link them to their correct views. DundrumSelector class.. public static final int BUTTON1 = R.id.anandaAddressButton; public static final int BUTTON2 = R.id.bramblesCafeAddressButton; public static final int BUTTON3 = R.id.brannigansAddressButton; public void onCreate(Bundle savedInstanceState){ super.onCreate(savedInstanceState); int position = getIntent().getExtras().getInt("position"); if(position == 0){ setContentView(R.layout.ananda); }; if(position == 1){ setContentView(R.layout.bramblescafe); }; if(position == 2){ setContentView(R.layout.brannigans); Button anandabutton = (Button) findViewById(R.id.anandaAddressButton); anandabutton.setOnClickListener(new View.OnClickListener() { public void onClick(View view) { Intent myIntent = new Intent(view.getContext(),MapClass.class); myIntent.putExtra("button", BUTTON1); startActivityForResult(myIntent,0); } }); Button bramblesbutton = (Button) findViewById(R.id.bramblesCafeAddressButton); bramblesbutton.setOnClickListener(new View.OnClickListener() { public void onClick(View view) { Intent myIntent = new Intent(view.getContext(),MapClass.class); myIntent.putExtra("button", BUTTON2); startActivityForResult(myIntent, 0); } }); etc etc.... Then what i did was set up static ints to represent the buttons which you can see at the top of this class, the reason for this is because in my mapClass activity I just want to have one method, because the only thing that is varying is the coordinates to each location. ie. i dont want to have 100+ map classes essentially doing the same thing other than different coordinates into the method. So my map class is as follows... case DundrumSelector.BUTTON1: handleCoordinates("53.288719","-6.241179"); break; case DundrumSelector.BUTTON2: handleCoordinates("53.288719","-6.241179"); break; case DundrumSelector.BUTTON3: handleCoordinates("53.288719","-6.241179"); break; } } private void handleCoordinates(String l, String b){ mapView = (MapView) findViewById(R.id.mapView); LinearLayout zoomLayout = (LinearLayout)findViewById(R.id.zoom); View zoomView = mapView.getZoomControls(); zoomLayout.addView(zoomView, new LinearLayout.LayoutParams( LayoutParams.WRAP_CONTENT, LayoutParams.WRAP_CONTENT)); mapView.displayZoomControls(true); mc = mapView.getController(); String coordinates[] = {l, b}; double lat = Double.parseDouble(coordinates[0]); double lng = Double.parseDouble(coordinates[1]); p = new GeoPoint( (int) (lat*1E6), (int) (lng*1E6)); mc.animateTo(p); mc.setZoom(17); mapView.invalidate(); } Now this is where my problem is. The onClick() events don't even work from the listView to get into the correct views. I have to comment out the methods in 'DundrumSelector' before I can get into their views. And this is what I dont understand, firstly why wont the onClick() events work, because its not even on that next view where the map is. I know this is a very long post and it might be quite confusing so let me know if you want any clarification.. Just to recap, what i'm trying to do is just have one class that sets up the map coordinates, like what i'm trying to do in my 'mapClass'. Please can someone help or suggest another way of doing this! Thanks alot everyone for reading this.

    Read the article

  • How to compare a memory bits in C++?

    - by Trunet
    Hi, I need help with a memory bit comparison function. I bought a LED Matrix here with 4 x HT1632C chips and I'm using it on my arduino mega2560. There're no code available for this chipset(it's not the same as HT1632) and I'm writing on my own. I have a plot function that get x,y coordinates and a color and that pixel turn on. Only this is working perfectly. But I need more performance on my display so I tried to make a shadowRam variable that is a "copy" of my device memory. Before I plot anything on display it checks on shadowRam to see if it's really necessary to change that pixel. When I enabled this(getShadowRam) on plot function my display has some, just SOME(like 3 or 4 on entire display) ghost pixels(pixels that is not supposed to be turned on). If I just comment the prev_color if's on my plot function it works perfectly. Also, I'm cleaning my shadowRam array setting all matrix to zero. variables: #define BLACK 0 #define GREEN 1 #define RED 2 #define ORANGE 3 #define CHIP_MAX 8 byte shadowRam[63][CHIP_MAX-1] = {0}; getShadowRam function: byte HT1632C::getShadowRam(byte x, byte y) { byte addr, bitval, nChip; if (x>=32) { nChip = 3 + x/16 + (y>7?2:0); } else { nChip = 1 + x/16 + (y>7?2:0); } bitval = 8>>(y&3); x = x % 16; y = y % 8; addr = (x<<1) + (y>>2); if ((shadowRam[addr][nChip-1] & bitval) && (shadowRam[addr+32][nChip-1] & bitval)) { return ORANGE; } else if (shadowRam[addr][nChip-1] & bitval) { return GREEN; } else if (shadowRam[addr+32][nChip-1] & bitval) { return RED; } else { return BLACK; } } plot function: void HT1632C::plot (int x, int y, int color) { if (x<0 || x>X_MAX || y<0 || y>Y_MAX) return; if (color != BLACK && color != GREEN && color != RED && color != ORANGE) return; char addr, bitval; byte nChip; byte prev_color = HT1632C::getShadowRam(x,y); bitval = 8>>(y&3); if (x>=32) { nChip = 3 + x/16 + (y>7?2:0); } else { nChip = 1 + x/16 + (y>7?2:0); } x = x % 16; y = y % 8; addr = (x<<1) + (y>>2); switch(color) { case BLACK: if (prev_color != BLACK) { // compare with memory to only set if pixel is other color // clear the bit in both planes; shadowRam[addr][nChip-1] &= ~bitval; HT1632C::sendData(nChip, addr, shadowRam[addr][nChip-1]); shadowRam[addr+32][nChip-1] &= ~bitval; HT1632C::sendData(nChip, addr+32, shadowRam[addr+32][nChip-1]); } break; case GREEN: if (prev_color != GREEN) { // compare with memory to only set if pixel is other color // set the bit in the green plane and clear the bit in the red plane; shadowRam[addr][nChip-1] |= bitval; HT1632C::sendData(nChip, addr, shadowRam[addr][nChip-1]); shadowRam[addr+32][nChip-1] &= ~bitval; HT1632C::sendData(nChip, addr+32, shadowRam[addr+32][nChip-1]); } break; case RED: if (prev_color != RED) { // compare with memory to only set if pixel is other color // clear the bit in green plane and set the bit in the red plane; shadowRam[addr][nChip-1] &= ~bitval; HT1632C::sendData(nChip, addr, shadowRam[addr][nChip-1]); shadowRam[addr+32][nChip-1] |= bitval; HT1632C::sendData(nChip, addr+32, shadowRam[addr+32][nChip-1]); } break; case ORANGE: if (prev_color != ORANGE) { // compare with memory to only set if pixel is other color // set the bit in both the green and red planes; shadowRam[addr][nChip-1] |= bitval; HT1632C::sendData(nChip, addr, shadowRam[addr][nChip-1]); shadowRam[addr+32][nChip-1] |= bitval; HT1632C::sendData(nChip, addr+32, shadowRam[addr+32][nChip-1]); } break; } } If helps: The datasheet of board I'm using. On page 7 has the memory mapping I'm using. Also, I have a video of display working.

    Read the article

  • Test of procedure is fine but when called from a menu gives uninitialized errors. C

    - by Delfic
    The language is portuguese, but I think you get the picture. My main calls only the menu function (the function in comment is the test which works). In the menu i introduce the option 1 which calls the same function. But there's something wrong. If i test it solely on the input: (1/1)x^2 //it reads the polinomyal (2/1) //reads the rational and returns 4 (you can guess what it does, calculates the value of an instace of x over a rational) My polinomyals are linear linked lists with a coeficient (rational) and a degree (int) int main () { menu_interactivo (); // instanciacao (); return 0; } void menu_interactivo(void) { int i; do{ printf("1. Instanciacao de um polinomio com um escalar\n"); printf("2. Multiplicacao de um polinomio por um escalar\n"); printf("3. Soma de dois polinomios\n"); printf("4. Multiplicacao de dois polinomios\n"); printf("5. Divisao de dois polinomios\n"); printf("0. Sair\n"); scanf ("%d", &i); switch (i) { case 0: exit(0); break; case 1: instanciacao (); break; case 2: multiplicacao_esc (); break; case 3: somar_pol (); break; case 4: multiplicacao_pol (); break; case 5: divisao_pol (); break; default:printf("O numero introduzido nao e valido!\n"); } } while (i != 0); } When i call it with the menu, with the same input, it does not stop reading the polinomyal (I know this because it does not ask me for the rational as on the other example) I've run it with valgrind --track-origins=yes returning the following: ==17482== Memcheck, a memory error detector ==17482== Copyright (C) 2002-2009, and GNU GPL'd, by Julian Seward et al. ==17482== Using Valgrind-3.5.0 and LibVEX; rerun with -h for copyright info ==17482== Command: ./teste ==17482== 1. Instanciacao de um polinomio com um escalar 2. Multiplicacao de um polinomio por um escalar 3. Soma de dois polinomios 4. Multiplicacao de dois polinomios 5. Divisao de dois polinomios 0. Sair 1 Introduza um polinomio na forma (n0/d0)x^e0 + (n1/d1)x^e1 + ... + (nk/dk)^ek, com ei > e(i+1): (1/1)x^2 ==17482== Conditional jump or move depends on uninitialised value(s) ==17482== at 0x401126: simplifica_f (fraccoes.c:53) ==17482== by 0x4010CB: le_f (fraccoes.c:30) ==17482== by 0x400CDA: le_pol (polinomios.c:156) ==17482== by 0x400817: instanciacao (t4.c:14) ==17482== by 0x40098C: menu_interactivo (t4.c:68) ==17482== by 0x4009BF: main (t4.c:86) ==17482== Uninitialised value was created by a stack allocation ==17482== at 0x401048: le_f (fraccoes.c:19) ==17482== ==17482== Conditional jump or move depends on uninitialised value(s) ==17482== at 0x400D03: le_pol (polinomios.c:163) ==17482== by 0x400817: instanciacao (t4.c:14) ==17482== by 0x40098C: menu_interactivo (t4.c:68) ==17482== by 0x4009BF: main (t4.c:86) ==17482== Uninitialised value was created by a stack allocation ==17482== at 0x401048: le_f (fraccoes.c:19) ==17482== I will now give you the functions which are called void le_pol (pol *p) { fraccao f; int e; char c; printf ("Introduza um polinomio na forma (n0/d0)x^e0 + (n1/d1)x^e1 + ... + (nk/dk)^ek,\n"); printf("com ei > e(i+1):\n"); *p = NULL; do { le_f (&f); getchar(); getchar(); scanf ("%d", &e); if (f.n != 0) *p = add (*p, f, e); c = getchar (); if (c != '\n') { getchar(); getchar(); } } while (c != '\n'); } void instanciacao (void) { pol p1; fraccao f; le_pol (&p1); printf ("Insira uma fraccao na forma (n/d):\n"); le_f (&f); escreve_f(inst_esc_pol(p1, f)); } void le_f (fraccao *f) { int n, d; getchar (); scanf ("%d", &n); getchar (); scanf ("%d", &d); getchar (); assert (d != 0); *f = simplifica_f(cria_f(n, d)); } simplifica_f simplifies a rational and cria_f creates a rationa given the numerator and the denominator Can someone help me please? Thanks in advance. If you want me to provide some tests, just post it. See ya.

    Read the article

  • Is there a better way to avoid an infinite loop using winforms?

    - by Hamish Grubijan
    I am using .Net 3.5 for now. Right now I am using a using trick to disable and enable events around certain sections of code. The user can change either days, hours, minutes or total minutes, and that should not cause an infinite cascade of events (e.g. minutes changing total, total changing minutes, etc.) While the code does what I want, there might be a better / more straight-forward way. Do you know of any? For brawny points: This control will be used by multiple teams - I do not want to make it embarrassing. I suspect that I do not need to reinvent the wheel when defining hours in a day, days in week, etc. Some other standard .Net library out there must have it. Any other remarks regarding code? This using (EventHacker.DisableEvents(this)) business - that must be a common pattern in .Net ... changing the setting temporarily. What is the name of it? I'd like to be able to refer to it in a comment and also read up more on current implementations. In the general case not only a handle to the thing being changed needs to be remembered, but also the previous state (in this case previous state does not matter - events are turned on and off unconditionally). Then there is also a possibility of multi-threaded hacking. One could also utilize generics to make the code arguably cleaner. Figuring all this out can lead to a multi-page blog post. I'd be happy to hear some of the answers. P.S. Does it seem like I suffer from obsessive compulsive disorder? Some people like to get things finished and move on; I like to keep them open ... there is always a better way. // Corresponding Designer class is omitted. using System; using System.Windows.Forms; namespace XYZ // Real name masked { interface IEventHackable { void EnableEvents(); void DisableEvents(); } public partial class PollingIntervalGroupBox : GroupBox, IEventHackable { private const int DAYS_IN_WEEK = 7; private const int MINUTES_IN_HOUR = 60; private const int HOURS_IN_DAY = 24; private const int MINUTES_IN_DAY = MINUTES_IN_HOUR * HOURS_IN_DAY; private const int MAX_TOTAL_DAYS = 100; private static readonly decimal MIN_TOTAL_NUM_MINUTES = 1; // Anything faster than once per minute can bog down our servers. private static readonly decimal MAX_TOTAL_NUM_MINUTES = (MAX_TOTAL_DAYS * MINUTES_IN_DAY) - 1; // 99 days should be plenty. // The value above was chosen so to not cause an overflow exception. // Watch out for it - numericUpDownControls each have a MaximumValue setting. public PollingIntervalGroupBox() { InitializeComponent(); InitializeComponentCustom(); } private void InitializeComponentCustom() { this.m_upDownDays.Maximum = MAX_TOTAL_DAYS - 1; this.m_upDownHours.Maximum = HOURS_IN_DAY - 1; this.m_upDownMinutes.Maximum = MINUTES_IN_HOUR - 1; this.m_upDownTotalMinutes.Maximum = MAX_TOTAL_NUM_MINUTES; this.m_upDownTotalMinutes.Minimum = MIN_TOTAL_NUM_MINUTES; } private void m_upDownTotalMinutes_ValueChanged(object sender, EventArgs e) { setTotalMinutes(this.m_upDownTotalMinutes.Value); } private void m_upDownDays_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void m_upDownHours_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void m_upDownMinutes_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void updateTotalMinutes() { this.setTotalMinutes( MINUTES_IN_DAY * m_upDownDays.Value + MINUTES_IN_HOUR * m_upDownHours.Value + m_upDownMinutes.Value); } public decimal TotalMinutes { get { return m_upDownTotalMinutes.Value; } set { m_upDownTotalMinutes.Value = value; } } public decimal TotalHours { set { setTotalMinutes(value * MINUTES_IN_HOUR); } } public decimal TotalDays { set { setTotalMinutes(value * MINUTES_IN_DAY); } } public decimal TotalWeeks { set { setTotalMinutes(value * DAYS_IN_WEEK * MINUTES_IN_DAY); } } private void setTotalMinutes(decimal nTotalMinutes) { if (nTotalMinutes < MIN_TOTAL_NUM_MINUTES) { setTotalMinutes(MIN_TOTAL_NUM_MINUTES); return; // Must be carefull with recursion. } if (nTotalMinutes > MAX_TOTAL_NUM_MINUTES) { setTotalMinutes(MAX_TOTAL_NUM_MINUTES); return; // Must be carefull with recursion. } using (EventHacker.DisableEvents(this)) { // First set the total minutes this.m_upDownTotalMinutes.Value = nTotalMinutes; // Then set the rest this.m_upDownDays.Value = (int)(nTotalMinutes / MINUTES_IN_DAY); nTotalMinutes = nTotalMinutes % MINUTES_IN_DAY; // variable reuse. this.m_upDownHours.Value = (int)(nTotalMinutes / MINUTES_IN_HOUR); nTotalMinutes = nTotalMinutes % MINUTES_IN_HOUR; this.m_upDownMinutes.Value = nTotalMinutes; } } // Event magic public void EnableEvents() { this.m_upDownTotalMinutes.ValueChanged += this.m_upDownTotalMinutes_ValueChanged; this.m_upDownDays.ValueChanged += this.m_upDownDays_ValueChanged; this.m_upDownHours.ValueChanged += this.m_upDownHours_ValueChanged; this.m_upDownMinutes.ValueChanged += this.m_upDownMinutes_ValueChanged; } public void DisableEvents() { this.m_upDownTotalMinutes.ValueChanged -= this.m_upDownTotalMinutes_ValueChanged; this.m_upDownDays.ValueChanged -= this.m_upDownDays_ValueChanged; this.m_upDownHours.ValueChanged -= this.m_upDownHours_ValueChanged; this.m_upDownMinutes.ValueChanged -= this.m_upDownMinutes_ValueChanged; } // We give as little info as possible to the 'hacker'. private sealed class EventHacker : IDisposable { IEventHackable _hackableHandle; public static IDisposable DisableEvents(IEventHackable hackableHandle) { return new EventHacker(hackableHandle); } public EventHacker(IEventHackable hackableHandle) { this._hackableHandle = hackableHandle; this._hackableHandle.DisableEvents(); } public void Dispose() { this._hackableHandle.EnableEvents(); } } } }

    Read the article

  • How should I delete a child object from within a parent's slot? Possibly boost::asio specific.

    - by kaliatech
    I have written a network server class that maintains a std::set of network clients. The network clients emit a signal to the network server on disconnect (via boost::bind). When a network client disconnects, the client instance needs to be removed from the Set and eventually deleted. I would think this is a common pattern, but I am having problems that might, or might not, be specific to ASIO. I've tried to trim down to just the relevant code: /** NetworkServer.hpp **/ class NetworkServices : private boost::noncopyable { public: NetworkServices(void); ~NetworkServices(void); private: void run(); void onNetworkClientEvent(NetworkClientEvent&); private: std::set<boost::shared_ptr<const NetworkClient>> clients; }; /** NetworkClient.cpp **/ void NetworkServices::run() { running = true; boost::asio::io_service::work work(io_service); //keeps service running even if no operations // This creates just one thread for the boost::asio async network services boost::thread iot(boost::bind(&NetworkServices::run_io_service, this)); while (running) { boost::system::error_code err; try { tcp::socket* socket = new tcp::socket(io_service); acceptor->accept(*socket, err); if (!err) { NetworkClient* networkClient = new NetworkClient(io_service, boost::shared_ptr<tcp::socket>(socket)); networkClient->networkClientEventSignal.connect(boost::bind(&NetworkServices::onNetworkClientEvent, this, _1)); clients.insert(boost::shared_ptr<NetworkClient>(networkClient)); networkClient->init(); //kicks off 1st asynch_read call } } // etc... } } void NetworkServices::onNetworkClientEvent(NetworkClientEvent& evt) { switch(evt.getType()) { case NetworkClientEvent::CLIENT_ERROR : { boost::shared_ptr<const NetworkClient> clientPtr = evt.getClient().getSharedPtr(); // ------ THIS IS THE MAGIC LINE ----- // If I keep this, the io_service hangs. If I comment it out, // everything works fine (but I never delete the disconnected NetworkClient). // If actually deleted the client here I might expect problems because it is the caller // of this method via boost::signal and bind. However, The clientPtr is a shared ptr, and a // reference is being kept in the client itself while signaling, so // I would the object is not going to be deleted from the heap here. That seems to be the case. // Never-the-less, this line makes all the difference, most likely because it controls whether or not the NetworkClient ever gets deleted. clients.erase(clientPtr); //I should probably put this socket clean-up in NetworkClient destructor. Regardless by doing this, // I would expect the ASIO socket stuff to be adequately cleaned-up after this. tcp::socket& socket = clientPtr->getSocket(); try { socket.shutdown(boost::asio::socket_base::shutdown_both); socket.close(); } catch(...) { CommServerContext::error("Error while shutting down and closing socket."); } break; } default : { break; } } } /** NetworkClient.hpp **/ class NetworkClient : public boost::enable_shared_from_this<NetworkClient>, Client { NetworkClient(boost::asio::io_service& io_service, boost::shared_ptr<tcp::socket> socket); virtual ~NetworkClient(void); inline boost::shared_ptr<const NetworkClient> getSharedPtr() const { return shared_from_this(); }; boost::signal <void (NetworkClientEvent&)> networkClientEventSignal; void onAsyncReadHeader(const boost::system::error_code& error, size_t bytes_transferred); }; /** NetworkClient.cpp - onAsyncReadHeader method called from io_service.run() thread as result of an async_read operation. Error condition usually result of an unexpected client disconnect.**/ void NetworkClient::onAsyncReadHeader( const boost::system::error_code& error, size_t bytes_transferred) { if (error) { //Make sure this instance doesn't get deleted from parent/slot deferencing //Alternatively, somehow schedule for future delete? boost::shared_ptr<const NetworkClient> clientPtr = getSharedPtr(); //Signal to service that this client is disconnecting NetworkClientEvent evt(*this, NetworkClientEvent::CLIENT_ERROR); networkClientEventSignal(evt); networkClientEventSignal.disconnect_all_slots(); return; } I believe it's not safe to delete the client from within the slot handler because the function return would be ... undefined? (Interestingly, it doesn't seem to blow up on me though.) So I've used boost:shared_ptr along with shared_from_this to make sure the client doesn't get deleted until all slots have been signaled. It doesn't seem to really matter though. I believe this question is not specific to ASIO, but the problem manifests in a peculiar way when using ASIO. I have one thread executing io_service.run(). All ASIO read/write operations are performed asynchronously. Everything works fine with multiple clients connecting/disconnecting UNLESS I delete my client object from the Set per the code above. If I delete my client object, the io_service seemingly deadlocks internally and no further asynchronous operations are performed unless I start another thread. I have try/catches around the io_service.run() call and have not been able to detect any errors. Questions: Are there best practices for deleting child objects, that are also signal emitters, from within parent slots? Any ideas as to why the io_service is hanging when I delete my network client object?

    Read the article

  • Content Being Echoed Below Footer in Category Post Template

    - by poindexter
    I have created a category template in Wordpress for all posts that are in the 'blog' category. The file name is single-blog.php. There is some conditional code in single.php that checks whether the post is in the 'blog' category and if it is it redirects it to single-blog.php. That seems to be working fine. The problem is that on all the individual 'blog' categorized posts the post title and content are echoed below the footer of the page. I do not know why they are showing up and I haven't been able to stop it or hide it. The Loop is getting closed on the template page, but I'm wondering if the Loop from single.php is somehow also being sent over. You can view an example of the problem here: http://69.20.59.228/2010/03/test-blog-post/ Please let me know if you have any suggestions. I am posting two sections of code below. The first is the conditional call in single.php. The second is the code from the single-blog.php (the category post template). the conditional call in single.php. <?php $post = $wp_query->post; if (in_category('blog')) { include(TEMPLATEPATH.'/single-blog.php'); }?> code from the single-blog.php (the category post template) <?php get_header(); ?> <?php get_sidebar(); ?> <p><h2>The IQNavigator Blog</h2></p> <em><a href="/category/blog">Blog Home</a></em> | <em><a href="/category/blog/feed/">Subscribe via RSS</a></em><p><br></br></p> <?php if (have_posts()) : while (have_posts()) : the_post(); ?> <div <?php post_class() ?> id="post-<?php the_ID(); ?>"> <h1 class="pagetitle"><?php the_title(); ?></h1> <!-- <p class="details">Posted <?php the_time('l, F jS, Y') ?> at <?php the_time() ?></p> --> <div class="entry"> <?php the_content('<p class="serif">Read the rest of this entry &raquo;</p>'); ?> <?php wp_link_pages(array('before' => '<p><strong>Pages:</strong> ', 'after' => '</p>', 'next_or_number' => 'number')); ?> <?php the_tags( '<p>Tags: ', ', ', '</p>'); ?> <p class="postmetadata alt"> <small> -----<br> Posted <?php /* This is commented, because it requires a little adjusting sometimes. You'll need to download this plugin, and follow the instructions: http://binarybonsai.com/wordpress/time-since/ */ /* $entry_datetime = abs(strtotime($post->post_date) - (60*120)); echo time_since($entry_datetime); echo ' ago'; */ ?> on <?php the_time('l, F jS, Y') ?>, filed under <?php the_category(', ') ?>. Follow any responses to this entry through the <?php post_comments_feed_link('RSS'); ?> feed. <?php if ( comments_open() && pings_open() ) { // Both Comments and Pings are open ?> <a href="#respond">Leave your own comment</a>, or <a href="<?php trackback_url(); ?>" rel="trackback">trackback</a> from your own site. <?php } elseif ( !comments_open() && pings_open() ) { // Only Pings are Open ?> Responses are currently closed, but you can <a href="<?php trackback_url(); ?> " rel="trackback">trackback</a> from your own site. <?php } elseif ( comments_open() && !pings_open() ) { // Comments are open, Pings are not ?> You can skip to the end and leave a response. Pinging is currently not allowed. <?php } elseif ( !comments_open() && !pings_open() ) { // Neither Comments, nor Pings are open ?> Both comments and pings are currently closed. <?php } edit_post_link('Edit this entry','','.'); ?> </small> </p> <?php the_tags( '<p>Tagged: ', ', ', '</p>'); ?> </div> </div> <?php comments_template(); ?> <?php endwhile; else: ?> <p>Sorry, no posts matched your criteria.</p> <?php endif; ?> <?php get_footer(); ?>

    Read the article

  • How to programatically read native DLL imports in C#?

    - by Eric
    The large hunk of C# code below is intended to print the imports of a native DLL. I copied it from from this link and modified it very slightly, just to use LoadLibraryEx as Mike Woodring does here. I find that when I call the Foo.Test method with the original example's target, MSCOREE.DLL, it prints all the imports fine. But when I use other dlls like GDI32.DLL or WSOCK32.DLL the imports do not get printed. What's missing from this code that would let it print all the imports as, for example, DUMPBIN.EXE does? (Is there a hint I'm not grokking in the original comment that says, "using mscoree.dll as an example as it doesnt export any thing"?) Here's the extract that just shows how it's being invoked: public static void Test() { // WORKS: var path = @"c:\windows\system32\mscoree.dll"; // NO ERRORS, BUT NO IMPORTS PRINTED EITHER: //var path = @"c:\windows\system32\gdi32.dll"; //var path = @"c:\windows\system32\wsock32.dll"; var hLib = LoadLibraryEx(path, 0, DONT_RESOLVE_DLL_REFERENCES | LOAD_IGNORE_CODE_AUTHZ_LEVEL); TestImports(hLib, true); } And here is the whole code example: namespace PETest2 { [StructLayout(LayoutKind.Explicit)] public unsafe struct IMAGE_IMPORT_BY_NAME { [FieldOffset(0)] public ushort Hint; [FieldOffset(2)] public fixed char Name[1]; } [StructLayout(LayoutKind.Explicit)] public struct IMAGE_IMPORT_DESCRIPTOR { #region union /// <summary> /// CSharp doesnt really support unions, but they can be emulated by a field offset 0 /// </summary> [FieldOffset(0)] public uint Characteristics; // 0 for terminating null import descriptor [FieldOffset(0)] public uint OriginalFirstThunk; // RVA to original unbound IAT (PIMAGE_THUNK_DATA) #endregion [FieldOffset(4)] public uint TimeDateStamp; [FieldOffset(8)] public uint ForwarderChain; [FieldOffset(12)] public uint Name; [FieldOffset(16)] public uint FirstThunk; } [StructLayout(LayoutKind.Explicit)] public struct THUNK_DATA { [FieldOffset(0)] public uint ForwarderString; // PBYTE [FieldOffset(4)] public uint Function; // PDWORD [FieldOffset(8)] public uint Ordinal; [FieldOffset(12)] public uint AddressOfData; // PIMAGE_IMPORT_BY_NAME } public unsafe class Interop { #region Public Constants public static readonly ushort IMAGE_DIRECTORY_ENTRY_IMPORT = 1; #endregion #region Private Constants #region CallingConvention CALLING_CONVENTION /// <summary> /// Specifies the calling convention. /// </summary> /// <remarks> /// Specifies <see cref="CallingConvention.Winapi" /> for Windows to /// indicate that the default should be used. /// </remarks> private const CallingConvention CALLING_CONVENTION = CallingConvention.Winapi; #endregion CallingConvention CALLING_CONVENTION #region IMPORT DLL FUNCTIONS private const string KERNEL_DLL = "kernel32"; private const string DBGHELP_DLL = "Dbghelp"; #endregion #endregion Private Constants [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "GetModuleHandleA"), SuppressUnmanagedCodeSecurity] public static extern void* GetModuleHandleA(/*IN*/ char* lpModuleName); [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "GetModuleHandleW"), SuppressUnmanagedCodeSecurity] public static extern void* GetModuleHandleW(/*IN*/ char* lpModuleName); [DllImport(KERNEL_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "IsBadReadPtr"), SuppressUnmanagedCodeSecurity] public static extern bool IsBadReadPtr(void* lpBase, uint ucb); [DllImport(DBGHELP_DLL, CallingConvention = CALLING_CONVENTION, EntryPoint = "ImageDirectoryEntryToData"), SuppressUnmanagedCodeSecurity] public static extern void* ImageDirectoryEntryToData(void* Base, bool MappedAsImage, ushort DirectoryEntry, out uint Size); } static class Foo { // From winbase.h in the Win32 platform SDK. // const uint DONT_RESOLVE_DLL_REFERENCES = 0x00000001; const uint LOAD_IGNORE_CODE_AUTHZ_LEVEL = 0x00000010; [DllImport("kernel32.dll"), SuppressUnmanagedCodeSecurity] static extern uint LoadLibraryEx(string fileName, uint notUsedMustBeZero, uint flags); public static void Test() { //var path = @"c:\windows\system32\mscoree.dll"; //var path = @"c:\windows\system32\gdi32.dll"; var path = @"c:\windows\system32\wsock32.dll"; var hLib = LoadLibraryEx(path, 0, DONT_RESOLVE_DLL_REFERENCES | LOAD_IGNORE_CODE_AUTHZ_LEVEL); TestImports(hLib, true); } // using mscoree.dll as an example as it doesnt export any thing // so nothing shows up if you use your own module. // and the only none delayload in mscoree.dll is the Kernel32.dll private static void TestImports( uint hLib, bool mappedAsImage ) { unsafe { //fixed (char* pszModule = "mscoree.dll") { //void* hMod = Interop.GetModuleHandleW(pszModule); void* hMod = (void*)hLib; uint size = 0; uint BaseAddress = (uint)hMod; if (hMod != null) { Console.WriteLine("Got handle"); IMAGE_IMPORT_DESCRIPTOR* pIID = (IMAGE_IMPORT_DESCRIPTOR*)Interop.ImageDirectoryEntryToData((void*)hMod, mappedAsImage, Interop.IMAGE_DIRECTORY_ENTRY_IMPORT, out size); if (pIID != null) { Console.WriteLine("Got Image Import Descriptor"); while (!Interop.IsBadReadPtr((void*)pIID->OriginalFirstThunk, (uint)size)) { try { char* szName = (char*)(BaseAddress + pIID->Name); string name = Marshal.PtrToStringAnsi((IntPtr)szName); Console.WriteLine("pIID->Name = {0} BaseAddress - {1}", name, (uint)BaseAddress); THUNK_DATA* pThunkOrg = (THUNK_DATA*)(BaseAddress + pIID->OriginalFirstThunk); while (!Interop.IsBadReadPtr((void*)pThunkOrg->AddressOfData, 4U)) { char* szImportName; uint Ord; if ((pThunkOrg->Ordinal & 0x80000000) > 0) { Ord = pThunkOrg->Ordinal & 0xffff; Console.WriteLine("imports ({0}).Ordinal{1} - Address: {2}", name, Ord, pThunkOrg->Function); } else { IMAGE_IMPORT_BY_NAME* pIBN = (IMAGE_IMPORT_BY_NAME*)(BaseAddress + pThunkOrg->AddressOfData); if (!Interop.IsBadReadPtr((void*)pIBN, (uint)sizeof(IMAGE_IMPORT_BY_NAME))) { Ord = pIBN->Hint; szImportName = (char*)pIBN->Name; string sImportName = Marshal.PtrToStringAnsi((IntPtr)szImportName); // yes i know i am a lazy ass Console.WriteLine("imports ({0}).{1}@{2} - Address: {3}", name, sImportName, Ord, pThunkOrg->Function); } else { Console.WriteLine("Bad ReadPtr Detected or EOF on Imports"); break; } } pThunkOrg++; } } catch (AccessViolationException e) { Console.WriteLine("An Access violation occured\n" + "this seems to suggest the end of the imports section\n"); Console.WriteLine(e); } pIID++; } } } } } Console.WriteLine("Press Any Key To Continue......"); Console.ReadKey(); } }

    Read the article

  • Nodes set of the same type with if-test. Make it less.

    - by Kalinin
    How to make the code more beautiful (compact)? <xsl:template match="part"> <table class="part"> <xsl:if test="name != ''"> <tr> <td>????????</td><td><xsl:value-of select="name"/></td> </tr> </xsl:if> <xsl:if test="model != ''"> <tr> <td>??????</td><td><xsl:value-of select="model"/></td> </tr> </xsl:if> <xsl:if test="year != ''"> <tr> <td>???</td><td><xsl:value-of select="year"/></td> </tr> </xsl:if> <xsl:if test="glass_type != ''"> <tr> <td>???</td><td><xsl:value-of select="glass_type"/></td> </tr> </xsl:if> <xsl:if test="scancode != ''"> <tr> <td>???????</td><td><xsl:value-of select="scancode"/></td> </tr> </xsl:if> <xsl:if test="eurocode != ''"> <tr> <td>???????</td><td><xsl:value-of select="eurocode"/></td> </tr> </xsl:if> <xsl:if test="coment != ''"> <tr> <td>???????????</td><td><xsl:value-of select="coment"/></td> </tr> </xsl:if> <xsl:if test="glass_size != ''"> <tr> <td>??????</td><td><xsl:value-of select="glass_size"/></td> </tr> </xsl:if> <xsl:if test="vendor != ''"> <tr> <td>?????????????</td><td><xsl:value-of select="vendor"/></td> </tr> </xsl:if> <xsl:if test="trademark != ''"> <tr> <td>???????? ?????</td><td><xsl:value-of select="trademark"/></td> </tr> </xsl:if> <xsl:if test="fprice != ''"> <tr> <td>????</td><td><xsl:value-of select="fprice"/></td> </tr> </xsl:if> </table> </xsl:template> Update: i wrote: <my:translations xmlns:my="my:my"> <w e="name" r="????????"/> <w e="model" r="??????"/> <w e="year" r="???"/> <w e="glass_type" r="???"/> <w e="scancode" r="???????"/> <w e="eurocode" r="???????"/> <w e="comment" r="???????????"/> <w e="glass_size" r="??????"/> <w e="vendor" r="?????????????"/> <w e="trademark" r="???????? ?????"/> <w e="fprice" r="????"/> </my:translations> <xsl:value-of select="//w/@r"/> And have no result from this code. Is it normal? And how can i get new element w?

    Read the article

  • C++ converting binary(P5) image to ascii(P2) image (.pgm)

    - by tubby
    I am writing a simple program to convert grayscale binary (P5) to grayscale ascii (P2) but am having trouble reading in the binary and converting it to int. #include <iostream> #include <fstream> #include <sstream> using namespace::std; int usage(char* arg) { // exit program cout << arg << ": Error" << endl; return -1; } int main(int argc, char* argv[]) { int rows, cols, size, greylevels; string filetype; // open stream in binary mode ifstream istr(argv[1], ios::in | ios::binary); if(istr.fail()) return usage(argv[1]); // parse header istr >> filetype >> rows >> cols >> greylevels; size = rows * cols; // check data cout << "filetype: " << filetype << endl; cout << "rows: " << rows << endl; cout << "cols: " << cols << endl; cout << "greylevels: " << greylevels << endl; cout << "size: " << size << endl; // parse data values int* data = new int[size]; int fail_tracker = 0; // find which pixel failing on for(int* ptr = data; ptr < data+size; ptr++) { char t_ch; // read in binary char istr.read(&t_ch, sizeof(char)); // convert to integer int t_data = static_cast<int>(t_ch); // check if legal pixel if(t_data < 0 || t_data > greylevels) { cout << "Failed on pixel: " << fail_tracker << endl; cout << "Pixel value: " << t_data << endl; return usage(argv[1]); } // if passes add value to data array *ptr = t_data; fail_tracker++; } // close the stream istr.close(); // write a new P2 binary ascii image ofstream ostr("greyscale_ascii_version.pgm"); // write header ostr << "P2 " << rows << cols << greylevels << endl; // write data int line_ctr = 0; for(int* ptr = data; ptr < data+size; ptr++) { // print pixel value ostr << *ptr << " "; // endl every ~20 pixels for some readability if(++line_ctr % 20 == 0) ostr << endl; } ostr.close(); // clean up delete [] data; return 0; } sample image - Pulled this from an old post. Removed the comment within the image file as I am not worried about this functionality now. When compiled with g++ I get output: $> ./a.out a.pgm filetype: P5 rows: 1024 cols: 768 greylevels: 255 size: 786432 Failed on pixel: 1 Pixel value: -110 a.pgm: Error The image is a little duck and there's no way the pixel value can be -110...where am I going wrong? Thanks.

    Read the article

  • I have this broken php upload script

    - by Anders Kitson
    I have this script for uploading a image and content from a form, it works in one project but not the other. I have spent a good few hours trying to debug it, I am hoping someone could point out the issue I might be having. Where there are comments is where I have tried to debug. The first error I got was the "echo invalid file" at the beginning of the last comment. With these specific areas commented out the upload name and type that I am supposed to be grabbing from the form is not being echoed, I am thinking this is where the error is occurring, but can't quite seem to find it. Thanks. <?php include("../includes/connect.php"); /* if ((($_FILES["file"]["type"] == "image/gif") || ($_FILES["file"]["type"] == "image/jpeg") || ($_FILES["file"]["type"] == "image/pjpeg")) && ($_FILES["file"]["size"] < 2000000)) { */ if ($_FILES["file"]["error"] > 0) { echo "Return Code: " . $_FILES["file"]["error"] . "<br />"; } else { echo "Upload: " . $_FILES["file"]["name"] . "<br />"; echo "Type: " . $_FILES["file"]["type"] . "<br />"; echo "Size: " . ($_FILES["file"]["size"] / 1024) . " Kb<br />"; echo "Temp file: " . $_FILES["file"]["tmp_name"] . "<br />"; /* GRAB FORM DATA */ $title = $_POST['title']; $date = $_POST['date']; $content = $_POST['content']; $imageName1 = $_FILES["file"]["name"]; echo $title; echo "<br/>"; echo $date; echo "<br/>"; echo $content; echo "<br/>"; echo $imageName1; $sql = "INSERT INTO blog (title,date,content,image)VALUES( \"$title\", \"$date\", \"$content\", \"$imageName1\" )"; $results = mysql_query($sql)or die(mysql_error()); echo "<br/>"; if (file_exists("../images/blog/" . $_FILES["file"]["name"])) { echo $_FILES["file"]["name"] . " already exists. "; } else { move_uploaded_file($_FILES["file"]["tmp_name"], "../images/blog/" . $_FILES["file"]["name"]); echo "Stored in: " . "../images/blog/" . $_FILES["file"]["name"]; } } /* } else { echo "Invalid file" . "<br/>"; echo "Type: " . $_FILES["file"]["type"] . "<br />"; } */ //lets create a thumbnail of this uploaded image. /* $fileName = $_FILES["file"]["name"]; createThumb($fileName,310,"../images/blog/thumbs/"); function createThumb($thisFileName, $thisThumbWidth, $thisThumbDest){ $thisOriginalFilePath = "../images/blog/". $thisFileName; list($width, $height) = getimagesize($thisOriginalFilePath); $imgRatio =$width/$height; $thisThumbHeight = $thisThumbWidth/$imgRatio; $thumb = imagecreatetruecolor($thisThumbWidth,$thisThumbHeight); $source = imagecreatefromjpeg($thisOriginalFilePath); imagecopyresampled($thumb, $source, 0, 0, 0, 0, $thisThumbWidth,$thisThumbHeight, $width, $height); $newFileName = $thisThumbDest.$thisFileName; imagejpeg($thumb,$newFileName, 80); echo "<p><img src=\"$newFileName\" /></p>"; //header("location: http://www.google.ca"); } */ ?>

    Read the article

  • Find inner arrays in nested arrays

    - by 50ndr33
    I have a nested array in PHP: array ( '0' => "+5x", '1' => array ( '0' => "+", '1' => "(", '2' => "+3", '3' => array ( '0' => "+", '1' => "(", '2' => array ( // I want to find this one. '0' => "+", '1' => "(", '2' => "+5", '3' => "-3", '4' => ")" ), '3' => "-3", '4' => ")" ), '4' => ")" ) ); I need to process the innermost arrays here, the one with the comment: "I want to find this one." Is there a function for that? I have thought about doing (written as an idea, not as correct PHP): foreach ($array as $id => $value) { if ($value is array) { $name = $id; foreach ($array[$id] as $id_2 => $value_2) { if ($value_2 is array) { $name .= "." . $id_2; foreach ($array[$id][$id_2] as $id_3 => $value_3) { if ($value_3 is array) { $name .= "." . $id_3; foreach ($array[$id][$id_2][$id_3] as $id_4 => $value_4) { if ($value_4 is array) { $name .= "." . $id_4; foreach [and so it goes on]; } else { $listOfInnerArrays[] = $name; break; } } } else { $listOfInnerArrays[] = $name; break; } } } else { $listOfInnerArrays[] = $name; break; } } } } So what it does is it makes $name the current key in the array. If the value is an array, it goes into it with foreach and adds "." and the id of the array. So we would in the example array end up with: array ( '0' => "1.3.2", ) Then I can process those values to access the innner arrays. The problem is that the array that I'm trying to find the inner arrays of is dynamic and made of a user input. (It splits an input string where it finds + or -, and puts it in a separate nested array if it contains brackets. So if the user types a lot of brackets, there will be a lot of nested arrays.) Therefore I need to make this pattern go for 20 times down, and still it will only catch 20 nested arrays no matter what. Is there a function for that, again? Or is there a way to make it do this without my long code? Maybe make a loop make the necessary number of the foreach pattern and run it through eval()? Long answer to J. Bruni: <?php $liste = array ( '0' => "+5x", '1' => array ( '0' => "+", '1' => "(", '2' => "+3", '3' => array ( '0' => "+", '1' => "(", '2' => array ( '0' => "+", '1' => "(", '2' => "+5", '3' => "-3", '4' => ")" ), '3' => "-3", '4' => ")" ), '4' => ")" ) ); function find_deepest( $item, $key ) { echo "0"; if ( !is_array( $item ) ) return false; foreach( $item as $sub_item ) { if ( is_array( $sub_item ) ) return false; } echo "1"; print_r( $item ); return true; } array_walk_recursive( $liste, 'find_deepest' ); echo "<pre>"; print_r($liste); ?> I wrote echo 0 and 1 to see what the script did, and here is the output: 00000000000000 Array ( [0] => +5x [1] => Array ( [0] => + [1] => ( [2] => +3 [3] => Array ( [0] => + [1] => ( [2] => Array ( [0] => + [1] => ( [2] => +5 [3] => -3 [4] => ) ) [3] => -3 [4] => ) ) [4] => ) ) )

    Read the article

  • PHP: How to automate building a 100 <UL>/<LI> menuitems, while keeping the Menu Structure File Flat / Simply Managable?

    - by Sam
    Above: current "stupid" menu. (entire ul/li menu for javascript menu system) + (some li lines as page-specific submenu) Hi folks! With passion for automation and elegancy, but limited knowledge/knowhow, im stuck with "my hands in my hair" as we Dutch say, for my current menu system works perfectly, but is a pain in the a*s to update! So, i would appreciate it greatly, if you can suggest how to automate this in php: how to let the php generate the html menu code basing on a flat menu input file with TABS indented. OLD SITUATION <ul> <!-- about 100 of these <li>....</li> lines --> <li><a href="carrot.php"><p class="mnu" style="background-position:0 -820px"><? echo __("carrot juice") ?></p></a></li> <!-- lots of data, with only little bit thats really the menu itself--> </ul a javascript file reads a ul/li structure as input to build menu of format in that ul/li, the items with a hyperlink and sprite-bg position represent webpages, (inside LI) while items without hyperlink and sprite-bg are just headers of that menusection, (inside H6) to highlight the current page in the menu, the javascript menumaker uses an id number. this number corresponds to the consequtive li that is a webpage, skips h6 headers correctly. these h6 headers are only there for when importing sections of the same menu as submenu. non-li headers are not shown in menu, nore counted by the javascript menu for their ID. to know which page should be shown, i have to count from ID 0, the li items till finding the current webpage in the li structure and then manually put it in each webpage! BUT: changing an item in li order, means stupidly re-counting their entire li again! each webpage has an icon (= sprite bg-position numer), which is also used in the webpage. INTENDED RESULT I dream of, once setting what the current webpage is (e.g carrot.php) the menu system automatically "finds" and "counts" the li's and returns the id nr (for proper highlight of main menu); generates the entire menu html, and depending on which headings are set for submenu, (e.g. meals, drinks) generates those submenu (entire section below each given header); ginally adds h5 highlight inside the li of that submenu item. For the menu, i wish an easily readable, simple plain txt menu that is indented with tabs, (each tab is one depth for example) and further tabs follow for url and sprite position of icon. MY DREAM MENU-MANAGEMENT FILE |>TAB SEPARATED/INDENTED FLATMENU FILE |MUST BE CALCULATED BY PHP: |>MENUTEXT============URL=============SPRITE=====|ID===TAG================== |>about "#" -520 |00 li |> INFORMATION |—— h6 |> physical state "physical.php" -920 |01 li |> mental health "mental.php" -10 |02 li |> |>apetite "#" -1290 |03 li |> meals "#" -600 |04 li |> COLD MEAL |—— h6 |> egg salade "salad.php" -1040 |05 li |> salmon fish "salmon.php" -540 |06 li |> HOT MEAL |—— h6 |> spare ribs "spareribs.php" -120 |07 li |> di macaroni "macaroni.php" -870 |08 li |> |> drinks "#" -230 |09 li |> JUCY DRINK |—— h6 |> carrot juice "carrot.php" -820 |10 li |> mango hive "mango.php" -270 |11 li DESIRED CHRONOLOGY php outputs the entire ul/li html so the javascript can show the menu: webpage items go inside li tags, and header items go inside h6 tags, e.g. <h6>JUCY DRINK</h6> Each website page has a url filename [eg: salad.php]. Based on this given fact, the php menu generator detects the pagename, gives the IDnr of the position of that page according to the li-item nr and sets variable for javascript to highlight current menu item. the menu items below the specified headers are loaded as submenu in which the current page.php is wrapped inside h5 to highlight current page in submenu: e.g. (<li><h5><a href="carrot.php"><p>..etc..</p></h5></li> Question Which methods / steps / (chronological)ways are there for doing this? I am no good in php programming, but am learning it so please dont write any code without a line of comment why I should use that method etc. Where do I start? If I am unclear in my question, please ask. Thanks. Much appreciated!! Concrete Task List from the provided Comments/Answers, sofar: (RobertB) First, get some PHP code working that can read through a tab-delimited file and put the data into an appropriate data structure. NOW WORKING AT THIS

    Read the article

  • why i am getting popup message when I am tryiing to update user.

    - by kumar
    I am getting Popup mesage something like You have chosen to open Update which is a:application/json From : http://localhost:1234 which ok cancel buttons.. I am using this code to run.. [HttpPost] public JsonResult MEdit(ExpenseBE e) { var cache = CacheFactory.GetCacheManager(); string F_ACTION = "U"; string F_DEBUG = "Y"; var excUpdateStatus = false; for (int i = 0; i <= cache.Count; i++) { var x = (ExpenseBE)cache.GetData("a" + i); if (x != null) { string Resolutioncode = e.Exception.ResolutionCode; string reasoncode = e.Exception.ReasonCode; string actioncode = e.Exception.ActionCode; e.Exception.ExceptionID = x.Exception.ExceptionID; e.Exception.ReasonCode = reasoncode; e.Exception.ReasonCode = Resolutioncode; e.Exception.ActionCode = actioncode; e.Exception.Sequence = x.Exception.Sequence; e.Exception.FollowupDate = x.Exception.FollowupDate; e.Exception.IOL = x.Exception.IOL; e.Exception.LastUpdateUser = User.Identity.Name.ToUpper().Remove(0, 4); excUpdateStatus = common.UpdateException(e.Exception, F_ACTION, F_DEBUG); } } return Json(excUpdateStatus.ToString()); } and my view is <%@ Control Language="C#" Inherits="System.Web.Mvc.ViewUserControl<NorthernTrust.ATP.iTool.Core.Business.Entities.Specialist.ExpenseBE>" %> <% using (Html.BeginForm("MEdit", "expense", FormMethod.Post)) { %> <%= Html.ValidationSummary(true)%> <fieldset class="clearfix" id="fieldset-exception"> <legend>Mass Edit Exception Information</legend> <div class="fiveper"> <label for="ExceptionStatus"> Status: <span> </span> </label> <label for="ResolutionCode"> Resolution: <span> <%=Html.DropDownListFor(model=>model.Exception.ResolutionCode,new SelectList(Model.LookupCodes["C_EXCPT_RESL"], "Key", "Value"))%> </span> </label> <label for="ReasonCode"> Reason: <span><%=Html.DropDownListFor(model => model.Exception.ReasonCode, new SelectList(Model.LookupCodes["C_EXCPT_RSN"], "Key", "Value"))%></span> </label> <label for="ExceptionStatus"> Action Taken: <span><%=Html.DropDownListFor(model => model.Exception.ActionCode, new SelectList(Model.LookupCodes["C_EXCPT_ACT"], "Key", "Value"))%></span> </label> </div> <div class="fiveper"> <label for="FollowupDate"> Follow-up: <span><input type="text" id="exc-flwup-" /></span> <%--<%=Html.EditorFor(model=>model.Exception.FollowupDate) %>--%> </label> <label for="IOL"> Inquiry #: <%=Html.TextBox("Inquiery", ViewData["inq"] ?? "")%> </label> <label>Comment</label> <span> <%=Html.TextArea("value") %> <%=Html.ValidationMessage("value")%> </span> </div> <br /> <br /> <div> <button id="btnSelect" class="button">Select All</button> <button id="btnCancel" class="button">Cancel</button> <input type="submit" class="button" value="Save" /> </div> </fieldset> <% } %> <script type="text/javascript"> $(document).ready(function() { $('#btnSelectAll').click(function() { function validate_excpt(formData, jqForm, options) { var form = jqForm[0]; } $('#btnSelect').click(function() { $('#input [type=checkbox]').attr('checked', 'checked'); }); // post-submit callback function showResponse(responseText, statusText, xhr, $form) { if ('success' == statusText) { $('#error-msg span:last').html('<strong>Update successful.</strong>'); } else { $('#error-msg span:last').html('<strong>Update failed.</strong> ' + responseText); } $('#error-msg').removeClass('hide'); } $('#exc').ajaxForm({ target: '#error-msg', beforeSubmit: validate_excpt, success: showResponse, dataType: 'json' }); $('.button').button(); }); $('.button').button(); $("input[id^='exc-flwup-']").datepicker({ duration: '', showTime: true, constrainInput: true, stepMinutes: 30, stepHours: 1, altTimeField: '', time24h: true, minDate: 0 }); $('#ui-timepicker-div').bgiframe(); }); </script> please correct me if i am doing somwhere wrong? thanks

    Read the article

  • Need help getting DIV inside DIV to stretch to width of contents in Firefox

    - by bj.
    I am using a layout similar to the one from Dynamic Drive here: http://www.dynamicdrive.com/style/layouts/item/css-right-frame-layout/ The main content area (white) has overflow set to auto. I have given the innerTube inside this main content area a border. However if the contents within this innerTube are greater than the width of the main content area, a horizontal scroll bar will appear as expected, but in Firefox these contents will 'overlap' the border and go off screen (can be retrieved by scrolling horizontally). In other words, the right hand border remains in place, and the content just goes over the op of it, and disappears behind the right hand column. In IE it behaves exactly as I want - the content pushes the border off screen to be visible only once you scroll over there. I guess the easiest thing is to paste the source code here. If you copy it into a blank file you'll see what I mean. I've just used one really long word to replicate what happens if a wide image is there instead. Thanks in advance to anyone who can help me out. <!--Force IE6 into quirks mode with this comment tag--> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <style type="text/css"> body{ margin: 0; padding: 0; border: 0; overflow: hidden; height: 100%; max-height: 100%; } #framecontent{ position: absolute; top: 0; bottom: 0; right: 0; width: 200px; /*Width of frame div*/ height: 100%; overflow: hidden; /*Disable scrollbars. Set to "scroll" to enable*/ background: #cccccc; color: white; } #maincontent{ position: fixed; top: 0; left: 0; right: 200px; /*Set right value to WidthOfFrameDiv*/ bottom: 0; overflow: auto; background: #fff; } .innertube{ margin: 15px; /*Margins for inner DIV inside each DIV (to provide padding)*/ } .innertubeWithBorder { margin: 15px; border: solid 1px #666666; } * html body{ /*IE6 hack*/ padding: 0 200px 0 0; /*Set value to (0 WidthOfFrameDiv 0 0)*/ } * html #maincontent{ /*IE6 hack*/ height: 100%; width: 100%; } </style> </head> <body> <div id="framecontent"> <div class="innertube"> <h1>CSS Right Frame Layout</h1> <h3>Sample text here</h3> </div> </div> <div id="maincontent"> <div class="innertubeWithBorder"> <h1>Dynamic Drive CSS Library</h1> <p>AReallyLongWordWhichIsSimilarToHavingAnImageWithWidthGreaterThanTheWidthOfThisDivToShowOverFlowProblemWithBorderSoIfYouResizeThisWindowNarrowerYouWillSeeWhatIMeanWorksFineInIEButNotFirefox</p> <p>So I want that border over there ------> to dissappear behind the right hand column like it does in IE, and be visible once you use the scrollbar below and scroll to the right</p> <p style="text-align: center">Credits: <a href="http://www.dynamicdrive.com/style/">Dynamic Drive CSS Library</a></p> </div> </div> </body> </html>

    Read the article

  • Php mail pulling form data from previous page

    - by Mark
    So I have a form being filled out on one php like so: <p> <label for="first_name">First Name: </label> <input type="text" size="30" name="first_name" id="first_name"/> </p> <p> <label for="last_name"> Last Name:</label> <input type="text" size="30" name="last_name" id="last_name"/> </p> <p> <label for="address_street">Street:</label> <input type="text" size="30" name="address_street" id="address_street"/> </p> <p> <label for="address_city">City:</label> <input type="text" size="30" name="address_city" id="address_city"/> </p> <p> <label for="address_state">State/Province:</label> <input type="text" size="30" name="address_state" id="address_state"/> </p> <p> <label for="email">Your e-mail: </label> <input type="text" size="30" name="email" id="email"/> </p> <p> <label for="phone">Your phone number: </label> <input type="text" size="30" name="phone" id="phone"/> </p> This is on one php page. From here, it goes to another php which part of it contains script to send a html email to recipient. Problem is, I cannot seem to get it to pull the variables even though I thought I declared them correctly and mixed them into the html correctly. <?php $first_name = $_POST['first_name']; $last_name = $_POST['last_name']; $to = "[email protected], [email protected]"; $subject = "HTML email for ALPS"; $message .= ' <html> <body> <div style="display: inline-block; width: 28%; float: left;"> <img src="http://englishintheusa.com/images/alps-logo.jpg" alt="ALPS Language School" /> </div> <div style="display: inline-block; width: 68%; float: right;"> <p style="color: #4F81BD; font-size: 20px; text-decoration: underline;">Thanks You For Your Inquiry!</p> </div> <div style="padding-left: 20px; color: #666666; font-size: 16.8px; clear: both;"> <p>Dear $first_name $last_name ,</p> </br > <p>Thank you for the following inquiry:</p> </br > </br > </br > </br > <p>****Comment goes here****</p> </br > </br > <p>We will contact you within 2 business days. Our office is open Monday-Friday, 8:30 AM - 5:00 PM Pacific Standard Time.</p> </br > <p>Thank you for your interest!</p> </br > </br > <p>Best Regards,</p> </br > </br > <p>ALPS Language School</p> </br > </br > <p>430 Broadway East</p> <p>Seattle WA 98102</p> <p>Phone: 206.720.6363</p> <p>Fax: 206. 720.1806</p> <p>Email: [email protected]</p> </div> </body> </html>'; // Always set content-type when sending HTML email $headers .= "MIME-Version: 1.0" . "\r\n"; $headers .= "Content-type:text/html;charset=UTF-8" . "\r\n"; // More headers mail($to,$subject,$message,$headers); ?> So you see where I am trying to get first_name and last_name. Well it doesn't come out correctly. Can someone help here?

    Read the article

  • Json / Jsonp not connecting to php (Phonegap + jquerymobile)

    - by Madhulika Mukherjee
    I am trying to make - an android WEB application with phonegap layout with JqueryMobile What Im doing - An html form that takes ID, name, and address as input 'Serialize's this data using ajax makes a json object out of it Should send it to a file called 'connection.php' Where, this data is put into a database (MySql) Other details - My server is localhost, Im using xampp I have already created a database and table using phpmyadmin The problem - My html file, where my json object is created, does not connect to the php file which is hosted by my localhost Here is my COMPLETE html file: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01//EN" "http://www.w3.org/TR/html4/strict.dtd"> <html> <head> <!-- Change this if you want to allow scaling --> <meta name="viewport" content="width=default-width; user-scalable=no" /> <meta http-equiv="Content-type" content="text/html;charset=utf-8"> <title>Trial app</title> <link rel="stylesheet" href="thestylesheet.css" type="text/css"> <script type="text/javascript" charset="utf-8" src="javascript1.js"></script> <script type="text/javascript" charset="utf-8" src="javascript2.js"></script> <script type="text/javascript" charset="utf-8" src="cordova-1.8.0.js"></script> <script> $(document).ready(function () { $("#btn").click( function() { alert('hello hello'); $.ajax({ url: "connection.php", type: "POST", data: { id: $('#id').val(), name: $('#name').val(), Address: $('#Address').val() }, datatype: "json", success: function (status) { if (status.success == false) { alert("Failure!"); } else { alert("Success!"); } } }); }); }); </script> </head> <body> <div data-role="header"> <h1>Heading of the app</h1> </div><!-- /header --> <div data-role="content"> <form id="target" method="post"> <label for="id"> <input type="text" id="id" placeholder="ID"> </label> <label for="name"> <input type="text" id="name" placeholder="Name"> </label> <label for="Address"> <input type="text" id="Address" placeholder="Address"> </label> <div id="btn" data-role="button" data-icon="star" data-theme="e">Add record</div> <!--<input type="submit" value="Add record" data-icon="star" data-theme="e"> --> </form> </div> </body> </html> And here is my 'connection.php' hosted by my localhost <?php header('Content-type: application/json'); $server = "localhost"; $username = "root"; $password = ""; $database = "jqueryex"; $con = mysql_connect($server, $username, $password); if($con) { echo "Connected to database!"; } else { echo "Could not connect!"; } //or die ("Could not connect: " . mysql_error()); mysql_select_db($database, $con); /* CREATE TABLE `sample` ( `id` int(11) unsigned NOT NULL AUTO_INCREMENT, `name` varchar(45) DEFAULT NULL, `Address` varchar(45) DEFAULT NULL, PRIMARY KEY (`id`) ) */ $id= json_decode($_POST['id']); $name = json_decode($_POST['name']); $Address = json_decode($_POST['Address']); $sql = "INSERT INTO sample (id, name, Address) "; $sql .= "VALUES ($id, '$name', '$Address')"; if (!mysql_query($sql, $con)) { die('Error: ' . mysql_error()); } else { echo "Comment added"; } mysql_close($con); ?> My doubts: No entry is made in my table 'sample' when i view it in phpmyadmin So obviously, i see no success messages either I dont get any errors, not from ajax and neither from the php file. Stuff Im suspecting: Should i be using jsonp instead of json? Im new to this. Is there a problem with my php file? Perhaps I need to include some more javascript files in my html file? I assume this is a very simple problem so please help me out! I think there is just some conceptual error, as i have only just started with jquery, ajax, and json. Thank you.

    Read the article

  • Why SELECT N + 1 with no foreign keys and LINQ?

    - by Daniel Flöijer
    I have a database that unfortunately have no real foreign keys (I plan to add this later, but prefer not to do it right now to make migration easier). I have manually written domain objects that map to the database to set up relationships (following this tutorial http://www.codeproject.com/Articles/43025/A-LINQ-Tutorial-Mapping-Tables-to-Objects), and I've finally gotten the code to run properly. However, I've noticed I now have the SELECT N + 1 problem. Instead of selecting all Product's they're selected one by one with this SQL: SELECT [t0].[id] AS [ProductID], [t0].[Name], [t0].[info] AS [Description] FROM [products] AS [t0] WHERE [t0].[id] = @p0 -- @p0: Input Int (Size = -1; Prec = 0; Scale = 0) [65] Controller: public ViewResult List(string category, int page = 1) { var cat = categoriesRepository.Categories.SelectMany(c => c.LocalizedCategories).Where(lc => lc.CountryID == 1).First(lc => lc.Name == category).Category; var productsToShow = cat.Products; var viewModel = new ProductsListViewModel { Products = productsToShow.Skip((page - 1) * PageSize).Take(PageSize).ToList(), PagingInfo = new PagingInfo { CurrentPage = page, ItemsPerPage = PageSize, TotalItems = productsToShow.Count() }, CurrentCategory = cat }; return View("List", viewModel); } Since I wasn't sure if my LINQ expression was correct I tried to just use this but I still got N+1: var cat = categoriesRepository.Categories.First(); Domain objects: [Table(Name = "products")] public class Product { [Column(Name = "id", IsPrimaryKey = true, IsDbGenerated = true, AutoSync = AutoSync.OnInsert)] public int ProductID { get; set; } [Column] public string Name { get; set; } [Column(Name = "info")] public string Description { get; set; } private EntitySet<ProductCategory> _productCategories = new EntitySet<ProductCategory>(); [System.Data.Linq.Mapping.Association(Storage = "_productCategories", OtherKey = "productId", ThisKey = "ProductID")] private ICollection<ProductCategory> ProductCategories { get { return _productCategories; } set { _productCategories.Assign(value); } } public ICollection<Category> Categories { get { return (from pc in ProductCategories select pc.Category).ToList(); } } } [Table(Name = "products_menu")] class ProductCategory { [Column(IsPrimaryKey = true, Name = "products_id")] private int productId; private EntityRef<Product> _product = new EntityRef<Product>(); [System.Data.Linq.Mapping.Association(Storage = "_product", ThisKey = "productId")] public Product Product { get { return _product.Entity; } set { _product.Entity = value; } } [Column(IsPrimaryKey = true, Name = "products_types_id")] private int categoryId; private EntityRef<Category> _category = new EntityRef<Category>(); [System.Data.Linq.Mapping.Association(Storage = "_category", ThisKey = "categoryId")] public Category Category { get { return _category.Entity; } set { _category.Entity = value; } } } [Table(Name = "products_types")] public class Category { [Column(Name = "id", IsPrimaryKey = true, IsDbGenerated = true, AutoSync = AutoSync.OnInsert)] public int CategoryID { get; set; } private EntitySet<ProductCategory> _productCategories = new EntitySet<ProductCategory>(); [System.Data.Linq.Mapping.Association(Storage = "_productCategories", OtherKey = "categoryId", ThisKey = "CategoryID")] private ICollection<ProductCategory> ProductCategories { get { return _productCategories; } set { _productCategories.Assign(value); } } public ICollection<Product> Products { get { return (from pc in ProductCategories select pc.Product).ToList(); } } private EntitySet<LocalizedCategory> _LocalizedCategories = new EntitySet<LocalizedCategory>(); [System.Data.Linq.Mapping.Association(Storage = "_LocalizedCategories", OtherKey = "CategoryID")] public ICollection<LocalizedCategory> LocalizedCategories { get { return _LocalizedCategories; } set { _LocalizedCategories.Assign(value); } } } [Table(Name = "products_types_localized")] public class LocalizedCategory { [Column(Name = "id", IsPrimaryKey = true, IsDbGenerated = true, AutoSync = AutoSync.OnInsert)] public int LocalizedCategoryID { get; set; } [Column(Name = "products_types_id")] private int CategoryID; private EntityRef<Category> _Category = new EntityRef<Category>(); [System.Data.Linq.Mapping.Association(Storage = "_Category", ThisKey = "CategoryID")] public Category Category { get { return _Category.Entity; } set { _Category.Entity = value; } } [Column(Name = "country_id")] public int CountryID { get; set; } [Column] public string Name { get; set; } } I've tried to comment out everything from my View, so nothing there seems to influence this. The ViewModel is as simple as it looks, so shouldn't be anything there. When reading this ( http://www.hookedonlinq.com/LinqToSQL5MinuteOVerview.ashx) I started suspecting it might be because I have no real foreign keys in the database and that I might need to use manual joins in my code. Is that correct? How would I go about it? Should I remove my mapping code from my domain model or is it something that I need to add/change to it? Note: I've stripped parts of the code out that I don't think is relevant to make it cleaner for this question. Please let me know if something is missing.

    Read the article

  • Transferring data from 2d Dynamic array in C to CUDA and back

    - by Soumya
    I have a dynamically declared 2D array in my C program, the contents of which I want to transfer to a CUDA kernel for further processing. Once processed, I want to populate the dynamically declared 2D array in my C code with the CUDA processed data. I am able to do this with static 2D C arrays but not with dynamically declared C arrays. Any inputs would be welcome! I mean the dynamic array of dynamic arrays. The test code that I have written is as below. #include "cuda_runtime.h" #include "device_launch_parameters.h" #include <stdio.h> #include <conio.h> #include <math.h> #include <stdlib.h> const int nItt = 10; const int nP = 5; __device__ int d_nItt = 10; __device__ int d_nP = 5; __global__ void arr_chk(float *d_x_k, float *d_w_k, int row_num) { int index = (blockIdx.x * blockDim.x) + threadIdx.x; int index1 = (row_num * d_nP) + index; if ( (index1 >= row_num * d_nP) && (index1 < ((row_num +1)*d_nP))) //Modifying only one row data pertaining to one particular iteration { d_x_k[index1] = row_num * d_nP; d_w_k[index1] = index; } } float **mat_create2(int r, int c) { float **dynamicArray; dynamicArray = (float **) malloc (sizeof (float)*r); for(int i=0; i<r; i++) { dynamicArray[i] = (float *) malloc (sizeof (float)*c); for(int j= 0; j<c;j++) { dynamicArray[i][j] = 0; } } return dynamicArray; } /* Freeing memory - here only number of rows are passed*/ void cleanup2d(float **mat_arr, int x) { int i; for(i=0; i<x; i++) { free(mat_arr[i]); } free(mat_arr); } int main() { //float w_k[nItt][nP]; //Static array declaration - works! //float x_k[nItt][nP]; // if I uncomment this dynamic declaration and comment the static one, it does not work..... float **w_k = mat_create2(nItt,nP); float **x_k = mat_create2(nItt,nP); float *d_w_k, *d_x_k; // Device variables for w_k and x_k int nblocks, blocksize, nthreads; for(int i=0;i<nItt;i++) { for(int j=0;j<nP;j++) { x_k[i][j] = (nP*i); w_k[i][j] = j; } } for(int i=0;i<nItt;i++) { for(int j=0;j<nP;j++) { printf("x_k[%d][%d] = %f\t",i,j,x_k[i][j]); printf("w_k[%d][%d] = %f\n",i,j,w_k[i][j]); } } int size1 = nItt * nP * sizeof(float); printf("\nThe array size in memory bytes is: %d\n",size1); cudaMalloc( (void**)&d_x_k, size1 ); cudaMalloc( (void**)&d_w_k, size1 ); if((nP*nItt)<32) { blocksize = nP*nItt; nblocks = 1; } else { blocksize = 32; // Defines the number of threads running per block. Taken equal to warp size nthreads = blocksize; nblocks = ceil(float(nP*nItt) / nthreads); // Calculated total number of blocks thus required } for(int i = 0; i< nItt; i++) { cudaMemcpy( d_x_k, x_k, size1,cudaMemcpyHostToDevice ); //copy of x_k to device cudaMemcpy( d_w_k, w_k, size1,cudaMemcpyHostToDevice ); //copy of w_k to device arr_chk<<<nblocks, blocksize>>>(d_x_k,d_w_k,i); cudaMemcpy( x_k, d_x_k, size1, cudaMemcpyDeviceToHost ); cudaMemcpy( w_k, d_w_k, size1, cudaMemcpyDeviceToHost ); } printf("\nVerification after return from gpu\n"); for(int i = 0; i<nItt; i++) { for(int j=0;j<nP;j++) { printf("x_k[%d][%d] = %f\t",i,j,x_k[i][j]); printf("w_k[%d][%d] = %f\n",i,j,w_k[i][j]); } } cudaFree( d_x_k ); cudaFree( d_w_k ); cleanup2d(x_k,nItt); cleanup2d(w_k,nItt); getch(); return 0;

    Read the article

< Previous Page | 574 575 576 577 578 579 580 581 582 583 584 585  | Next Page >