Search Results

Search found 2500 results on 100 pages for 'util'.

Page 58/100 | < Previous Page | 54 55 56 57 58 59 60 61 62 63 64 65  | Next Page >

  • Creating a provider. I receive this exception java.lang.SecurityException

    - by user308806
    Hello, I'm trying to create a provider. when I run the code i receive this exception Exception in thread "main" java.lang.SecurityException: JCE cannot authenticate the provider MyProvider at javax.crypto.Cipher.getInstance(DashoA13*..) at javax.crypto.Cipher.getInstance(DashoA13*..) at hellman.Main.main(Main.java:68) Caused by: java.util.jar.JarException: Cannot parse file:/C:/Documents%20and%20Settings/brahim%20%20chami/Bureau/Project%233/hellman/build/classes/ at javax.crypto.SunJCE_c.a(DashoA13*..) at javax.crypto.SunJCE_b.b(DashoA13*..) at javax.crypto.SunJCE_b.a(DashoA13*..) ... 3 more Java Result: 1

    Read the article

  • Creating BlackBerry method stubs using wscompile on WSDL from ColdFusion

    - by Jim B
    I have been working on a BlackBerry application that consumes web services from ColdFusion 7. The Java ME SDK and the Java Wireless Toolkit both require that the generated WSDL be of the document/literal type. Fortunately, I have input on the web service development so I tried setting 'style="document"' in the cfcomponent tag. This generated a document/literal style WSDL but now wscompile generates the following errors in several places: Found unknown simple type: javax.xml.soap.SOAPElement Found unknown simple type: java.util.Calendar Any ideas why this is happening? The WSDL does get parsed correctly by the JWSDP tool but the stubs use namespaces that are not available in the J2ME platform. I would have thought ColdFusion WSDL would work more easily with other products in the Java family.

    Read the article

  • Is it possible to use the Spring MVC on JBoss App server?

    - by ikky
    Hi. Is it possible to use Spring MVC on JBoss App server? If so, how? Used the Spring MVC with Tomcat Apache server, but now i have to move my project to a JBoss app server. But i'm getting an error, and i'm not sure why. It seems like i can't use my classes. 125 ERROR [Engine] StandardWrapperValve[project]: Servlet.service() for servlet project threw exception java.lang.NullPointerException at java.util.Hashtable.containsKey(Hashtable.java:307) at com.scap.handle.ControlStatusContainer.deleteUser(ControlStatusContainer.java:70) at web.shnController.handleRequest(shnController.java:121) at org.springframework.web.servlet.mvc.SimpleControllerHandlerAdapter.handle(SimpleControllerHandlerAdapter.java:48) at org.springframework.web.servlet.DispatcherServlet.doDispatch(DispatcherServlet.java:875) at org.springframework.web.servlet.DispatcherServlet.doService(DispatcherServlet.java:807) at org.springframework.web.servlet.FrameworkServlet.processRequest(FrameworkServlet.java:571) at org.springframework.web.servlet.FrameworkServlet.doGet(FrameworkServlet.java:501) Anyone got a suggestion? Thanks in advance.

    Read the article

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • Why can't my main class see the array in my calender class

    - by Rocky Celltick Eadie
    This is a homework problem. I'm already 5 days late and can't figure out what I'm doing wrong.. this is my 1st semester in Java and my first post on this site Here is the assignment.. Create a class called Calendar. The class should contain a variable called events that is a String array. The array should be created to hold 5 elements. Use a constant value to specify the array size. Do not hard code the array size. Initialize the array in the class constructor so that each element contains the string “ – No event planned – “. The class should contain a method called CreateEvent. This method should accept a String argument that contains a one-word user event and an integer argument that represents the day of the week. Monday should be represented by the number 1 and Friday should be represented by the number 5. Populate the events array with the event info passed into the method. Although the user will input one-word events, each event string should prepend the following string to each event: event_dayAppoinment: (where event_day is the day of the week) For example, if the user enters 1 and “doctor” , the first array element should read: Monday Appointment: doctor If the user enters 2 and “PTA” , the second array element should read: Tuesday Appointment: PTA Write a driver program (in a separate class) that creates and calls your Calendar class. Then use a loop to gather user input. Ask for the day (as an integer) and then ask for the event (as a one word string). Pass the integer and string to the Calendar object’s CreateEvent method. The user should be able enter 0 – 5 events. If the user enters -1, the loop should exit and your application should print out all the events in a tabular format. Your program should not allow the user to enter invalid values for the day of the week. Any input other than 1 – 5 or -1 for the day of the week would be considered invalid. Notes: When obtaining an integer from the user, you will need to use the nextInt() method on your Scanner object. When obtaining a string from a user, you will need to use the next() method on your Scanner object. Here is my code so far.. //DRIVER CLASS /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin class driver public class driver { /** * @paramargs the command line arguments */ //begin main method public static void main(String[] args) { //initiates scanner Scanner userInput = new Scanner (System.in); //declare variables int dayOfWeek; String userEvent; //creates object for calender class calendercalenderObject = new calender(); //user prompt System.out.println("Enter day of week for your event in the following format:"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //user prompt System.out.println("Please type in the name of your event"); //collect user input userEvent = userInput.next(); //begin while loop while (dayOfWeek != -1) { //test for valid day of week if ((dayOfWeek>=1) && (dayOfWeek<=5)){ //calls createEvent method in calender class and passes 2 variables calenderObject.createEvent(userEvent,dayOfWeek); } else { //error message System.out.println("You have entered an invalid number"); //user prompts System.out.println("Press -1 to quit or enter another day"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //end data validity test } //end while loop } //prints array to screen int i=0; for (i=0;i<events.length;i++){ System.out.println(events[i]); } //end main method } } /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin calender class public class calender { //creates events array String[] events = new String[5]; //begin calender class constructor public calender() { //Initializes array String[] events = {"-No event planned-","-No event planned-","-No event planned-","-No event planned-","-No event planned-"}; //end calender class constructor } //begin createEvent method public String[] createEvent (String userEvent, int dayOfWeek){ //Start switch test switch (dayOfWeek){ case 1: events[0] = ("Monday Appoinment:") + userEvent; break; case 2: events[1] = ("Tuesday Appoinment:") + userEvent; break; case 3: events[2] = ("WednsdayAppoinment:") + userEvent; break; case 4: events[3] = ("Thursday Appoinment:") + userEvent; break; case 5: events[4] = ("Friday Appoinment:") + userEvent; break; default: break; //End switch test } //returns events array return events; //end create event method } //end calender class }

    Read the article

  • Write a program that allows the user to enter a string and then prints the letters of the String sep

    - by WM
    The output is always a String, for example H,E,L,L,O,. How could I limit the commas? I want the commas only between letters, for example H,E,L,L,O. import java.util.Scanner; import java.lang.String; public class forLoop { public static void main(String[] args) { Scanner Scan = new Scanner(System.in); System.out.print("Enter a string: "); String Str1 = Scan.next(); String newString=""; String Str2 =""; for (int i=0; i < Str1.length(); i++) { newString = Str1.charAt(i) + ","; Str2 = Str2 + newString; } System.out.print(Str2); } }

    Read the article

  • how to use an array list ?

    - by soad El-hayek
    salam 3lekom i need to know if i store my data in an Araaylist and i need to get the value that i've stroed in it for example : if i've an array list like this ArrayList A = new ArrayList(); A = {"Soad", "mahran"}; and i want to get each String lonly how can i do it ? I've tried to do it like this package arraylist; import java.util.ArrayList; public class Main { public static void main(String[] args) { ArrayList S = new ArrayList(); String A = "soad "; S.add(A); S.add("A"); String F = S.toString(); System.out.println(F); String [] W = F.split(","); for(int i=0 ; i<W.length ; i++) { System.out.println(W[i]); } } }

    Read the article

  • a question on webpage data scraping using Java

    - by Gemma
    Hi there. I am now trying to implement a simple HTML webpage scraper using Java.Now I have a small problem. Suppose I have the following HTML fragment. <div id="sr-h-left" class="sr-comp"> <a class="link-gray-underline" id="compare_header" rel="nofollow" href="javascript:i18nCompareProd('/serv/main/buyer/ProductCompare.jsp?nxtg=41980a1c051f-0942A6ADCF43B802'); " Compare Showing 1 - 30 of 1,439 matches, The data I am interested is the integer 1.439 shown at the bottom.I am just wondering how can I get that integer out of the HTML. I am now considering using a regular expression,and then use the java.util.Pattern to help get the data out,but still not very clear about the process. I would be grateful if you guys could give me some hint or idea on this data scraping. Thanks a lot.

    Read the article

  • Understanding the workings of equals and hashCode in a HashMap

    - by andandandand
    I have this test code: import java.util.*; class MapEQ { public static void main(String[] args) { Map<ToDos, String> m = new HashMap<ToDos, String>(); ToDos t1 = new ToDos("Monday"); ToDos t2 = new ToDos("Monday"); ToDos t3 = new ToDos("Tuesday"); m.put(t1, "doLaundry"); m.put(t2, "payBills"); m.put(t3, "cleanAttic"); System.out.println(m.size()); } } class ToDos{ String day; ToDos(String d) { day = d; } public boolean equals(Object o) { return ((ToDos)o).day == this.day; } // public int hashCode() { return 9; } } When // public int hashCode() { return 9; } is uncommented m.size() returns 2, when it's left commented it returns three. Why?

    Read the article

  • input file cannot be found

    - by Eric Smith
    I am just messing around with reading input files with java until I got stumped at the most basic of steps... finding the input file! The input.txt file is in the same directory as my class file that is calling it yet eclipse still gives me an error that it cant be found: "Exception in thread "main" java.lang.Error: Unresolved compilation problem: Unhandled exception type FileNotFoundException" My code: package pa; import java.util.Scanner; public class Project { public static void main(String[] args) { java.io.File file = new java.io.File("input.txt"); System.out.println(file.getAbsolutePath()); Scanner input = new Scanner(file); } } input.txt is in the same package, same folder and everything. I'm confused :(

    Read the article

  • Why is there a seemingly identical copy of the JDK 1.5 core runtime in org.osgi.foundation-1.0.0.jar?

    - by Jonathan Neufeld
    I am maintaining a web application that depends on OSGi and Maven pulls-in a jar called org.osgi-foundation-1.0.0.jar that seems to contain the same classes as part of the JDK core runtime such as: java.util.*; java.io.*; etc. and so on. This seems very strange and I have to ask why this is necessary. More-over, my web-application fails to deploy on JBoss 6 because these are "illegal package names" for a third-party library. What is the purpose of org.osgi-foundation-1.0.0.jar ? is it necessary?

    Read the article

  • In terminal, merging multiple folders into one.

    - by Josh Pinter
    I have a backup directory created by WDBackup (western digital external HD backup util) that contains a directory for each day that it backed up and the incremental contents of just what was backed up. So the hierarchy looks like this: 20100101 My Documents Letter1.doc My Music Best Songs Every First Songs.mp3 My song.mp3 # modified 20100101 20100102 My Documents Important Docs Taxes.doc My Music My Song.mp3 # modified 20100102 ...etc... Only what has changed is backed up and the first backup that was ever made contains all the files selected for backup. What I'm trying to do now is incrementally copy, while keeping the folder structure, from oldest to newest, each of these dated folders into a 'merged' folder so that it overrides the older content and keeps the new stuff. As an example, if just using these two example folders, the final merged folder would look like this: Merged My Documents Important Docs Taxes.doc Letter1.doc My Music Best Songs Every First Songs.mp3 My Song.mp3 # modified 20100102 Hope that makes sense. Thanks, Josh

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to write to an XML file inside a jar file?

    - by cancelledout
    Hi Java programmers. I badly need your help. I have a JavaFX/Java ME application. I'm trying to modify an XML file inside my project's folder (soon to be packaged jar file). The path of the file I want to write: /parseExample/service1.xml Sadly, my application is a JavaFx/JavaME so it doesn't contain the library java.util.jar. So I can't use the jar classes. Are there other ways to do that?

    Read the article

  • How to use LocalValueBean in jsp page.

    - by Himanshu
    I have set certain bean label and bean value in one of my dao class.. I have created a list of LocalValueBean objects and passed it as a list to jsp.. now here at jsp i need to print the label seperately and on hover to the label i need to show the value.. i need to exttract or to say get those values in jsp directly... i have also imported the org.apache.struts.util.LabelValueBean in my jsp but still its not working.. please let me know if you any ideas...

    Read the article

  • How to implement blocking request-reply using Java concurrency primitives?

    - by Uri
    My system consists of a "proxy" class that receives "request" packets, marshals them and sends them over the network to a server, which unmarshals them, processes, and returns some "response packet". My "submit" method on the proxy side should block until a reply is received to the request (packets have ids for identification and referencing purposes) or until a timeout is reached. If I was building this in early versions of Java, I would likely implement in my proxy a collection of "pending messages ids", where I would submit a message, and wait() on the corresponding id (with a timeout). When a reply was received, the handling thread would notify() on the corresponding id. Is there a better way to achieve this using an existing library class, perhaps in java.util.concurrency? If I went with the solution described above, what is the correct way to deal with the potential race condition where a reply arrives before wait() is invoked?

    Read the article

  • How can I launch a system command via Javascript in Google Chrome?

    - by kvsn
    I want to execute a local program on my computer via Javascript in Chrome. In Firefox, it can be done as follows (after setting 'signed.applets.codebase_principal_support' to true in about:config): function run_cmd(cmd, args) { netscape.security.PrivilegeManager.enablePrivilege("UniversalXPConnect"); var file = Components.classes["@mozilla.org/file/local;1"] .createInstance(Components.interfaces.nsILocalFile); file.initWithPath(cmd); var process = Components.classes["@mozilla.org/process/util;1"] .createInstance(Components.interfaces.nsIProcess); process.init(file); process.run(false, args, args.length); } What's the equivalent code for Chrome?

    Read the article

  • grails date from params in controller

    - by nils petersohn
    y is it so hard to extract the date from the view via the params in a grails controller? i don't want to extract the date by hand like this: instance.dateX = parseDate(params["dateX_value"])//parseDate is from my helper class i just want to use instance.properties = params you know :) in the model the type is java.util.Date and in the params is all the information (dateX_month, dateX_day, ...) i searched on the net and found nothing on this :( i hoped that grails 1.3.0 could help but still the same thing. i can't and will not belief that extracting the date by hand is nessesary!

    Read the article

  • log4j: Change format of loggers configured in another library.

    - by Ignacio Thayer
    Using clojure, I've been able to successfully setup log4j very simply by using this log4j.properties file, and including log4j in my classpath. # BEGIN log4j.properties log4j.appender.STDOUT=org.apache.log4j.ConsoleAppender log4j.appender.STDOUT.layout=org.apache.log4j.PatternLayout log4j.appender.STDOUT.layout.ConversionPattern=%d{MMdd HHmmss SSS} %5p %c [%t] %m\n log4j.rootLogger=DEBUG, STDOUT Then after :use'ing clojure.contrib.logging, I'm able to print a statement with the desired formatting as expected like so: (info "About to print this") (debug "This is debug-level") My question is how to achieve a consistent formatting for logging statements made from loggers configured in other libraries. I thought I could find existing loggers using org.apache.log4j.LogManager.getCurrentLoggers() and change the PatternLayouts there, but I'm not able to iterate over that enumeration in clojure, as I get the following error: Dont know how to create ISeq from: java.util.Vector$1 I assume this is possible somehow, and probably very simply. How? Thanks much.

    Read the article

  • Copying a java text file into a String.

    - by Deepak Konidena
    Hi, I run into the following errors when i try to store a large file into a string. Exception in thread "main" java.lang.OutOfMemoryError: Java heap space at java.util.Arrays.copyOf(Arrays.java:2882) at java.lang.AbstractStringBuilder.expandCapacity(AbstractStringBuilder.java:100) at java.lang.AbstractStringBuilder.append(AbstractStringBuilder.java:515) at java.lang.StringBuffer.append(StringBuffer.java:306) at rdr2str.ReaderToString.main(ReaderToString.java:52) As is evident, i am running out of heap space. Basically my pgm looks like something like this. FileReader fr = new FileReader(<filepath>); sb = new StringBuffer(); char[] b = new char[BLKSIZ]; while ((n = fr.read(b)) > 0) sb.append(b, 0, n); fileString = sb.toString(); Can someone suggest me why i am running into heap space error? Thanks.

    Read the article

  • Comparing two java objects on fly (data type not known)

    - by Narendra
    Hi All, I need to compare different data objects. Can any one tell me how can i do this. I don't know what are the data types i will get priorly. If i need to use any util from apache commons then please give reference to it. At present I am using .equals() for comparing equality of objects .It is working fine when I am comparing quality for two strings. If i am comparing java.sql.date data type then it is showing unequal even though both contains same values. Can any one suggest me on this regard. Thanks, Narendra

    Read the article

  • Extjs - Getting more from the server

    - by fatnjazzy
    Hi, Is it possible to get every data from the server? for example, i want to get the columns items from the server Via Ajax/Proxy by sending json string? thanks var grid = new Ext.grid.GridPanel({ store: store, columns: [ {id:'company',header: 'Company', width: 160, sortable: true, dataIndex: 'company'}, {header: 'Price', width: 75, sortable: true, renderer: 'usMoney', dataIndex: 'price'}, {header: 'Change', width: 75, sortable: true, renderer: change, dataIndex: 'change'}, {header: '% Change', width: 75, sortable: true, renderer: pctChange, dataIndex: 'pctChange'}, {header: 'Last Updated', width: 85, sortable: true, renderer: Ext.util.Format.dateRenderer('m/d/Y'), dataIndex: 'lastChange'} ], stripeRows: true, autoExpandColumn: 'company', height: 350, width: 600, title: 'Array Grid', stateful: true, stateId: 'grid' });

    Read the article

  • For Loop help In a Hash Cracker Homework.

    - by aaron burns
    On the homework I am working on we are making a hash cracker. I am implementing it so as to have my cracker. java call worker.java. Worker.java implements Runnable. Worker is to take the start and end of a list of char, the hash it is to crack, and the max length of the password that made the hash. I know I want to do a loop in run() BUT I cannot think of how I would do it so it would go to the given max pasword length. I have posted the code I have so far. Any directions or areas I should look into.... I thought there was a way to do this with a certain way to write the loop but I don't know or can't find the correct syntax. Oh.. also. In main I divide up so x amount of threads can be chosen and I know that as of write now it only works for an even number of the 40 possible char given. package HashCracker; import java.util.*; import java.security.MessageDigest; import java.security.NoSuchAlgorithmException; public class Cracker { // Array of chars used to produce strings public static final char[] CHARS = "abcdefghijklmnopqrstuvwxyz0123456789.,-!".toCharArray(); public static final int numOfChar=40; /* Given a byte[] array, produces a hex String, such as "234a6f". with 2 chars for each byte in the array. (provided code) */ public static String hexToString(byte[] bytes) { StringBuffer buff = new StringBuffer(); for (int i=0; i<bytes.length; i++) { int val = bytes[i]; val = val & 0xff; // remove higher bits, sign if (val<16) buff.append('0'); // leading 0 buff.append(Integer.toString(val, 16)); } return buff.toString(); } /* Given a string of hex byte values such as "24a26f", creates a byte[] array of those values, one byte value -128..127 for each 2 chars. (provided code) */ public static byte[] hexToArray(String hex) { byte[] result = new byte[hex.length()/2]; for (int i=0; i<hex.length(); i+=2) { result[i/2] = (byte) Integer.parseInt(hex.substring(i, i+2), 16); } return result; } public static void main(String args[]) throws NoSuchAlgorithmException { if(args.length==1)//Hash Maker { //create a byte array , meassage digestand put password into it //and get out a hash value printed to the screen using provided methods. byte[] myByteArray=args[0].getBytes(); MessageDigest hasher=MessageDigest.getInstance("SHA-1"); hasher.update(myByteArray); byte[] digestedByte=hasher.digest(); String hashValue=Cracker.hexToString(digestedByte); System.out.println(hashValue); } else//Hash Cracker { ArrayList<Thread> myRunnables=new ArrayList<Thread>(); int numOfThreads = Integer.parseInt(args[2]); int charPerThread=Cracker.numOfChar/numOfThreads; int start=0; int end=charPerThread-1; for(int i=0; i<numOfThreads; i++) { //creates, stores and starts threads. Runnable tempWorker=new Worker(start, end, args[1], Integer.parseInt(args[1])); Thread temp=new Thread(tempWorker); myRunnables.add(temp); temp.start(); start=end+1; end=end+charPerThread; } } } import java.util.*; public class Worker implements Runnable{ private int charStart; private int charEnd; private String Hash2Crack; private int maxLength; public Worker(int start, int end, String hashValue, int maxPWlength) { charStart=start; charEnd=end; Hash2Crack=hashValue; maxLength=maxPWlength; } public void run() { byte[] myHash2Crack_=Cracker.hexToArray(Hash2Crack); for(int i=charStart; i<charEnd+1; i++) { Cracker.numOfChar[i]////// this is where I am stuck. } } }

    Read the article

  • java.io in debian

    - by Stig
    Hello, i try to compile a java program but in the import section of the code fails: import java.net.; import java.io.; import java.util.; import java.text.; import java.awt.; //import java.awt.image.; import java.awt.event.; //import java.awt.image.renderable.; import javax.swing.; import javax.swing.border.; //import javax.swing.border.EtchedBorder; //import javax.media.jai.; //import javax.media.jai.operator.; //import com.sun.media.jai.codec.; //import java.lang.reflect.; how can i fix the problem in a linux debian machine?. Thanks

    Read the article

  • Stuck with the first record while parsing an XML in Java

    - by Ritwik G
    I am parsing the following XML : <table ID="customer"> <T><C_CUSTKEY>1</C_CUSTKEY><C_NAME>Customer#000000001</C_NAME><C_ADDRESS>IVhzIApeRb ot,c,E</C_ADDRESS><C_NATIONKEY>15</C_NATIONKEY><C_PHONE>25-989-741-2988</C_PHONE><C_ACCTBAL>711.56</C_ACCTBAL><C_MKTSEGMENT>BUILDING</C_MKTSEGMENT><C_COMMENT>regular, regular platelets are fluffily according to the even attainments. blithely iron</C_COMMENT></T> <T><C_CUSTKEY>2</C_CUSTKEY><C_NAME>Customer#000000002</C_NAME><C_ADDRESS>XSTf4,NCwDVaWNe6tEgvwfmRchLXak</C_ADDRESS><C_NATIONKEY>13</C_NATIONKEY><C_PHONE>23-768-687-3665</C_PHONE><C_ACCTBAL>121.65</C_ACCTBAL><C_MKTSEGMENT>AUTOMOBILE</C_MKTSEGMENT><C_COMMENT>furiously special deposits solve slyly. furiously even foxes wake alongside of the furiously ironic ideas. pending</C_COMMENT></T> <T><C_CUSTKEY>3</C_CUSTKEY><C_NAME>Customer#000000003</C_NAME><C_ADDRESS>MG9kdTD2WBHm</C_ADDRESS><C_NATIONKEY>1</C_NATIONKEY><C_PHONE>11-719-748-3364</C_PHONE><C_ACCTBAL>7498.12</C_ACCTBAL><C_MKTSEGMENT>AUTOMOBILE</C_MKTSEGMENT><C_COMMENT>special packages wake. slyly reg</C_COMMENT></T> <T><C_CUSTKEY>4</C_CUSTKEY><C_NAME>Customer#000000004</C_NAME><C_ADDRESS>XxVSJsLAGtn</C_ADDRESS><C_NATIONKEY>4</C_NATIONKEY><C_PHONE>14-128-190-5944</C_PHONE><C_ACCTBAL>2866.83</C_ACCTBAL><C_MKTSEGMENT>MACHINERY</C_MKTSEGMENT><C_COMMENT>slyly final accounts sublate carefully. slyly ironic asymptotes nod across the quickly regular pack</C_COMMENT></T> <T><C_CUSTKEY>5</C_CUSTKEY><C_NAME>Customer#000000005</C_NAME><C_ADDRESS>KvpyuHCplrB84WgAiGV6sYpZq7Tj</C_ADDRESS><C_NATIONKEY>3</C_NATIONKEY><C_PHONE>13-750-942-6364</C_PHONE><C_ACCTBAL>794.47</C_ACCTBAL><C_MKTSEGMENT>HOUSEHOLD</C_MKTSEGMENT><C_COMMENT>blithely final instructions haggle; stealthy sauternes nod; carefully regu</C_COMMENT></T> </table> with the following java code: package xmlparserformining; import java.util.List; import java.util.Iterator; import org.dom4j.Document; import org.dom4j.DocumentException; import org.dom4j.Node; import org.dom4j.io.SAXReader; public class XmlParserForMining { public static Document getDocument( final String xmlFileName ) { Document document = null; SAXReader reader = new SAXReader(); try { document = reader.read( xmlFileName ); } catch (DocumentException e) { e.printStackTrace(); } return document; } public static void main(String[] args) { String xmlFileName = "/home/r/javaCodez/parsing in java/customer.xml"; String xPath = "//table/T/C_ADDRESS"; Document document = getDocument( xmlFileName ); List<Node> nodes = document.selectNodes( xPath ); System.out.println(nodes.size()); for (Node node : nodes) { String customer_address = node.valueOf(xPath); System.out.println( "Customer address: " + customer_address); } } } However, instead of getting all the various customer records, I am getting the following output: 1500 Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E and so on .. What is wrong here? Why is it printing only the first record ?

    Read the article

< Previous Page | 54 55 56 57 58 59 60 61 62 63 64 65  | Next Page >