Search Results

Search found 1322 results on 53 pages for 'manish kumar singh'.

Page 6/53 | < Previous Page | 2 3 4 5 6 7 8 9 10 11 12 13  | Next Page >

  • pound sign is not working in mail content using java.mail package?

    - by kumar kasimala
    HI all, I am using javax.mail packaage MINEMESSAGE,MimeMultipart class to send a mail, but even though I mention type utf-8, unicode characters are not working in body text. like pound sign is not working. please help what to do. here is my message headers To: kumar[email protected] Message-ID: <875158456.1.1294898905049.JavaMail.root@nextrelease> Subject: My Site Free Trial - 5 days left MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="----=_Part_0_1733237863.1294898905008" MyHeaderName: myHeaderValue Date: Thu, 13 Jan 2011 06:08:25 +0000 (UTC) ------=_Part_0_1733237863.1294898905008 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable

    Read the article

  • list-index hibernate ?

    - by kumar kasimala
    Hi I am bit confusion of list index type,my mapping file has like below <list name="transactionItems" cascade="save-update,delete-orphan" lazy="false"> <key column="TRANSACTION_ID" /> <list-index column="IDX" /> <one-to-many class="TransactionItem" /> </list> whenever hibernate load a mapped object,its through exception null index column for collection:transactionItems please suggest me what can be the problem here. can you exaplain a bit about list-index? thanks & Regards kumar kasiamla India,Hyderabad.

    Read the article

  • How to write java program to increase file limit using ulimit

    - by Sunil Kumar Sahoo
    I am using Fedora linux where ulimit -n 10000 increases file limit upto 10000. I want to achieve the same using java program How to write java program to increase file limit using ulimit I have tried with the below program but it didnot work well. The program didnot give any error. but didnot increase file limit also public class IncreaseFIle { public static void main(String[] args) { String command = "/bin/bash ulimit -n 10000"; // String command = "pwd"; try { Runtime.getRuntime().exec(command); } catch (IOException ex) { ex.printStackTrace(); } } } Thanks Sunil Kumar Sahoo

    Read the article

  • How to detect internet connectivity using java program

    - by Sunil Kumar Sahoo
    How to write a java program which will tell me whether I have internet access or not. I donot want to ping or create connection with some external url because if that server will be down then my program will not work. I want reliable way to detect which will tell me 100% guarantee that whether I have internet connection or not irrespective of my Operating System. I want the program for the computers who are directly connected to internet. I have tried with the below program URL url = new URL("http://www.xyz.com/"); URLConnection conn = url.openConnection(); conn.connect(); I want something more appropriate than this program Thanks Sunil Kumar Sahoo

    Read the article

  • How to maximize java swing application

    - by Sunil Kumar Sahoo
    Hi All, I have created a login page using java swing. and i created jar for the application. Now when I run the jar then my login page is displayed then i minimize the application and again run the jar then another instance of my application is displayed (means now in my system I have two login page. 1 is in minimized format and another is in normal state. But I want that if in my system login page is already running and is minimized then if i run the jar once again then it will not start as a new application rather it should maximize the earlier login page. How to achieve this type of functionality ? please help me Thanks Sunil Kumar Sahoo

    Read the article

  • generate all subsets of size k from a set

    - by Kumar
    hi, i want to generate all the subsets of size k from a set. eg:-say i have a set of 6 elements, i have to list all the subsets in which the cardinality of elements is 3. I tried looking for solution,but those are code snippets. Its been long since I have done coding,so I find it hard to understand the code and construct a executable program around it. A complete executable program in C or C++ will be quite helpful. Hoping of an optimal solution using recursion. Thanks in advance. Kumar.

    Read the article

  • A Multi-Channel Contact Center Can Reduce Total Cost of Ownership

    - by Tom Floodeen
    In order to remain competitive in today’s market, CRM customers need to provide feature-rich superior call center experience to their customers across all communication channels while improving their service agent productivity. They also require their call center to be deeply integrated with their CRM system; and they need to implement all this quickly, seamlessly, and without breaking the bank. Oracle’s Siebel Customer Relationship Management (CRM) is the world’s leading application suite for automated customer-facing operations for Sales and Marketing and for managing all aspects of providing service to customers. Oracle’s Contact On Demand (COD) is a world-class carrier grade hosted multi-channel contact center solution that can be deployed in days without up-front capital expenditures or integration costs. Agents can work efficiently from anywhere in the world with 360-degree views into customer interactions and real-time business intelligence. Customers gain from rapid and personalized sales and service, while organizations can dramatically reduce costs and increase revenues Oracle’s latest update of Siebel CRM now comes pre-integrated with Oracle’s Contact On Demand. This solution seamlessly runs fully-functional contact center provided by a single vendor, significantly reducing your total cost of ownership. This solution supports Siebel 7.8 and higher for Voice and Siebel 8.1 and higher for Voice and Siebel CRM Chat.  The impressive feature list of Oracle’s COD solution includes full-control CTI toolbar with Voice, Chat, and Click to Dial features.  It also includes context-sensitive screens, automated desktops, built-in IVR, Multidimensional routing, Supervisor and Quality monitoring, and Instant Provisioning. The solution also ships with Extensible Web Services interface for implementing more complex business processes. Click here to learn how to reduce complexity and total cost of ownership of your contact center. Contact Ann Singh at [email protected] for additional information.

    Read the article

  • ArchBeat Link-o-Rama for 2012-07-11

    - by Bob Rhubart
    Is the future of retail showrooming? | GigaOm "The digital shopper isn’t just digital and she expects to be served seamlessly across all channels, physical and digital," reports GigaOm. Twenty years into the Internet era and the changes just keep coming. Solution architects take note... Agile Bureaucracy: When Practices become Principles | Jim Highsmith.com "Principles and values are a critical part of keeping individuals in organizations aligned and engaged," says Agile guru Jim Highsmith, "but the more pseudo-principles are piled on top of principles, the less and less organizations are able to adapt." Oracle Fusion Applications 11g Basics | Michel Schildmeijer "We are trying to build up a Oracle Fusion Apps environment on a Exalogic system, though still on bare metal, because officially there still is no Oracle VM available yet on Exalogic," says Michel Schildmeijer, an Oracle Fusion Middleware Architect at Qualogy. "It is a bit of a challenge, but getting to know the basics and which components the install, build and configure phase use, might bring you a step further on the way." Process Centric Banking: Loan Origination Solution | Manish Palaparthy This interesting, detailed post by Manish Palaparthy explains the process behind the execution of a proof-of-concept for a Fusion Middleware-based loan-origination solution for a bank. The solution incorporates Oracle BPM Suite, Webcenter, and ADF technolgies in a SOA infrastructure. How eBay and Facebook are Cleaning Up Data Centers | Amy Gallo - HBR The Cloud has needs! As reported by Amy Gallo in an article in the Harvard Business Review, "The electricity demand of data centers and the telecommunications network is rivaling that of most nations. If the cloud were itself a country, it would rank fifth in the world on energy demand behind the U.S., China, Russia, and Japan." Do WebLogic configuration from ANT | Edwin Biemond "With WebLogic WLST you can script the creation of all your Application DataSources or SOA Integration artifacts( like JMS etc)," says Oracle ACE Edwin Biemond. "This is necessary if your domain contains many WebLogic artifacts or you have more then one WebLogic environment. If so, you want to script this so you can configure a new WebLogic domain in minutes and you can repeat this task with always the same result." Oracle Special-Edition E-Book: Cloud Architecture for Dummies Learn how to architect and model your cloud implementation to drive efficiency and leverage economies of scale with Cloud Architecture for Dummies, a free Oracle e-book. (Registration required.) Thought for the Day "One of the best things to come out of the home computer revolution could be the general and widespread understanding of how severely limited logic really is." — Frank Herbert Source: SoftwareQuotes.com

    Read the article

  • Design The Way Search Engines Like To See

    Designing a website does not require creativity and imagination only, but also a pinch of experience. Many times web designers high on confidence and low in experience commit some mistakes, though un... [Author: Manish Rawat - Web Design and Development - June 06, 2010]

    Read the article

  • Benefits of PSD to HTML Service? For Whom and How

    With the advent of Internet and e-industry, most of the companies create website and hire web development professionals. And it is also true that the process of converting a design into web pages is ... [Author: Manish Rawat - Web Design and Development - June 13, 2010]

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Cannot get Correct month for a call from call log history

    - by Nishant Kumar
    I am trying to extract information from the call log of the android. I am getting the call date that is one month back from the actual time of call. I mean to say that the information extracted by my code for the date of call is one mont back than the actual call date. I have the following in the Emulator: I saved a contact. Then I made a call to the contact. Code: I have 3 ways of extracting call Date information but getting the same wrong result. My code is as follows: /* Make the query to call log content */ Cursor callLogResult = context.getContentResolver().query( CallLog.Calls.CONTENT_URI, null, null, null, null); int columnIndex = callLogResult.getColumnIndex(Calls.DATE); Long timeInResult = callLogResult.getLong(columnIndex); /* Method 1 to change the milliseconds obtained to the readable date formate */ Time time = new Time(); time.toMillis(true); time.set(timeInResult); String callDate= time.monthDay+"-"+time.month+"-"+time.year; /* Method 2 for extracting the date from tha value read from the column */ Calendar calendar = Calendar.getInstance(); calendar.setTimeInMillis(time); String Month = calendar.get(Calendar.MONTH) ; /* Method 3 for extracting date from the result obtained */ Date date = new Date(timeInResult); String mont = date.getMonth() While using the Calendar method , I also tried to set the DayLight SAving Offset but it didnot worked, calendar.setTimeZone(TimeZone.getTimeZone("Europe/Paris")); int DST_OFFSET = calendar.get( Calendar.DST_OFFSET ); // DST_OFFSET Boolean isSet = calendar.getTimeZone().useDaylightTime(); if(isSet) calendar.set(Calendar.DST_OFFSET , 0); int reCheck = calendar.get(Calendar.DST_OFFSET ); But the value is not set to 0 in recheck. I am getting the wrong month value by using this also. Please some one help me where I am wrong? or is this the error in emulator ?? Thanks, Nishant Kumar Engineering Student

    Read the article

  • FMS NetConnection.Connect.Close happening when starts and even in the middle of video in Flash with

    - by Sunil Kumar
    Hi I have developed a Flash Video player in Flash CS3 with Action Script 2.0 to play video from Adobe Flash Media Server 3.5. To play video from FMS 3.5, first I have to verify my swf file on FMS 3.5 server console so that it can be ensure that RTMP video URL only be play in verified SWF file. Right now I am facing problem of "NetConnection.Connect.Close" when I try to connect my NetConnection Object to FMS 3.5 to stream video from that server. So now I am getting this message "NetConnection.Connect.Close" from FMS 3.5. When this is happening in my office area at the same time when I am checking the the same video url from out side the office (With help of my friends who is in another office) area it is working fine. My friends naver faced even a single issue with NetConnection.Connect.Close. But in my office when I got message NetConnection.Connect.Close, I can play another streaming video very well like mtv.com jaman.com rajshri.com etc. Some time FMS works fine and video starts playing but in the middle of the video same thing happen "NetConnection.Connect.Close" There is no issue of Bandwidth in my office. I do't know why this is happening. Please see the message when I am getting "NetConnection.Connect.Close" message. NetConn == data: NetConn == objectEncoding: 0 NetConn == description: Connection succeeded. NetConn == code: NetConnection.Connect.Success NetConn == level: status NetConn == level: status NetConn == code: NetConnection.Connect.Closed Please help Thanks & regards Sunil Kumar

    Read the article

  • which xml validator will work perfectly for multithreading project

    - by Sunil Kumar Sahoo
    Hi All, I have used jdom for xml validation against schema. The main problem there is that it gives an error FWK005 parse may not be called while parsing The main reason was that multiple of threads working for xerces validation at the same time. SO I got the solution that i have to lock that validation. which is not good So I want to know which xml validator works perfectly for multithreading project public static HashMap validate(String xmlString, Validator validator) { HashMap<String, String> map = new HashMap<String, String>(); long t1 = System.currentTimeMillis(); DocumentBuilder builder = null; try { //obtain lock to proceed // lock.lock(); try { builder = DocumentBuilderFactory.newInstance().newDocumentBuilder(); // Source source = new DOMSource(builder.parse(new ByteArrayInputStream(xmlString.getBytes()))); validator.validate(new StreamSource(new StringReader(xmlString))); map.put("ISVALID", "TRUE"); logger.info("We have successfuly validated the schema"); } catch (Exception ioe) { ioe.printStackTrace(); logger.error("NOT2 VALID STRING IS :" + xmlString); map.put("MSG", ioe.getMessage()); // logger.error("IOException while validating the input XML", ioe); } logger.info(map); long t2 = System.currentTimeMillis(); logger.info("XML VALIDATION TOOK:::" + (t2 - t1)); } catch (Exception e) { logger.error(e); } finally { //release lock // lock.unlock(); builder = null; } return map; } Thanks Sunil Kumar Sahoo

    Read the article

  • How to play .3gp videos in mobile using RTMP (FMS) and HTTP?

    - by Sunil Kumar
    Hi I am not able to play video on mobile device which is .3gp container and H.263 / AMR_NB encoded. I just want to play my website videos in mobile device also just like youtube.com. I want to use RTMP and HTTP both. My requirement is as follows- Which codec and container will be best? Should I use FLV to play video on mobile device? RTSP required or can be use RTMP? Is NetStream and NetConnection methods different from Flash Player in Flash Lite Player? How to play 3gp video using RTMP stream ie. ns.play(“mp4:mobilevideo.3gp”, 0, -1, true) is it ok or any thing else required? For mobile browser and computer browser, can I use single player or I have to make different player for computer browser and mobile browser? It would be better if I can do it with single player for both mobile and computer browser. Sample code required for testing. If you can. I got below article in which they mention that we can play video 3gp container in mobile also. Please find the article. Articles URL- http://www.hsharma.com/tech/articles/flash-lite-30-video-formats-and-video-volume/ http://www.adobe.com/devnet/logged_in/dmotamedi_fms3.html Thanks Sunil Kumar

    Read the article

  • android odbc connection

    - by Vijay Kumar
    i want to connect odbc connection for my android application. Here in my program i'm using oracle database 11g and my table name is sample. After i run the program close the emulator open the database the values could not be stored. Please give one solution or any changes in my program or connection string. package com.odbc; import java.sql.Connection; import java.sql.DriverManager; import java.sql.PreparedStatement; import android.app.Activity; import android.os.Bundle; public class OdbcActivity extends Activity { /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); String first="vijay"; String last="kumar"; try { DriverManager.registerDriver(new oracle.jdbc.driver.OracleDriver()); Connection con=DriverManager.getConnection("jdbc:oracle:thin:@localshot:1521:XE","system","vijay"); PreparedStatement pst=con.prepareStatement("insert into sample(first,last) values(?,?"); pst.setString(1,first); pst.setString(2,last); pst.executeUpdate(); } catch(Exception e) { System.out.println("Exception:"+e); } } }

    Read the article

  • Help regarding Android NDK

    - by Siva Kumar
    I am a beginner in using Android NDK. I am using Eclipse and I installed cygwin to build the c file to generate the .so file But while building the c file in cygwin I am always getting the error make: ***No rule to make target 'file.c' ... .Stop I tried building different C codes but for every file it says the same error .. Here is the source code: public class ndktest extends Activity { static { System.loadLibrary("ndkt"); } private native void helloLog(String logThis); @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); helloLog("this is to test log file"); } } file.c void Java_com_ndktest_helloLog(JNIEnv * env, jobject this, jstring logThis) { jboolean isCopy; const char * szLogThis = (*env)->GetStringUTFChars(env, logThis, &isCopy); (*env)->ReleaseStringUTFChars(env, logThis, szLogThis); } And here is my Android.mk LOCAL_PATH := $(call my-dir) include $(CLEAR_VARS) LOCAL_LDLIBS := -llog LOCAL_MODULE := ndkt LOCAL_SRC_FILES := file.c include $(BUILD_SHARED_LIBRARY) I searched for the solution for the cause of error ... but nothing works for me. Can anyone tell me where I am making the mistake ? Thanks, Siva Kumar

    Read the article

  • How to fix "Xlib: extension "RECORD" missing on display :1" in vnc session?

    - by Manish Sapariya
    I am running a JNativeHook capture program on Ubuntu. When I run the session on default X session things are working fine. However when I run the same program from vnc session, it fails with "Xlib: extension "RECORD" missing on display". I checked that this extension is loaded in X which is started by display manager/init. However I am not sure if indeed is initialized during vncserver startup. I could not see anything related in the vnc log. I tried create custom xorg.conf with Module section, which explicitly loads RECORD extension as suggested by many posts but did not help. My environment: Xorg-server: 2.1.12.4-6 tightvncserver: 1.3.9 The same thing works fine on my CentOS 6.4 setup.

    Read the article

  • Prioritize bit torrent traffic

    - by Manish Mathai
    Hi, I would like to know how to prioritize traffic from various applications. Specifically I want to know if there is a way to give web traffic higher priority over bit torrent traffic. OS : Windows XP Browser : Firefox Bittorrent client : uTorrent Can I somehow shape the traffic such that, when I am browsing, bittorrent traffic gets suppressed (but not completely) and once no web traffic is detected , it is allowed to continue at full speed ?

    Read the article

  • Not able to connect to a mac client from a windows machine

    - by Manish
    I have a Server.exe file which I use to connect to a mac.(I am fairly confident that server.exe is not buggy ).When i try to do this I get this often cited error "No connection could be made because the target machine actively refused it " I did search some existing questions about this on the forum and it looked like this might be a firewall issue.FWIW I dont have any firewall set on my mac (client) and on my server machine (Windows 7 64 bit ) under the firewall settings I have :- Incoming connections : Block all connections to programs that are not on the list of allowed programs. Active Domain Networks: Same domain as the one which my client is on. Windows Firewire State: Off. Do you think i need to change something here?Can someone help me with next steps?

    Read the article

  • Installing perforce visual client on linux

    - by Manish
    I am from Mac background trying my hand at installing perforce client visual(P4V) on my linux box.For this I download the correct version here and untar the files. Then I cd to the directory ~/Desktop/p4v-2012-blah-blah/bin I also say chmod +x p4* After this i try running p4v (by double clicking) but I dont see anything .The file type is shown as a "text executable" but i dont know why it is not running. On mac i had done the same thing -just clicked on p4v and the client would show up(where I filled the server address and everything )But not sure what is going wrong here.Can someone give me directions? FWIW i did check out this link .

    Read the article

  • how to change document root to public_html from root directory

    - by manish
    For testing I hosted my website on free server from 000webhost.com They have a directory structure:- (root folder) \ (public folder) \public_html this directory structure enables to keep all the library files in root folder and all public data in \public_html, so I developed my website accordingly, and my final structure looked like:- / /include(this folder contains library files) /logs(log files) /public_html /public_html/index.php /public_html/home.php /public_html/and other public files on 000webhost makes only public_folder available to be accessed via url and my url looked neat and clean like www.xample.com/index.php or www.example.com/home.php but after completion of development I moved website to shared host purchased from go-daddy.com, now they do not have any such kind of directory permission, all the files are kept in root folder and are accessible via url also url has become like:- www.example.com/public_html/home.php or www.example.com/public_html/index.php How should I redirect url request to public_html folder again so as to make library file unavailable to public access and make url neat and clean.

    Read the article

  • How does NetCut work ?

    - by Manish Mathai
    NetCut is a software which enables a network admin to turn off the internet connection of any machine in a LAN. I want to know how it works. It has something to do with spurious ARP packets, however can't seem to find exactly how it works. I am looking for a detailed answer. Any takers ?

    Read the article

  • Connecting to local Sql server 2005 through Internet

    - by Manish
    Hello My Sql server is on Local Machine, I want to access it through Internet. I Configure Surace manager and Configuration manager of sqlserver 2005 for remote access. My sqlserver is running on port:1433 I am using port forwarding , I can access service of other ports, My Connetion String Is: Data Source=190.190.200.100,1433;Network Library=DBMSSOCN;Initial Catalog=myDataBase;User ID=myUsername;Password=myPassword; But it gives following error when i am trying to connect sql server through internet: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.)

    Read the article

  • How can I set up port forwarding for SQL Server 2005?

    - by Manish
    Hello Subject :how to use port forwarding Internet------> Router in my network ------->LocalMachine (Windows 2003) -->Sqlserver2005 How can I access SQL Server through the internet via a router in the local network? My router IP Address is =192.168.1.86; My local machine which is connected to the router Ip Address is= 192.168.1.81 At port No=1433 tell me how to use port forwarding Thanks for help in advance

    Read the article

< Previous Page | 2 3 4 5 6 7 8 9 10 11 12 13  | Next Page >