Search Results

Search found 93060 results on 3723 pages for 'lines of code'.

Page 58/3723 | < Previous Page | 54 55 56 57 58 59 60 61 62 63 64 65  | Next Page >

  • Google Jam 2009. C. Welcome to Code Jam. Can't understand Dynamic programming

    - by vibneiro
    The original link of the problem is here: https://code.google.com/codejam/contest/90101/dashboard#s=p2&a=2 In simple words we need to find how many times the string S="welcome to code jam" appears as a sub-sequence of given string S, e.g. S="welcome to code jam" T="wweellccoommee to code qps jam" I know the theory but not good at DP in practice. Would you please explain step-by-step process to solve this DP problem on example and why it works?

    Read the article

  • How to print source code lines in python logger

    - by anon
    Is there some relatively simple way to programmatically include source code lines to python logger report. For example... import logging def main(): something_is_not_right = True logging.basicConfig(level=logging.DEBUG, format=('%(filename)s: ' '%(levelname)s: ' '%(funcName)s(): ' '%(lineno)d:\t' '%(message)s') ) if something_is_not_right == True: logging.debug('some way to get previous line of source code here?') So that output would look like this. example.py: DEBUG: main(): 14: if something_is_not_right == True:

    Read the article

  • xcode user script - Apple Script - Sort selected lines by length

    - by Bach
    I need to create a user scripts in xcode where I can sort a selection of multiple lines, by their length (number of characters) I know of this macro variable PBXTextLength, but not sure how to write the script. this is the sort selection script in Xcode: echo -n "%%%{PBXSelection}%%%" sort <&0 echo -n "%%%{PBXSelection}%%%" how can i modify that script to sort the selection by the length of the line (PBXTextLength)? thanks

    Read the article

  • Reading a subset of the lines in a text file, with bash

    - by Markus
    Hi! I have a file line a - this is line a line b - this is line b line c - this is line c line d - this is line d line e - this is line e The question is: How can I output the lines starting from "line b" till "line d" using bash commands? I mean, to obtain: "line b - this is line b line c - this is line c line d - this is line d"

    Read the article

  • VS2010 Code Analysis, any way to automatically fix certain warnings?

    - by JL
    I must say I really like the new code analysis with VS 2010, I have a lot of areas in my code where I am not using CultureInfo.InvariantCultureand code analysis is warming me about this. I am pretty sure I want to use CultureInfo.InvariantCulturewhere ever code analysis has detected it is missing on Convert.ToString operations. Is there anyway to get VS to automatically fix warnings of this type?

    Read the article

  • how to add lines numbers to : QTextEdit ?

    - by radi
    i am writing a visual basic ide , and i need to add lines numbers to QTextEdit and highlight current line . i have found this tutorial but it is written in java and i write my project in c++ so where to find tutorial like that in c++ , or if there is a ready to use component ? thanks .

    Read the article

  • How to create lines with Athens?

    - by Kilon
    I have no clue how to create lines with Athens. I took a look at Cairo docs but I cant see how Athens is related to Cairo. http://zetcode.com/gfx/cairo/basicdrawing/ In the above link I cant find any equivalent for cairo_set_line_width(cr, 1); I tried to look inside Athens but is nowhere to be found. Overall I find the Athens architecture quite confusing though Cairo looks simple. Any idea how to makes this work ?

    Read the article

  • LaTeX verbatim that can break too long lines?

    - by kotlinski
    I want to generate a PDF of user-submitted text using LaTeX. To handle crazy user input, I first thought about using the verbatim package, but of course it doesn't break up too long lines. Is there some package that works similar to verbatim (i.e., accept any input) but formats the text nicely?

    Read the article

  • iPhone UITextView leaves room for 2 lines at the bottom

    - by Ton
    Hi Guys, When i start typing text in a default textView in my viewcontroller, its not going to the bottom of the textfield. It leaves room for 2 more lines of text and then starts scrolling. I want it to start scrolling when i start going beyond the last line. I tried everything, and i dont know what i can do? Anyone any ideas?

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Python script to remove lines from file containing words in array

    - by chromesub
    I have the following script which identifies lines in a file which I want to remove, based on an array but does not remove them. What should I change? sourcefile = "C:\\Python25\\PC_New.txt" filename2 = "C:\\Python25\\PC_reduced.txt" offending = ["Exception","Integer","RuntimeException"] def fixup( filename ): print "fixup ", filename fin = open( filename ) fout = open( filename2 , "w") for line in fin.readlines(): for item in offending: print "got one",line line = line.replace( item, "MUST DELETE" ) line=line.strip() fout.write(line) fin.close() fout.close() fixup(sourcefile)

    Read the article

  • Make openGL lines connected

    - by user146780
    Right now I'v created a polygon, then I do the same thing but with line_loop to draw the outline. My issue right now is if I set the line thickness to high, the lines arn't connected. Their ends would need to be (linewidth) longer... is there a way to fix this? Thanks

    Read the article

  • Algorithmia Source Code released on CodePlex

    - by FransBouma
    Following the release of our BCL Extensions Library on CodePlex, we have now released the source-code of Algorithmia on CodePlex! Algorithmia is an algorithm and data-structures library for .NET 3.5 or higher and is one of the pillars LLBLGen Pro v3's designer is built on. The library contains many data-structures and algorithms, and the source-code is well documented and commented, often with links to official descriptions and papers of the algorithms and data-structures implemented. The source-code is shared using Mercurial on CodePlex and is licensed under the friendly BSD2 license. User documentation is not available at the moment but will be added soon. One of the main design goals of Algorithmia was to create a library which contains implementations of well-known algorithms which weren't already implemented in .NET itself. This way, more developers out there can enjoy the results of many years of what the field of Computer Science research has delivered. Some algorithms and datastructures are known in .NET but are re-implemented because the implementation in .NET isn't efficient for many situations or lacks features. An example is the linked list in .NET: it doesn't have an O(1) concat operation, as every node refers to the containing LinkedList object it's stored in. This is bad for algorithms which rely on O(1) concat operations, like the Fibonacci heap implementation in Algorithmia. Algorithmia therefore contains a linked list with an O(1) concat feature. The following functionality is available in Algorithmia: Command, Command management. This system is usable to build a fully undo/redo aware system by building your object graph using command-aware classes. The Command pattern is implemented using a system which allows transparent undo-redo and command grouping so you can use it to make a class undo/redo aware and set properties, use its contents without using commands at all. The Commands namespace is the namespace to start. Classes you'd want to look at are CommandifiedMember, CommandifiedList and KeyedCommandifiedList. See the CommandQueueTests in the test project for examples. Graphs, Graph algorithms. Algorithmia contains a sophisticated graph class hierarchy and algorithms implemented onto them: non-directed and directed graphs, as well as a subgraph view class, which can be used to create a view onto an existing graph class which can be self-maintaining. Algorithms include transitive closure, topological sorting and others. A feature rich depth-first search (DFS) crawler is available so DFS based algorithms can be implemented quickly. All graph classes are undo/redo aware, as they can be set to be 'commandified'. When a graph is 'commandified' it will do its housekeeping through commands, which makes it fully undo-redo aware, so you can remove, add and manipulate the graph and undo/redo the activity automatically without any extra code. If you define the properties of the class you set as the vertex type using CommandifiedMember, you can manipulate the properties of vertices and the graph contents with full undo/redo functionality without any extra code. Heaps. Heaps are data-structures which have the largest or smallest item stored in them always as the 'root'. Extracting the root from the heap makes the heap determine the next in line to be the 'maximum' or 'minimum' (max-heap vs. min-heap, all heaps in Algorithmia can do both). Algorithmia contains various heaps, among them an implementation of the Fibonacci heap, one of the most efficient heap datastructures known today, especially when you want to merge different instances into one. Priority queues. Priority queues are specializations of heaps. Algorithmia contains a couple of them. Sorting. What's an algorithm library without sort algorithms? Algorithmia implements a couple of sort algorithms which sort the data in-place. This aspect is important in situations where you want to sort the elements in a buffer/list/ICollection in-place, so all data stays in the data-structure it already is stored in. PropertyBag. It re-implements Tony Allowatt's original idea in .NET 3.5 specific syntax, which is to have a generic property bag and to be able to build an object in code at runtime which can be bound to a property grid for editing. This is handy for when you have data / settings stored in XML or other format, and want to create an editable form of it without creating many editors. IEditableObject/IDataErrorInfo implementations. It contains default implementations for IEditableObject and IDataErrorInfo (EditableObjectDataContainer for IEditableObject and ErrorContainer for IDataErrorInfo), which make it very easy to implement these interfaces (just a few lines of code) without having to worry about bookkeeping during databinding. They work seamlessly with CommandifiedMember as well, so your undo/redo aware code can use them out of the box. EventThrottler. It contains an event throttler, which can be used to filter out duplicate events in an event stream coming into an observer from an event. This can greatly enhance performance in your UI without needing to do anything other than hooking it up so it's placed between the event source and your real handler. If your UI is flooded with events from data-structures observed by your UI or a middle tier, you can use this class to filter out duplicates to avoid redundant updates to UI elements or to avoid having observers choke on many redundant events. Small, handy stuff. A MultiValueDictionary, which can store multiple unique values per key, instead of one with the default Dictionary, and is also merge-aware so you can merge two into one. A Pair class, to quickly group two elements together. Multiple interfaces for helping with building a de-coupled, observer based system, and some utility extension methods for the defined data-structures. We regularly update the library with new code. If you have ideas for new algorithms or want to share your contribution, feel free to discuss it on the project's Discussions page or send us a pull request. Enjoy!

    Read the article

  • Weekend reading: Microsoft/Oracle and SkyDrive based code-editor

    - by jamiet
    A couple of news item caught my eye this weekend that I think are worthy of comment. Microsoft/Oracle partnership to be announced tomorrow (24/06/2013) According to many news site Microsoft and Oracle are about to announce a partnership (Oracle set for major Microsoft, Salesforce, Netsuite partnerships) and they all seem to be assuming that it will be something to do with “the cloud”. I wouldn’t disagree with that assessment, Microsoft are heavily pushing Azure and Oracle seem (to me anyway) to be rather lagging behind in the cloud game. More specifically folks seem to be assuming that Oracle’s forthcoming 12c database release will be offered on Azure. I did a bit of reading about Oracle 12c and one of its key pillars appears to be that it supports multi-tenant topologies and multi-tenancy is a common usage scenario for databases in the cloud. I’m left wondering then, if Microsoft are willing to push a rival’s multi-tenant solution what is happening to its own cloud-based multi-tenant offering – SQL Azure Federations. We haven’t heard anything about federations for what now seems to be a long time and moreover the main Program Manager behind the technology, Cihan Biyikoglu, recently left Microsoft to join Twitter. Furthermore, a Principle Architect for SQL Server, Conor Cunningham, recently presented the opening keynote at SQLBits 11 where he talked about multi-tenant solutions on SQL Azure and not once did he mention federations. All in all I don’t have a warm fuzzy feeling about the future of SQL Azure Federations so I hope that that question gets asked at some point following the Microsoft/Oracle announcement. Text Editor on SkyDrive with coding-specific features Liveside.net got a bit of a scoop this weekend with the news (Exclusive: SkyDrive.com to get web-based text file editing features) that Microsoft’s consumer-facing file storage service is going to get a new feature – a web-based code editor. Here’s Liveside’s screenshot: I’ve long had a passing interest in online code editors, indeed back in December 2009 I wondered out loud on this blog site: I started to wonder when the development tools that we use would also become cloud-based. After all, if we’re using cloud-based services does it not make sense to have cloud-based tools that work with them? I think it does. Project Houston Since then the world has moved on. Cloud 9 IDE (https://c9.io/) have blazed a trail in the fledgling world of online code editors and I have been wondering when Microsoft were going to start playing catch-up. I had no doubt that an online code editor was in Microsoft’s future; its an obvious future direction, why would I want to have to download and install a bloated text editor (which, arguably, is exactly what Visual Studio amounts to) and have to continually update it when I can simply open a web browser and have ready access to all of my code from wherever I am. There are signs that Microsoft is already making moves in this direction, after all the URL for their new offering Team Foundation Service doesn’t mention TFS at all – my own personalised URL for Team Foundation Service is http://jamiet.visualstudio.com – using “Visual Studio” as the domain name for a service that isn’t strictly speaking part of Visual Studio leads me to think that there’s a much bigger play here and that one day http://visualstudio.com will house an online code editor. With that in mind then I find Liveside’s revelation rather intriguing, why would a code editing tool show up in Skydrive? Perhaps SkyDrive is going to get integrated more tightly into TFS, I’m very interested to see where this goes. The larger question playing on my mind though is whether an online code editor from Microsoft will support SQL Server developers. I have opined before (see The SQL developer gap) about the shoddy treatment that SQL Server developers have to experience from Microsoft and I haven’t seen any change in Microsoft’s attitude in the three and a half years since I wrote that post. I’m constantly bewildered by the lack of investment in SQL Server developer productivity compared to the riches that are lavished upon our appdev brethren. When you consider that SQL Server is Microsoft’s third biggest revenue stream it is, frankly, rather insulting. SSDT was a step in the right direction but the hushed noises I hear coming out of Microsoft of late in regard to SSDT don’t bode fantastically well for its future. So, will an online code editor from Microsoft support T-SQL development? I have to assume not given the paucity of investment on us lowly SQL Server developers over the last few years, but I live in hope! Your thoughts in the comments section please. I would be very interested in reading them. @Jamiet

    Read the article

< Previous Page | 54 55 56 57 58 59 60 61 62 63 64 65  | Next Page >