Search Results

Search found 15233 results on 610 pages for 'ssis design patterns'.

Page 586/610 | < Previous Page | 582 583 584 585 586 587 588 589 590 591 592 593  | Next Page >

  • php array code with regular expressions

    - by user551068
    there are few mistakes which it is showing as Warning: preg_match() [function.preg-match]: Delimiter must not be alphanumeric or backslash in array 4,9,10,11,12... can anyone resolve them <?PHP $hosts = array( array("ronmexico.kainalopallo.com/","beforename=$F_firstname%20$F_lastname&gender=$F_gender","Your Ron Mexico Name is ","/the ultimate disguise, is <u><b>([^<]+)<\/b><\/u>/s"), array("www.fjordstone.com/cgi-bin/png.pl","gender=$F_gender&submit=Name%20Me","Your Pagan name is ","/COLOR=#000000 SIZE=6> *([^<]*)<\/FONT>/"), array("rumandmonkey.com/widgets/toys/mormon/index.php","gender=$F_gender&firstname=$F_firstname&surname=$F_lastname","Your Mormon Name is ","/<p>My Mormon name is <b>([^<]+)<\/b>!<br \/>/s"), array("cyborg.namedecoder.com/index.php","acronym=$F_firstname&design=edox&design_click-edox.x=0&design_click-edox.y=0&design_click-edox=edo","","Your Cyborg Name is ","/<p>([^<]+)<\/p>/"), array("rumandmonkey.com/widgets/toys/namegen/10/","nametype=$brit&page=2&id=10&submit=God%20save%20the%20Queen!&name=$F_firstname%20$F_lastname","Your Very British Name is ","/My very British name is \&lt\;b\&gt;([^&]+)\&lt;\/b\&gt;\.\&lt;br/"), array("blazonry.com/name_generator/usname.php","realname=$F_firstname+$F_lastname&gender=$F_gender","Your U.S. Name is ","/also be known as <font size=\'\+1\'><b>([^<]+)<\/b>/s"), array("www.spacepirate.org/rogues.php","realname=$F_firstname%20$F_lastname&formentered=Yes&submit=Arrrgh","Your Space Pirate name is ","/Your pirate name is <font size=\'\+1\'><b>([^<]+)<\/b><\/font>/s"), array("rumandmonkey.com/widgets/toys/ghetto/","firstname=$F_firstname&lastname=$F_lastname","Your Ghetto Name is ","/<p align=\"center\" style=\"font-size: 36px\">\s*<br \/>\s*([^<]*)<br \/>/"), array("www.emmadavies.net/vampire/default.aspx","mf=$emgender&firstname=$F_firstname&lastname=$F_lastname&submit=Find+My+Vampire+Name","","Your Vampire Name is ","/<i class=\"vampirecontrol vampire name\">([^<]*)<\/i>/"), array("www.emmadavies.net/fairy/default.aspx","mf=$emgender&firstname=$F_firstname&lastname=$F_lastname&submit=Seek+Fairy","","Your Fairy Name is ","/<i class=\'ng fairy name\'>([^<]*)<\/i>/"), array("www.irielion.com/israel/reggaename.html","phase=3&oldname=$F_firstname%20$F_lastname&gndr=$reggender","","Your Rasta Name is ","/Yes I, your irie new name is ([^\n]*)\n/"), array("www.ninjaburger.com/fun/games/ninjaname/ninjaname.php","realname=$F_firstname+$F_lastname","Your Ninja Burger Name is ","/<BR>Ninja Burger ninja name will be<BR><BR><FONT SIZE=\'\+1\'>([^<]*)<\/FONT>/"), array("gangstaname.com/pirate_name.php","sex=$F_gender&name=$F_firstname+$F_lastname","Your Pirate Name is ","/<p><strong>We\'ll now call ye:<\/strong><\/p> *<h2 class=\"newName\">([^<]*)<\/h2>/"), array("www.xach.com/nerd-name/","name=$F_firstname+$F_lastname&gender=$F_gender","Your Nerd Name is ","/<p><div align=center class=\"nerdname\">([^<]*)<\/div>/"), array("rumandmonkey.com/widgets/toys/namegen/5941/","page=2&id=5941&nametype=$dj&name=$F_firstname+$F_lastname","Your DJ Name is ","/My disk spinnin nu name is &lt\;b&gt\;([^<]*)&lt\;\/b&gt\;\./"), array("pizza.sandwich.net/poke/pokecgi.cgi","name=$F_firstname%20$F_lastname&color=black&submit=%20send%20","Your Pokename is ","/Your Pok&eacute;name is: <h1>([^<]*)<\/h1>/") ); return $hosts; ?>

    Read the article

  • Bogus WPF / XAML errors in Visual Studio 2010

    - by epalm
    There are bogus errors hanging around, but at runtime everything works. Right now, I'm getting Cannot locate resource 'img/icons/silk/arrow_refresh.png'. I've got a simple UserControl called ImageButton (doesn't everyone?): <UserControl x:Class="WinDispatchClientWpf.src.controls.ImageButton" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006" xmlns:d="http://schemas.microsoft.com/expression/blend/2008" mc:Ignorable="d"> <Button Name="btnButton" Click="btnButton_Click"> <StackPanel Orientation="Horizontal"> <Image Name="btnImage" Stretch="None" /> <TextBlock Name="btnText" /> </StackPanel> </Button> </UserControl> Which does what you'd expect: [ContentProperty("Text")] public partial class ImageButton : UserControl { public String Image { set { btnImage.Source = GuiUtil.CreateBitmapImage(value); } } public String Text { set { btnText.Text = value; } } public double Gap { set { btnImage.Margin = new Thickness(0, 0, value, 0); } } public bool ToolBarStyle { set { if (value) { btnButton.Style = (Style)FindResource(ToolBar.ButtonStyleKey); } } } public bool IsCancel { set { btnButton.IsCancel = value; } } public bool IsDefault { set { btnButton.IsDefault = value; } } public event RoutedEventHandler Click; public ImageButton() { InitializeComponent(); } private void btnButton_Click(object sender, RoutedEventArgs e) { if (Click != null) { Click(sender, e); } } } Where CreateBitmapImage is the following: public static BitmapImage CreateBitmapImage(string imagePath) { BitmapImage icon = new BitmapImage(); icon.BeginInit(); icon.UriSource = new Uri(String.Format("pack://application:,,,/{0}", imagePath)); icon.EndInit(); return icon; } I can't see the design view of any xaml file that uses an ImageButton like such: <Window foo="bar" xmlns:wpfControl="clr-namespace:MyProj.src.controls"> <Grid> <wpfControl:ImageButton ToolBarStyle="True" Gap="3" Click="btnRefresh_Click" Text="Refresh" Image="img/icons/silk/arrow_refresh.png" /> </Grid> </Window> Why is VS complaining?

    Read the article

  • Adding NavigationControl to a TabBar Application containing UITableViews

    - by kungfuslippers
    Hi, I'm new to iPhone dev and wanted to get advice on the general design pattern / guide for putting a certain kind of app together. I'm trying to build a TabBar type application. One of the tabs needs to display a TableView and selecting a cell from within the table view will do something else - maybe show another table view or a web page. I need a Navigation Bar to be able to take me back from the table view/web page. The approach I've taken so far is to: Create an app based around UITabBarController as the rootcontroller i.e. @interface MyAppDelegate : NSObject <UIApplicationDelegate> { IBOutlet UIWindow *window; IBOutlet UITabBarController *rootController; } Create a load of UIViewController derived classes and associated NIBs and wire everything up in IB so when I run the app I get the basic tabs working. I then take the UIViewController derived class and modify it to the following: @interface MyViewController : UIViewController<UITableViewDataSource, UITableViewDelegate> { } and I add the delegate methods to the implementation of MyViewController - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { return 2; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; } if (indexPath.row == 0) { cell.textLabel.text = @"Mummy"; } else { cell.textLabel.text = @"Daddy"; } return cell; } Go back to IB , open MyViewController.xib and drop a UITableView onto it. Set the Files Owner to be MyViewController and then set the delegate and datasource of the UITableView to be MyViewController. If I run the app now, I get the table view appearing with mummy and daddy working nicely. So far so good. The question is how do I go about incorporating a Navigation Bar into my current code for when I implement: - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath() { // get row selected NSUInteger row = [indexPath row]; if (row == 0) { // Show another table } else if (row == 1) { // Show a web view } } Do I drop a NavigationBar UI control onto MyControllerView.xib ? Should I create it programmatically? Should I be using a UINavigationController somewhere ? I've tried dropping a NavigationBar onto my MyControllerView.xib in IB but its not shown when I run the app, only the TableView is displayed.

    Read the article

  • On Mac, two jpg's whose color should match do not

    - by Tim
    So I'm designing a myspace page and I have two images, one is a repeating bg image, and another is an image which loads on a layer above it, which acts as a header/masthead. For some reason, on Macs only, and only in the browser (tested in safari and ff), the masthead renders slightly darker than the repeating bg image, creating this color inconsistency. The block that extends up behind the album artwork is a solid box made with css which blocks some of myspace's standard content. It actually renders as the proper color, blending in well with the bottom portion of this image, which is the repeating part of the background, but becomes noticeable as it extends up, over the masthead, which is darker than it should be. Both images where created in GIMP and saved as jpg's using, as far as i can tell, the same settings. Here's the pic of what is going on: Screenshot - Click Me!!! Here is the code which controls this part of the design. <div class="masthead"><span></span></div> .masthead {width: 1600px; height: 1940px; background-image:url(http://www.sourtricks.com/myspace/bdww/myspace_bg09.jpg); position: absolute; margin-left: -800px; left: 50%; top: 0px; z-index: -1; overflow-x: hidden;} body.bodyContent{ margin: 0 !important; padding: 0 !important; background-color: 000000 !important; font-size: 1px; background-image: url(http://www.sourtricks.com/myspace/bdww/bg_repeat05.jpg); background-position: center bottom; _background-position: right bottom; background-attachment: scroll; background-repeat: repeat-y; z-index: -2; overflow-x: hidden; font-family: arial, sans-serif !important; } Any help would be much, much, much appreciated. Thanks for your time, Tim

    Read the article

  • How to initiate chatting between two clients and two clients only, using applets and servlets?

    - by mithun1538
    Hello everyone, I first need to apologize for my earlier questions. (You can check my profile for them)They seemed to ask more questions than give answers. Hence, I am laying down the actual question that started all them absurd questions. I am trying to design a chat applet. Till now, I have coded the applet, servlet and communication between the applet and the servlet. The code in the servlet side is such that I was able to establish chatting between clients using the applets, but the code was more like a broadcast all feature, i.e. all clients would be chatting with each other. That was my first objective when I started designing the chat applet. The second step is chatting between only two specific users, much like any other chat application we have. So this was my idea for it: I create an instance of the servlet that has the 'broadcast-all' code. I then pass the address of this instance to the respective clients. 2 client applets use the address to then chat. Technically the code is 'broadcast-all', but since only 2 clients are connected to it, it gives the chatting between two clients feature. Thus, groups of 2 clients have different instances of the same servlet, and each instance handles chatting between two clients at a max. However, as predicted, the idea didn't materialize! I tried to create an instance of the servlet but the only solution for that was using sessions on the servlet side, and I don't know how to use this session for later communications. I then tried to modify my broadcast-all code. In that code, I was using classes that implemented Observer and Observable interfaces. So the next idea that I got was: Create a new object of the Observable class(say class_1). This object be common to 2 clients. 2 clients that wish to chat will use same object of the class_1. 2 other clients will use a different object of class_1. But the problem here lies with the class that implements the Observer interface(say class_2). Since this has observers monitoring the same type of class, namely class_1, how do I establish an observer monitoring one object of class_1 and another observer monitoring another object of the same class class_1 (Because notifyObservers() would notify all the observers and I can't assign a particular observer to a particular object)? I first decided to ask individual problems, like how to create instances of servlets, using objects of observable and observer and so on in stackoverflow... but I got confused even more. Can anyone give me an idea how to establish chatting between two clients only?(I am using Http and not sockets or RMI). Regards, Mithun. P.S. Thanks to all who replied to my previous (absurd) queries. I should have stated the purpose earlier so that you guys could help me better.

    Read the article

  • Rails. Putting update logic in your migrations

    - by Daniel Abrahamsson
    A couple of times I've been in the situation where I've wanted to refactor the design of some model and have ended up putting update logic in migrations. However, as far as I've understood, this is not good practice (especially since you are encouraged to use your schema file for deployment, and not your migrations). How do you deal with these kind of problems? To clearify what I mean, say I have a User model. Since I thought there would only be two kinds of users, namely a "normal" user and an administrator, I chose to use a simple boolean field telling whether the user was an adminstrator or not. However, after I while I figured I needed some third kind of user, perhaps a moderator or something similar. In this case I add a UserType model (and the corresponding migration), and a second migration for removing the "admin" flag from the user table. And here comes the problem. In the "add_user_type_to_users" migration I have to map the admin flag value to a user type. Additionally, in order to do this, the user types have to exist, meaning I can not use the seeds file, but rather create the user types in the migration (also considered bad practice). Here comes some fictional code representing the situation: class CreateUserTypes < ActiveRecord::Migration def self.up create_table :user_types do |t| t.string :name, :nil => false, :unique => true end #Create basic types (can not put in seed, because of future migration dependency) UserType.create!(:name => "BASIC") UserType.create!(:name => "MODERATOR") UserType.create!(:name => "ADMINISTRATOR") end def self.down drop_table :user_types end end class AddTypeIdToUsers < ActiveRecord::Migration def self.up add_column :users, :type_id, :integer #Determine type via the admin flag basic = UserType.find_by_name("BASIC") admin = UserType.find_by_name("ADMINISTRATOR") User.all.each {|u| u.update_attribute(:type_id, (u.admin?) ? admin.id : basic.id)} #Remove the admin flag remove_column :users, :admin #Add foreign key execute "alter table users add constraint fk_user_type_id foreign key (type_id) references user_types (id)" end def self.down #Re-add the admin flag add_column :users, :admin, :boolean, :default => false #Reset the admin flag (this is the problematic update code) admin = UserType.find_by_name("ADMINISTRATOR") execute "update users set admin=true where type_id=#{admin.id}" #Remove foreign key constraint execute "alter table users drop foreign key fk_user_type_id" #Drop the type_id column remove_column :users, :type_id end end As you can see there are two problematic parts. First the row creation part in the first model, which is necessary if I would like to run all migrations in a row, then the "update" part in the second migration that maps the "admin" column to the "type_id" column. Any advice?

    Read the article

  • CSS - changing the font color for a from select option in firefox

    - by Mick
    I'm building a website for my church, and I'm teaching myself all about web design along the way. http://www.wilmingtonchurchofgod.org/contact_us.html is the link where you can see my issue. If you look at that page in firefox, and you click the select part of the form (next to, "Who would you like to contact?") you will see that when you hover over a choice, the font is white. I have tried various things to fix this, but can't find a solution. This seems to be specific to Firefox. Here is the relevant CSS. input, textarea, select, option{ padding: 6px; border: solid 1px #E5E5E5; outline: 0; font: normal 13px/100% Verdana, Tahoma, sans-serif; width: 200px; background: #FFFFFF url(images/from-grad.jpg) left top repeat-x; background: -webkit-gradient(linear, left top, left 25, from(#FFFFFF), color-stop(4%, #EEEEEE), to(#FFFFFF)); background: -moz-linear-gradient(top, #FFFFFF, #EEEEEE 1px, #FFFFFF 25px); box-shadow: rgba(0,0,0, 0.15) 0px 0px 8px; -moz-box-shadow: rgba(0,0,0, 0.15) 0px 0px 8px; -webkit-box-shadow: rgba(0,0,0, 0.15) 0px 0px 8px; } option{ padding:0px; } textarea { width: 400px; max-width: 400px; height: 150px; line-height: 150%; } input:hover, textarea:hover, input:focus, textarea:focus{ border-color: #C9C9C9; -webkit-box-shadow: rgba(0, 0, 0, 0.15) 0px 0px 8px; -moz-box-shadow: rgba(0,0,0, 0.15) 0px 0px 8px; } option:hover, option:focus, select:hover, select:focus { color: black; border-color: #C9C9C9; -webkit-box-shadow: rgba(0, 0, 0, 0.15) 0px 0px 8px; -moz-box-shadow: rgba(0,0,0, 0.15) 0px 0px 8px; } Another side note is that I can't get any background gradient at all to show up on Google Chome (yet it does on Safari and they are supposed to use the same kit?) Any help with these two things would be greatly appreciated.

    Read the article

  • Ignore order of elements using xs:extension

    - by Peter Lang
    How can I design my xsd to ignore the sequence of elements? <root> <a/> <b/> </root> <root> <b/> <a/> </root> I need to use extension for code generation reasons, so I tried the following using all: <?xml version="1.0" encoding="UTF-8"?> <xs:schema targetNamespace="http://www.example.com/test" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:t="http://www.example.com/test" > <xs:complexType name="BaseType"> <xs:all> <xs:element name="a" type="xs:string" /> </xs:all> </xs:complexType> <xs:complexType name="ExtendedType"> <xs:complexContent> <xs:extension base="t:BaseType"> <xs:all> <!-- ERROR --> <xs:element name="b" type="xs:string" /> </xs:all> </xs:extension> </xs:complexContent> </xs:complexType> <xs:element name="root" type="t:ExtendedType"></xs:element> </xs:schema> This xsd is not valid though, the following error is reported at <!-- ERROR -->: cos-all-limited.1.2: An all model group must appear in a particle with {min occurs} = {max occurs} = 1, and that particle must be part of a pair which constitutes the {content type} of a complex type definition. Documentation of cos-all-limited.1.2 says: 1.2 the {term} property of a particle with {max occurs}=1 which is part of a pair which constitutes the {content type} of a complex type definition. I don't really understand this (neither xsd nor English native speaker :) ). Am I doing the wrong thing, am I doing the right thing wrong, or is there no way to achieve this? Thanks!

    Read the article

  • What Amazon S3 .NET Library is most useful and efficient?

    - by Geo
    There are two main open source .net Amazon S3 libraries. Three Sharp LitS3 I am currently using LitS3 in our MVC demo project, but there is some criticism about it. Has anyone here used both libraries so they can give an objective point of view. Below some sample calls using LitS3: On demo controller: private S3Service s3 = new S3Service() { AccessKeyID = "Thekey", SecretAccessKey = "testing" }; public ActionResult Index() { ViewData["Message"] = "Welcome to ASP.NET MVC!"; return View("Index",s3.GetAllBuckets()); } On demo view: <% foreach (var item in Model) { %> <p> <%= Html.Encode(item.Name) %> </p> <% } %> EDIT 1: Since I have to keep moving and there is no clear indication of what library is more effective and kept more up to date, I have implemented a repository pattern with an interface that will allow me to change library if I need to in the future. Below is a section of the S3Repository that I have created and will let me change libraries in case I need to: using LitS3; namespace S3Helper.Models { public class S3Repository : IS3Repository { private S3Service _repository; #region IS3Repository Members public IQueryable<Bucket> FindAllBuckets() { return _repository.GetAllBuckets().AsQueryable(); } public IQueryable<ListEntry> FindAllObjects(string BucketName) { return _repository.ListAllObjects(BucketName).AsQueryable(); } #endregion If you have any information about this question please let me know in a comment, and I will get back and edit the question. EDIT 2: Since this question is not getting attention, I integrated both libraries in my web app to see the differences in design, I know this is probably a waist of time, but I really want a good long run solution. Below you will see two samples of the same action with the two libraries, maybe this will motivate some of you to let me know your thoughts. WITH THREE SHARP LIBRARY: public IQueryable<T> FindAllBuckets<T>() { List<string> list = new List<string>(); using (BucketListRequest request = new BucketListRequest(null)) using (BucketListResponse response = service.BucketList(request)) { XmlDocument bucketXml = response.StreamResponseToXmlDocument(); XmlNodeList buckets = bucketXml.SelectNodes("//*[local-name()='Name']"); foreach (XmlNode bucket in buckets) { list.Add(bucket.InnerXml); } } return list.Cast<T>().AsQueryable(); } WITH LITS3 LIBRARY: public IQueryable<T> FindAllBuckets<T>() { return _repository.GetAllBuckets() .Cast<T>() .AsQueryable(); }

    Read the article

  • How to define generic super type for static factory method?

    - by Esko
    If this has already been asked, please link and close this one. I'm currently prototyping a design for a simplified API of a certain another API that's a lot more complex (and potentially dangerous) to use. Considering the related somewhat complex object creation I decided to use static factory methods to simplify the API and I currently have the following which works as expected: public class Glue<T> { private List<Type<T>> types; private Glue() { types = new ArrayList<Type<T>>(); } private static class Type<T> { private T value; /* some other properties, omitted for simplicity */ public Type(T value) { this.value = value; } } public static <T> Glue<T> glueFactory(String name, T first, T second) { Glue<T> g = new Glue<T>(); Type<T> firstType = new Glue.Type<T>(first); Type<T> secondType = new Glue.Type<T>(second); g.types.add(firstType); g.types.add(secondType); /* omitted complex stuff */ return g; } } As said, this works as intended. When the API user (=another developer) types Glue<Horse> strongGlue = Glue.glueFactory("2HP", new Horse(), new Horse()); he gets exactly what he wanted. What I'm missing is that how do I enforce that Horse - or whatever is put into the factory method - always implements both Serializable and Comparable? Simply adding them to factory method's signature using <T extends Comparable<T> & Serializable> doesn't necessarily enforce this rule in all cases, only when this simplified API is used. That's why I'd like to add them to the class' definition and then modify the factory method accordingly. PS: No horses (and definitely no ponies!) were harmed in writing of this question.

    Read the article

  • How to generate and encode (for use in GA), random, strict, binary rooted trees with N leaves?

    - by Peter Simon
    First, I am an engineer, not a computer scientist, so I apologize in advance for any misuse of nomenclature and general ignorance of CS background. Here is the motivational background for my question: I am contemplating writing a genetic algorithm optimizer to aid in designing a power divider network (also called a beam forming network, or BFN for short). The BFN is intended to distribute power to each of N radiating elements in an array of antennas. The fraction of the total input power to be delivered to each radiating element has been specified. Topologically speaking, a BFN is a strictly binary, rooted tree. Each of the (N-1) interior nodes of the tree represents the input port of an unequal, binary power splitter. The N leaves of the tree are the power divider outputs. Given a particular power divider topology, one is still free to map the power divider outputs to the array inputs in an arbitrary order. There are N! such permutations of the outputs. There are several considerations in choosing the desired ordering: 1) The power ratio for each binary coupler should be within a specified range of values. 2) The ordering should be chosen to simplify the mechanical routing of the transmission lines connecting the power divider. The number of ouputs N of the BFN may range from, say, 6 to 22. I have already written a genetic algorithm optimizer that, given a particular BFN topology and desired array input power distribution, will search through the N! permutations of the BFN outputs to generate a design with compliant power ratios and good mechanical routing. I would now like to generalize my program to automatically generate and search through the space of possible BFN topologies. As I understand it, for N outputs (leaves of the binary tree), there are $C_{N-1}$ different topologies that can be constructed, where $C_N$ is the Catalan number. I would like to know how to encode an arbitrary tree having N leaves in a way that is consistent with a chromosomal description for use in a genetic algorithm. Also associated with this is the need to generate random instances for filling the initial population, and to implement crossover and mutations operators for this type of chromosome. Any suggestions will be welcome. Please minimize the amount of CS lingo in your reply, since I am not likely to be acquainted with it. Thanks in advance, Peter

    Read the article

  • generated service mock: everything but RhinoMocks fails?

    - by hko
    I have the "quest" to search for the next Mocking Framework for my company, and basically it's down to NSubstitute (simplest syntax, but no strict mocks), FakeItEasy(best reviews, Roy Osherove bonus, and slightly better lib support than NSubstitute), Moq (best "other libs support", biggest featureset, downside: mock.Object). We definitely want to move on from RhinoMocks, e.g. because of the unusefull interactiontest error messages (it should tell me what the parameter was instead, when a verification fails). So I was pretty surprised the other day (that was yesterday) when I found out RhinoMocks could do a thing where every other mock framework fails at: Mocking an autogenerated SomethingService (a typical VS autogenerated service with a default construtor in a partial class). Please don't argue about the design.. I intend to write lightweight integration tests (and some unit tests), and I can't mess around with the service, the product is installed on too many customers system. See this code: // here the NSubstitute and FakeItEasy equivalents throw an exception.. see below TicketStoreService fakeTicketStoreService = MockRepository.GenerateMock<TicketStoreService>(); fakeTicketStoreService.Expect(service => service.DoSomething(Arg.Is(new Guid())).Return(new Guid()); fakeTicketStoreService.DoSomething(Arg.Is(new Guid())); fakeTicketStoreService.VerifyAllExpectations(); Note that DoSomething is a non-virtual methodcall in an autogenerated class. So it shouldn't work, according to common knowledge. But it does. Problem is that it's the only (non commercial) framework that can do this: Rhino.Mocks works, and verification works too FakeItEasy says it doesn't find a default constructor (probably just wrong exception message): No default constructor was found on the type SomeNamespace.TicketStoreService Moq gives something sane and understandable: Invalid setup on a non-virtual (overridable in VB) member: service=> service.DoSomething Nsubstitute gives a message System.NotSupportedException: Cannot serialize member System.ComponentModel.Component.Site of type System.ComponentModel.ISite because it is an interface. I'm really wondering what's going on here with the frameworks, except Moq. The "fancy new" frameworks seem to have an initial perf hit too, probably preparing some Type cache and serializing stuff, whilst RhinoMocks somehow manages to create a very "slim" mock without recursion. I have to admit I didn't like RhinoMocks very well, but here it shines.. unfortunately. So, is there a way to get that to work with newer (non-commercial!) mocking frameworks, or somehow get a sane error message out of Rhino.Mocks? And why can Rhino.Mocks achieve this, when clearly every Mocking framework states it can only work with virtual methods when given a concrete class? Let's not derail the discussion by talking about alternative approaches like Extract&Override or runtime-proxy Mocking frameworks like JustMock/TypeMock/Moles or the new Fakes framework, I know these, but that would be less ideal solutions, for reasons beyond this topic. Any help appreciated..

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • IE8 rendering of local-files is wrong

    - by Eric
    It appears that IE8 is not rendering properly a local file: Consider this simple webpage: http://sayang.free.fr/ie8render.html (html code below) extracted from a w3c tutorial on opacity. Save it locally and display it again: the local file has no opacity! That's very annoying, especially when one wants to design complex pages on prototypes placed in local files. Do you have a solution to that ? <html> <head> <title>IE8 Local File</title> <meta http-equiv="Content-Type" content="text/html; charset=ISO-8859-1" /> <meta http-equiv="pragma" content="no-cache" /> <meta http-equiv="cache-control" content="no-cache" /> <meta http-equiv="expires" content="-1" /> <style type="text/css"> div.background { width: 500px; height: 250px; background: url(http://www.w3schools.com/css/klematis.jpg) repeat; border: 2px solid black; } div.transbox { width: 400px; height: 180px; margin: 30px 50px; background-color: #ffffff; border: 1px solid black; /* for IE */ filter:alpha(opacity=60); /* CSS3 standard */ opacity:0.6; } div.transbox p { margin: 30px 40px; font-weight: bold; color: #000000; } </style> </head> <body> <h2>Save this file locally and open it to see the difference</h2> <div class="background"> <div class="transbox"> <p>This is some text that is placed in the transparent box. This is some text that is placed in the transparent box. This is some text that is placed in the transparent box. This is some text that is placed in the transparent box. This is some text that is placed in the transparent box.</p> </div> </div> </body> </html>

    Read the article

  • Recommended textbook for machine-level programming?

    - by Norman Ramsey
    I'm looking at textbooks for an undergraduate course in machine-level programming. If the perfect book existed, this is what it would look like: Uses examples written in C or assembly language, or both. Covers machine-level operations such as two's-complement integer arithmetic, bitwise operations, and floating-point arithmetic. Explains how caches work and how they affect performance. Explains machine instructions or assembly instructions. Bonus if the example assembly language includes x86; triple bonus if it includes x86-64 (aka AMD64). Explains how C values and data structures are represented using hardware registers and memory. Explains how C control structures are translated into assembly language using conditional and unconditional branch instructions. Explains something about procedure calling conventions and how procedure calls are implemented at the machine level. Books I might be interested in would probably have the words "machine organization" or "computer architecture" in the title. Here are some books I'm considering but am not quite happy with: Computer Systems: A Programmer's Perspective by Randy Bryant and Dave O'Hallaron. This is quite a nice book, but it's a book for a broad, shallow course in systems programming, and it contains a great deal of material my students don't need. Also, it is just out in a second edition, which will make it expensive. Computer Organization and Design: The Hardware/Software Interface by Dave Patterson and John Hennessy. This is also a very nice book, but it contains way more information about how the hardware works than my students need. Also, the exercises look boring. Finally, it has a show-stopping bug: it is based very heavily on MIPS hardware and the use of a MIPS simulator. My students need to learn how to use DDD, and I can't see getting this to work on a simulator. Not to mention that I can't see them cross-compiling their code for the simulator, and so on and so forth. Another flaw is that the book mentions the x86 architecture only to sneer at it. I am entirely sympathetic to this point of view, but news flash! You guys lost! Write Great Code Vol I: Understanding the Machine by Randall Hyde. I haven't evaluated this book as thoroughly as the other two. It has a lot of what I need, but the translation from high-level language to assembler is deferred to Volume Two, which has mixed reviews. My students will be annoyed if I make them buy a two-volume series, even if the price of those two volumes is smaller than the price of other books. I would really welcome other suggestions of books that would help students in a class where they are to learn how C-language data structures and code are translated to machine-level data structures and code and where they learn how to think about performance, with an emphasis on the cache.

    Read the article

  • Hide a base class method from derived class, but still visible outside of assembly

    - by clintp
    This is a question about tidyness. The project is already working, I'm satisfied with the design but I have a couple of loose ends that I'd like to tie up. My project has a plugin architecture. The main body of the program dispatches work to the plugins that each reside in their own AppDomain. The plugins are described with an interface, which is used by the main program (to get the signature for invoking DispatchTaskToPlugin) and by the plugins themselves as an API contract: namespace AppServer.Plugin.Common { public interface IAppServerPlugin { void Register(); void DispatchTaskToPlugin(Task t); // Other methods omitted } } In the main body of the program Register() is called so that the plugin can register its callback methods with the base class, and then later DispatchTaskToPlugin() is called to get the plugin running. The plugins themselves are in two parts. There's a base class that implements the framework for the plugin (setup, housekeeping, teardown, etc..). This is where DispatchTaskToPlugin is actually defined: namespace AppServer.Plugin { abstract public class BasePlugin : MarshalByRefObject, AppServer.Plugin.Common.IAppServerPlugin { public void DispatchTaskToPlugin(Task t) { // ... // Eventual call to actual plugin code // } // Other methods omitted } } The actual plugins themselves only need to implement a Register() method (to give the base class the delegates to call eventually) and then their business logic. namespace AppServer.Plugin { public class Plugin : BasePlugin { override public void Register() { // Calls a method in the base class to register itself. } // Various callback methods, business logic, etc... } } Now in the base class (BasePlugin) I've implemented all kinds of convenience methods, collected data, etc.. for the plugins to use. Everything's kosher except for that lingering method DispatchTaskToPlugin(). It's not supposed to be callable from the Plugin class implementations -- they have no use for it. It's only needed by the dispatcher in the main body of the program. How can I prevent the derived classes (Plugin) from seeing the method in the base class (BasePlugin/DispatchTaskToPlugin) but still have it visible from outside of the assembly? I can split hairs and have DispatchTaskToPlugin() throw an exception if it's called from the derived classes, but that's closing the barn door a little late. I'd like to keep it out of Intellisense or possibly have the compiler take care of this for me. Suggestions?

    Read the article

  • PHP Menu Items More Button

    - by Adrian M.
    Hello, I use the bellow code to load the main menu elements from some CMS, the present code is perfect except that it loads ALL the main items on a single line of menu - which will make the width of it unusable in any centered design (under 1000px).. I want to change this script so after 15 main elements will add a "MORE" button under which the rest of the main menu items will show as sub-items of this "MORE" button (they will not have their own sub-items as the first 15 do).. How can I do it? Thanks! <?php require_once( '../../../inc/header.inc.php' ); require_once( DIRECTORY_PATH_INC . 'membership_levels.inc.php' ); require_once( DIRECTORY_PATH_ROOT . "templates/tmpl_{$tmpl}/scripts/TemplMenu.php" ); class SimpleMenu extends TemplMenu { function getCode() { $this->iElementsCntInLine = 100; $this->getMenuInfo(); $this->genTopItems(); return $this->sCode; } function genTopItem($sText, $sLink, $sTarget, $sOnclick, $bActive, $iItemID, $isBold = false, $sPicture = '') { $sActiveStyle = ($bActive) ? ' id="tm_active"' : ''; if (!$bActive) { $sAlt= $sOnclick ? ( ' alt="' . $sOnclick . '"' ) : ''; $sTarget = $sTarget ? ( ' target="_parent"' ) : ''; } $sLink = (strpos($sLink, 'http://') === false && !strlen($sOnclick)) ? $this->sSiteUrl . $sLink : $sLink; $sSubMenu = $this->getAllSubMenus($iItemID); $sImgTabStyle = $sPictureRep = ''; if ($isBold && $sPicture != '') { $sPicturePath = getTemplateIcon($sPicture); $sPictureRep = "<img src='{$sPicturePath}' style='vertical-align:middle;width:16px;height:16px;' />"; $sText = '&nbsp;'; $sImgTabStyle = 'style="width:38px;"'; } $sMainSubs = ($sSubMenu=='') ? '' : " {$sSubMenu} </a>"; $this->sCode .= " <li><a href='{$sLink}' {$sOnclick} target='_parent'>{$sPictureRep}{$sText}</a> <div id='submenu'> <ul> <li>{$sMainSubs}</li> </ul> </div> </li> "; } } $objMenu = new SimpleMenu(); echo "<ul id='ddmenu'>"; echo $objMenu->getCode(); echo "</ul>"; ?>

    Read the article

  • Unique_ptr compiler errors

    - by Godric Seer
    I am designing and entity-component system for a project, and C++ memory management is giving me a few issues. I just want to make sure my design is legitimate. So to start I have an Entity class which stores a vector of Components: class Entity { private: std::vector<std::unique_ptr<Component> > components; public: Entity() { }; void AddComponent(Component* component) { this -> components.push_back(std::unique_ptr<Component>(component)); } ~Entity(); }; Which if I am not mistaken means that when the destructor is called (even the default, compiler created one), the destructor for the Entity, will call ~components, which will call ~std::unique_ptr for each element in the vector, and lead to the destruction of each Component, which is what I want. The component class has virtual methods, but the important part is its constructor: Component::Component(Entity parent) { parent.addComponent(this) // I am not sure if this would work like I expect // Other things here } As long as passing this to the method works, this also does what I want. My confusion is in the factory. What I want to do is something along the lines of: std::shared_ptr<Entity> createEntity() { std::shared_ptr<Entity> entityPtr(new Entity()); new Component(*parent); // Initialize more, and other types of Components return entityPtr; } Now, I believe that this setup will leave the ownership of the Component in the hands of its Parent Entity, which is what I want. First a small question, do I need to pass the entity into the Component constructor by reference or pointer or something? If I understand C++, it would pass by value, which means it gets copied, and the copied entity would die at the end of the constructor. The second, and main question is that code based on this sample will not compile. The complete error is too large to print here, however I think I know somewhat of what is going on. The compiler's error says I can't delete an incomplete type. My Component class has a purely virtual destructor with an implementation: inline Component::~Component() { }; at the end of the header. However since the whole point is that Component is actually an interface. I know from here that a complete type is required for unique_ptr destruction. The question is, how do I work around this? For reference I am using gcc 4.4.6.

    Read the article

  • Stuck with jQuery thumbnail gallery behavior

    - by Vitor
    Hi everyone, I'm trying to create a simple thumbnail viewer with jQuery. Here goes the code: $(function(){ $("ul.thumbnails li").click(function(e){ var imgAlt = $(this).find('img').attr("alt"); //Get Alt Tag of Image var imgTitle = $(this).find('a').attr("href"); //Get Main Image URL $("img.featured").attr({ src: imgTitle , alt: imgAlt}); //Switch the main image (URL + alt tag) }); <div class="image-gallery"> <img class="featured" src="big.jpg"> <ul class="thumbnails"> <li id="thumb01"> <a href="big.jpg"><img src="small.jpg"></a> </li> <li id="thumb02"> <a href="big.jpg"><img src="small.jpg"></a> </li> <li id="thumb03"> <a href="big.jpg"><img src="small.jpg"></a> </li> </ul> .thumbnails li { margin: 0; padding: 5px 5px 0 5px; list-style: none; float: left; overflow: hidden; } thumbnails li img { width: 50px; height: 50px; margin: 0; padding: 0; float: left; } If i click the thumbnail, the browser goes straight to the full image instead of just changing the img src with jQuery. But I if i click somewhere inside the <li> it works. I know this must be simple, but I don't know where I'm going wrong. I've tried studying other galleries, like http://www.sohtanaka.com/web-design/examples/image-rotator/ , but couldn't find what I'm missing. I could really use some help from you guys :)

    Read the article

  • how Can we get the output format to CSV instead of HTML in Alfresco using webscripts?

    - by pavan123
    how Can we change the output format to CSV instead of HTML in Alfresco using webscripts? below are the my corresponding FTL and Webscript files recursive.get.html.ftl <#macro recurse_macro node depth> <#if node.isContainer> <tr> <td> ${node.properties.name} </td> <td></td> </tr> <#list node.children as child> <#if child.isContainer> <@recurse_macro node=child depth=depth+1/> <#list child.children as child2> <#if child2.isDocument> <tr><td></td><td>${child2.properties.name}</td></tr> </#if> </#list> </#if> </#list> </#if> </#macro> Recursive Listing of Spaces & Documents: Space Document recursive.get.desc.xml <webscript> <shortname>recurcive</shortname> <description>Recursive</description> <url>/sample/recursive/{recursive}</url> <format default="html">extension</format> <authentication>guest</authentication> </webscript> and html output is Recursive Listing of Spaces & Documents: Space Document Company Home Data Dictionary Space Templates Software Engineering Project Documentation Drafts Pending Approval Published Samples system-overview.html Discussions UI Design Presentations Quality Assurance Presentation Templates doc_info.ftl localizable.ftl my_docs.ftl my_spaces.ftl my_summary.ftl translatable.ftl recent_docs.ftl general_example.ftl my_docs_inline.ftl show_audit.ftl readme.ftl Email Templates notify_user_email.ftl invite_user_email.ftl RSS Templates RSS_2.0_recent_docs.ftl Saved Searches admin Scripts backup.js example test script.js backup and log.js append copyright.js alfresco docs.js test return value.js Web Scripts org alfresco sample blogsearch.get.js blogsearch.get.atom.ftl blogsearch.get.desc.xml blogsearch.get.html.ftl blogsearch.get.html.400.ftl blogsearch.get.atom.400.ftl categorysearch.get.js categorysearch.get.atom.ftl categorysearch.get.desc.xml categorysearch.get.html.ftl categorysearch.get.html.404.ftl categorysearch.get.atom.404.ftl folder.get.js folder.get.atom.ftl folder.get.desc.xml folder.get.html.ftl avmstores.get.desc.xml avmstores.get.html.ftl avmbrowse.get.js avmbrowse.get.desc.xml avmbrowse.get.html.ftl recursive.get.desc.xml recursive.get.html.ftl sgs.get.desc.xml sgs.get.csv.ftl sample1.get.desc.xml sample1.get.csv.ftl first.get.desc.xml first.get.text.ftl rag.get.html.ftl rag.get.desc.xml new1.get.desc.xml new1.get.html.ftl excel.get.html.ftl excel.get.desc.xml sgs1.get.desc.xml one.get.html.ftl one.get.desc.xml one.get.js readme.html Web Scripts Extensions readme.html Guest Home Alfresco-Tutorial.pdf User Homes isabel Users Home

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Problem writing HTML content to Word document in ASP.NET

    - by saran
    I am trying to export the HTML page contents to Word. My Html display page is: What is your favourite color? NA List the top three school ? one National two Devs three PS And a button for click event. The button click event will open MS word and paste the page contents in word. The word page contains the table property of html design page. It occurs only in Word 2003. But in word 2007 the word document contains the text with out table property. How can I remove this table property in word 2003. I am not able to add the snapshots. Else i will make you clear. I am designing the web page by aspx. I am exporting the web page content by the following code. protected void Button1_Click(object sender, EventArgs e) { Response.ContentEncoding = System.Text.Encoding.UTF7; System.Text.StringBuilder SB = new System.Text.StringBuilder(); System.IO.StringWriter SW = new System.IO.StringWriter(); System.Web.UI.HtmlTextWriter htmlTW = new System.Web.UI.HtmlTextWriter(SW); tbl.RenderControl(htmlTW); string strBody = "<html>" + "<body>" + "<div><b>" + htmlTW.InnerWriter.ToString() + "</b></div>" + "</body>" + "</html>"; Response.AppendHeader("Content-Type", "application/msword"); Response.AppendHeader("Content-disposition", "attachment; filename=" + fileName); Response.ContentEncoding = System.Text.Encoding.UTF7; string fileName1 = "C://Temp/Excel" + DateTime.Now.Millisecond.ToString(); BinaryWriter writer = new BinaryWriter(File.Open(fileName1, FileMode.Create)); writer.Write(strBody); writer.Close(); FileStream fs = new FileStream(fileName1, FileMode.Open, FileAccess.Read); byte[] renderedBytes; // Create a byte array of file stream length renderedBytes = new byte[fs.Length]; //Read block of bytes from stream into the byte array fs.Read(renderedBytes, 0, System.Convert.ToInt32(fs.Length)); //Close the File Stream fs.Close(); FileInfo TheFile = new FileInfo(fileName1); if (TheFile.Exists) { File.Delete(fileName1); } Response.BinaryWrite(renderedBytes); Response.Flush(); Response.End(); }

    Read the article

  • PHP Menu Items Count then add under more button

    - by Adrian M.
    Hello, I use the bellow code to load the main menu elements from some CMS, the present code is perfect except that it loads ALL the main items on a single line of menu - which will make the width of it unusable in any centered design (under 1000px).. I want to change this script so after 15 main elements will add a "MORE" button under which the rest of the main menu items will show as sub-items of this "MORE" button (they will not have their own sub-items as the first 15 do).. How can I do it? Thanks! <?php require_once( '../../../inc/header.inc.php' ); require_once( DIRECTORY_PATH_INC . 'membership_levels.inc.php' ); require_once( DIRECTORY_PATH_ROOT . "templates/tmpl_{$tmpl}/scripts/TemplMenu.php" ); class SimpleMenu extends TemplMenu { function getCode() { $this->iElementsCntInLine = 100; $this->getMenuInfo(); $this->genTopItems(); return $this->sCode; } function genTopItem($sText, $sLink, $sTarget, $sOnclick, $bActive, $iItemID, $isBold = false, $sPicture = '') { $sActiveStyle = ($bActive) ? ' id="tm_active"' : ''; if (!$bActive) { $sAlt= $sOnclick ? ( ' alt="' . $sOnclick . '"' ) : ''; $sTarget = $sTarget ? ( ' target="_parent"' ) : ''; } $sLink = (strpos($sLink, 'http://') === false && !strlen($sOnclick)) ? $this->sSiteUrl . $sLink : $sLink; $sSubMenu = $this->getAllSubMenus($iItemID); $sImgTabStyle = $sPictureRep = ''; if ($isBold && $sPicture != '') { $sPicturePath = getTemplateIcon($sPicture); $sPictureRep = "<img src='{$sPicturePath}' style='vertical-align:middle;width:16px;height:16px;' />"; $sText = '&nbsp;'; $sImgTabStyle = 'style="width:38px;"'; } $sMainSubs = ($sSubMenu=='') ? '' : " {$sSubMenu} </a>"; $this->sCode .= " <li><a href='{$sLink}' {$sOnclick} target='_parent'>{$sPictureRep}{$sText}</a> <div id='submenu'> <ul> <li>{$sMainSubs}</li> </ul> </div> </li> "; } } $objMenu = new SimpleMenu(); echo "<ul id='ddmenu'>"; echo $objMenu->getCode(); echo "</ul>"; ?>

    Read the article

  • JSON or YAML encoding in GWT/Java on both client and server

    - by KennethJ
    I'm looking for a super simple JSON or YAML library (not particularly bothered which one) written in Java, and can be used in both GWT on the client, and in its original Java form on the server. What I'm trying to do is this: I have my models, which are shared between the client and the server, and these are the primary source of data interchange. I want to design the web service in between to be as simple as possible, and decided to take the RESTful approach. My problem is that I know our application will grow substantially in the future, and writing all the getters, setters, serialization, factories, etc. by hand fills me with absolute dread. So in order to avoid it, I decided to implement annotations to keep track of attributes on the models. The reason I can't just serialize everything directly, using GWT's own one, or one which works through reflection, is because we need a certain amount of logic going on in the serialization process. I.e. whether references to other models get serialized during the serialization of the original model, or whether an ID is just passed, and general simple things like that. I've then written an annotation processor to preprocess my shared models and generate an implementing class with all the getters, setters, serialization, lazy-loading, etc. To make a long story short, I need some type of simple YAML or JSON library, which allows me to encode and decode manually, so I can generate this code through my annotation processor. I have had a look around the interwebs, but every single one I ran into supported some reflection which, while all fine and dandy, make it pretty much useless for GWT. And in the case of GWT's own JSON library, it uses JSNI for speed purposes, making it useless server side. One solution I did think about involved writing writing two sets of serialization methods on the models, one for the client and one for the server, but I'd rather not do that. Also, I'm pretty new to GWT, and even though I have done a lot of Java, it was back in the 1.2 days, so it's a bit rusty. So if you think I'm going about this problem completely the wrong way, I'm open to suggestions.

    Read the article

  • Looking for an Open Source Project in need of help

    - by hvidgaard
    Hi StackOverflow! I'm a CS student on well on my way to graduate. I have had a difficult time of finding relevant student jobs (they seems to be taken merely hours after the notice gets on the board) , so instead I'm looking for an open source project in need of help. I'm aware that I should choose one that I use, but I'm not aware of any OS-project that I use that needs help. That's why I'm asking you. I don't have any deep experience, but I here are some of my biggest projects so far: BitTorrent-ish client in Python (a subset of BitTorrent) HTTP 1.1 webserver in Java Compiler from a subset of Java to run on JRE Flash-framework project to model an iPad look and feel (not to run actual iPad programs) complete with an API for programs. Complete MySQL database for a booking system, with departure and arrival times, so you could only book valid tickets (with a Java frontend). I know, Java and languages like AS3 and C# feels natural per se, Python, and have done a fair bit of hacking around in C, but I don't feel very comfortable with it. Mostly I'm afraid to make a fuckup because I have such a high degree of control. I would like to think I'm well aware of good software design practices, but in reality what I do is ask myself "would I like to use/maintain this?", and I love to refactor my code because I see optimizations. I love algorithms and to make them run in the best possible time. I don't have any preferred domain to work in, but I wouldn't mind it to be graphics or math heavy. Ideally I'm looking for a project in C++ to learn the in's and out's of it, but I'm well aware that I don't know that language very well. I would like to have a mentor-like figure until I'm confident enough to stand on my own, not one to review all my code (I'm sure someone will to start with anyway), but to ask questions about the project and language in question. I do have a wife and two children, so don't expect me to put in 10+ hours every week. In return I can work on my own, I strive to program modular and maintainable code. Know how to read an API, use Google, StackOverflow and online resources in general. If you have any questions, shoot. I'm looking forward to your suggestions.

    Read the article

< Previous Page | 582 583 584 585 586 587 588 589 590 591 592 593  | Next Page >