Search Results

Search found 134 results on 6 pages for 'nikhil garg'.

Page 6/6 | < Previous Page | 2 3 4 5 6 

  • Silverlight 4.0, Visual Studio 2010, .NET 4.0 released

    - by vladimirl
    Technorati Tags: Silverlight OK, now that Silverlight 4.0 finally is out (http://weblogs.asp.net/scottgu/archive/2010/04/15/silverlight-4-released.aspx) its time to learn it. Also VS 2010 and .NET 4.0 released (http://weblogs.asp.net/scottgu/archive/2010/04/12/visual-studio-2010-and-net-4-released.aspx). And remember about Windows Phone! There is more than enough information on the web. One thing that I would like to see from Microsoft is a complete reference example of business application. Personally I like what Nikhil Kothari is doing (check out his Mix 10 session “Developing with WCF RIA Services Quickly and Effectively” and his blog http://www.nikhilk.net/). Also there is Mike Taulty – the best presenter ever - http://mtaulty.com/communityserver/blogs/mike_taultys_blog/default.aspx Currently I’m watching this three part series: 1. What's new in Silverlight 4 Part 1 by Mike Taulty - http://channel9.msdn.com/posts/matthijs/Whats-new-in-Silverlight-4-Part-1-by-Mike-Taulty/ 2. What's new in Silverlight 4: Part 2 by Mike Taulty - http://channel9.msdn.com/posts/matthijs/Whats-new-in-Silverlight-4-Part-2-by-Mike-Taulty/ 3. Silverlight 4 - A Guided Tour of the Managed Extensibility Framework (MEF) - http://channel9.msdn.com/posts/matthijs/Silverlight-4-A-Guided-Tour-of-the-Managed-Extensibility-Framework-MEF/

    Read the article

  • OBJC_CLASS_$_MTSCRA", referenced from

    - by user1078841
    I was trying to make a sample code run download by the link http://www.magtek.com/support/software/downloads/sw/99510108.zip This is a card reader api ,here is a sample code.When I run this code I got the error: ld: warning: ignoring file /Users/gaurav.garg/Downloads/99510108/SampleCode/Lib/libMTSCRA.a, missing required architecture i386 in file Undefined symbols for architecture i386: "_OBJC_CLASS_$_MTSCRA", referenced from: objc-class-ref in MagTekDemoAppDelegate.o ld: symbol(s) not found for architecture i386 clang: error: linker command failed with exit code 1 (use -v to see invocation) The class MTSCRA is only a header file,And the solution that I have cheked That we have to add the .m file in compiled source path of build build phase of target...but unfortunately I don't have the MTSCRA.m file.MTscra.h have the AudioToolBox and externalAccesory framework.

    Read the article

  • Silverlight Cream for May 17, 2010 -- #863

    - by Dave Campbell
    In this Issue: Christian Schormann, Vladimir Bodurov, Pete Brown, Justin Angel, John Papa(-2-), Fons Sonnemans, Miroslav Miroslavov, and Jeremy Likness. Shoutouts: Jeff Brand has been doing WP7 presentations and posted Windows Phone 7 Presentation and Sample Code Mark Tucker posted about his Windows Phone 7 Presentation at Desert Code Camp 2010 John Allwright discusses 4 New case Studies on Silverlight at the Winter Olympics From SilverlightCream.com: New Video by Jon Harris: Blend 4 for Windows Phone in 90 Seconds Christian Schormann is discussing a second 90-second Expression Blend video tutorial by Jon Harris... this second one is about Blend 4 for WP7. XmlCodeEditor – Silverlight 4 control for editing XML and HTML on the browser Vladimir Bodurov has a post up extending the RichTextBox control to add coloring for HTML and XAML ... it colors as you type, and he plans on adding Intellisense! Creating a Simple Report Writer in Silverlight 4 While working on his book, Pete Brown decided to share some Silverlight 'Report Writer' work with us... check out that list of goals near the top that are all met... looks great to me! Windows Phone 7 - Unlocked ROMs Justin Angel has a good long post about a subject I've stayed away from until now that someone of Justin's level of knowledge has approached it: WP7 ROMs. Silverlight 4 Tools for Visual Studio 2010 Launch: New Designer Capabilities (Silverlight TV 27) John Papa has Silverlight TV 27 up today and is talking about the Silverlight 4 Tools for VS2010 launch with Mark Wilson-Thomas ... the video would be a great place to pick up some of the new features (hint, hint) WCF RIA Services v1.0 Launch! (Silverlight TV 28) John Papa also has Silverlight TV 28 up, talking with Nikhil Kothari and Dinesh Kulkarni about the v 1.0 release of WCF RIA Services. RightMouseTrigger Fons Sonnemans updated his MineSweeper game and has it posted at Silver Arcade, this version supports right mouse click via RightMouseTrigger code that he is sharing. Smoke effect The 'Smoke Effect' menus at the CompleteIT site are awesome, and this time out, Miroslav Miroslavov discusses how that was done and gives up the code...! WebClient and DeploymentCatalog gotchas in Silverlight OOB Jeremy Likness has a post up to give you some relief if you hit the same MEF/Silverlight gotcha he did when running OOB... like not running in OOB for instance. Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • Silverlight Cream for March 26, 2010 -- #821

    - by Dave Campbell
    In this Issue: Max Paulousky, Christian Schormann, John Papa, Phani Raj, David Anson(-2-, -3-), Brad Abrams(-2-), and Jeff Wilcox(-2-, -3-). Shoutouts: Jeff Wilcox posted his material from mix and some preview TestFramework bits: Unit Testing Silverlight & Windows Phone Applications – talk now online At MIX10, Jeff Wilcox demo'd an app called "Peppermint"... here's the bleeding edge demo: “Peppermint” MIX demo sources Erik Mork and Co. have put out their weekly This Week In Silverlight 3.25.2010 Brad Abrams has all his materials posted for his MIX10 session Mix2010: Search Engine Optimization (SEO) for Microsoft Silverlight... including play-by-play of the demo and all source. Do you use Rooler? Well you should! Watch a video Pete Brown did with Pete Blois on Expression Blend, Windows Phone, Rooler Interested in Silverlight and XNA for WP7? Me too! Michael Klucher has a post outlining the two: Silverlight and XNA Framework Game Development and Compatibility From SilverlightCream.com: Modularity in Silverlight Applications - An Issue With ModuleInitializeException Max Paulousky has a truly ugly error trace listed by way of not having a reference listed, and the obvious simple solution. Next time he'll talk about the difficult situations. Using SketchFlow to Prototype for Windows Phone Christian Schormann has a tutorial up on using Expression Blend to develop for WP7 ... who better than Christian for that task?? Silverlight TV 18: WCF RIA Services Validation John Papa held forth with Nikhil Kothari on WCF RIA Services and validation just prior to MIX10, and was posted yesterday. Building SL3 applications using OData client Library with Vs 2010 RC Phani Raj walks through building an OData consumer in SL3, the first problem you're going to hit, and the easy solution to it. Tip: When creating a DependencyProperty, follow the handy convention of "wrapper+register+static+virtual" David Anson has a couple more of his 'Tips' up... this first is about Dependency Properties again... having a good foundation for all your Dependency Properties is a great way to avoid problems. Tip: Do not assign DependencyProperty values in a constructor; it prevents users from overriding them In the next post, David Anson talks about not assigning Dependency Property values in a constructor and gives one of the two ways to get around doing so. Tip: Set DependencyProperty default values in a class's default style if it's more convenient In his latest post, David Anson gives the second way to avoid setting a Dependency Property value in the constructor. Silverlight 4 + RIA Services - Ready for Business: Search Engine Optimization (SEO) Brad Abrams Abrams adds SEO to the tutorial series he's doing. He begins with his PDC09 session material on the subject and then takes off on a great detailed tutorial all with source. Silverlight 4 + RIA Services - Ready for Business: Localizing Business Application Brad Abrams then discusses localization and Silverlight in another detailed tutorial with all code included. Silverlight Toolkit and the Windows Phone: WrapPanel, and a few others Jeff Wilcox has a few WP7 posts I'm going to push today. This first is from earlier this week and is about using the Toolkit in WP7 and better than that, he includes the bits you need if all you want is the WrapPanel Data binding user settings in Windows Phone applications In the next one from yesterday, Jeff Wilcox demonstrates saving some user info in Isolated Storage to improve the user experience, and shares all the necessary plumbing files, and other external links as well. Displaying 2D QR barcodes in Windows Phone applications In a post from today, Jeff Wilcox ported his Silverlight 2D QR Barcode app from last year into WP7 ... just very cool... get the source and display your Microsoft Tag. Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone    MIX10

    Read the article

  • Silverlight Cream for March 28, 2010 -- #823

    - by Dave Campbell
    In this Issue: Michael Washington, Andy Beaulieu, Bill Reiss, jocelyn, Shawn Wildermuth, Cameron Albert, Shawn Oster, Alex Yakhnin, ondrejsv, Giorgetti Alessandro, Jeff Handley, SilverLaw, deepm, and Kyle McClellan. Shoutouts: If I've listed this before, it's worth another... Introduction to Prototyping with SketchFlow (twelve video series) and on the same page is Creating a Beehive Game with Behaviors in Blend 3 (ten video series) Shawn Oster announced his Slides + Code + Video from ‘An Introduction to Developing Applications for Microsoft Silverlight’ from MIX10 Tim Heuer announced earlier this week: Silverlight Client for Facebook updated for Silverlight 4 RC Nikhil Kothari announced the availability of his MIX10 Talk - Slides and Code András Velvárt backed up his great MIX09 effort with MIX10.Zoomery.com... everything in one DZ effort... thanks András! Andy Beaulieu posted his material for his Code Camp 13 in Waltham: Windows Phone: Silverlight for Casual Games From SilverlightCream.com: Silverlight MVVM - The Revolution Has Begun Michael Washington did an awesome tutorial on MVVM and Silverlight creating a simple Silverlight File Manager. The post has a link to the tutorial at CodeProject... great tutorial. Windows Phone 7 + Silverlight Performance Andy Beaulieu has a post up we should all bookmark... getting a handle on the graphics performance of our app on WP7. Great examples, and external links. Space Rocks game step 6: Keyboard handling Bill Reiss has a post up about keyboard input for the WP7 game he's building ... this is Episode 6 ... you're working along with him, right? Panoramic Navigation on Windows Phone 7 with No Code! jocelyn at InnovativeSingapore (I found this by way of Shawn's post), has a Panoramic Navigation template out there for WP7 for all of us to grab... great post about it too. My First WP7 Application Shawn Wildermuth has been playing with WP7 development and has his XBOX Game library app up on the emulator... all with source of course Silverlight and Windows Phone 7 Game Cameron Albert built a web-based game called 'Shape Attack' and also did it for WP7 to compare the performance... check it out for yourself, but hey, it's game source for the phone... cool :) Changing the Onscreen Keyboard layout in Silverlight for Windows Phone using InputScope Shawn Oster has a cool post on changing the keyboard on WP7 to go along with what you're expecting the user to type... how cool is that?? Deep Zoom on WP7 Check out the quick work Alex Yakhnin made of putting DeepZoom on WP7... all source included. How to: Create a sketchy Siverlight GroupBox in Blend/SketchFlow ondrejsv has the xaml up to take Tim Greenfield's GroupBox control and insert it into SketchFlow. Silverlight / Castle Windsor – implementing a simple logging framework Giorgetti Alessandro posted about CastleWindsor for Silverlight, and a logging system inherited from LevelFilteredLogger in the absence of Log4Net. DomainDataSource in a ViewModel Jeff Handley responds to a common forum post about using DomainDataSource in a ViewModel. Read his comments on AutoLoad and ElementName Bindins. Digital Jugendstil TextEffect (Art Nouveau) - Silverlight 3 SilverLaw has a cool TagCloud demo and a UserControl he calls Art Nouveau up at the Expression Gallery... not for a business app, I don't think :) Configuring your DomainService for a Windows Phone 7 application deepm discusses RIA Services for WP7 and how to enable a WP7 app to communicate with a DomainService. Writing a Custom Filter or Parameter for DomainDataSource Kyle McClellan by way of Jeff Handley's blog, is discussing how to leverage the custom parameter types you defined in the previous version of RIA Services. Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • Zend framework controller action helper

    - by guptanikhilchandra
    I am getting fatal error after adding the action helper class. I am trying to load layout corresponding to called layout. Following is my code snippet: First of all i added a helper class under application/controller/helpers: class Zend_Controller_Action_Helper_Layout extends Zend_Controller_Action_Helper_Abstract { public $pluginLoader; public function __construct() { // TODO Auto-generated Constructor $this->pluginLoader = new Zend_Loader_PluginLoader (); } public function preDispatch() { $bootstrap = $this->getActionController()->getInvokeArg('bootstrap'); $config = $bootstrap->getOptions(); $module = $this->getRequest()->getModuleName(); if (isset($config[$module]['resources']['layout']['layout'])) { $layoutScript = $config[$module]['resources']['layout']['layout']; $this->getActionController()->getHelper('layout')->setLayout($layoutScript); } } } Then i added a loader in bootstrap.php: protected function _initLayoutHelper() { $this->bootstrap('frontController'); Zend_Controller_Action_HelperBroker::addPath(APPLICATION_PATH .'/controllers/helpers'); $layout = Zend_Controller_Action_HelperBroker::addHelper(new Zend_Controller_Action_Helper_Layout()); } Following is my application.ini: [production] autoloaderNamespaces.tree = "Tree_" phpSettings.display_startup_errors = 0 phpSettings.display_errors = 0 includePaths.library = APPLICATION_PATH "/../library" bootstrap.path = APPLICATION_PATH "/Bootstrap.php" bootstrap.class = "Bootstrap" resources.frontController.controllerDirectory = APPLICATION_PATH "/controllers" resources.frontController.moduleDirectory = APPLICATION_PATH "/modules" resources.frontController.helperDirectory = APPLICATION_PATH "/controllers/helpers" resources.modules[] = "" contact.resources.frontController.defaultControllerName = "index" resources.layout.layoutPath = APPLICATION_PATH "/layouts/scripts" resources.layout.layout = layout admin.resources.layout.layout = admin admin.resources.layout.layoutPath = APPLICATION_PATH "/layouts/scripts" resources.view[] = [staging : production] [testing : production] phpSettings.display_startup_errors = 1 phpSettings.display_errors = 1 [development : production] phpSettings.display_startup_errors = 1 phpSettings.display_errors = 1 While running this code i am getting following errors: Warning: include(Zend\Controller\Action\Helper\LayoutLoader.php) [function.include]: failed to open stream: No such file or directory in D:\personal\proj\renovate\library\Zend\Loader.php on line 83 Warning: include() [function.include]: Failed opening 'Zend\Controller\Action\Helper\LayoutLoader.php' for inclusion (include_path='D:\personal\proj\renovate\application/../library;D:\personal\proj\renovate\library;.;C:\php5\pear') in D:\personal\proj\renovate\library\Zend\Loader.php on line 83 Fatal error: Class 'Zend_Controller_Action_Helper_LayoutLoader' not found in D:\personal\proj\renovate\application\Bootstrap.php on line 33 Kindly let me know, how can i come out from this issue. I am beginner in Zend Framework. Thanks Nikhil

    Read the article

  • Silverlight 4 Tools for VS 2010 and WCF RIA Services Released

    - by ScottGu
    The final release of the Silverlight 4 Tools for Visual Studio 2010 and WCF RIA Services is now available for download.  Download and Install If you already have Visual Studio 2010 installed (or the free Visual Web Developer 2010 Express), then you can install both the Silverlight 4 Tooling Support as well as WCF RIA Services support by downloading and running this setup package (note: please make sure to uninstall the preview release of the Silverlight 4 Tools for VS 2010 if you have previously installed that).  The Silverlight 4 Tools for VS 2010 package extends the Silverlight support built into Visual Studio 2010 and enables support for Silverlight 4 applications as well.  It also installs WCF RIA Services application templates and libraries: Today’s release includes the English edition of the Silverlight 4 Tooling – localized versions will be available next month for other Visual Studio languages as well. Silverlight Tooling Support Visual Studio 2010 includes rich tooling support for building Silverlight and WPF applications. It includes a WYSIWYG designer surface that enables you to easily use controls to construct UI – including the ability to take advantage of layout containers, and apply styles and resources: The VS 2010 designer enables you to leverage the rich data binding support within Silverlight and WPF, and easily wire-up bindings on controls.  The Data Sources window within Silverlight projects can be used to reference POCO objects (plain old CLR objects), WCF Services, WCF RIA Services client proxies or SharePoint Lists.  For example, let’s assume we add a “Person” class like below to our project: We could then add it to the Data Source window which will cause it to show up like below in the IDE: We can optionally customize the default UI control types that are associated for each property on the object.  For example, below we’ll default the BirthDate property to be represented by a “DatePicker” control: And then when we drag/drop the Person type from the Data Sources onto the design-surface it will automatically create UI controls that are bound to the properties of our Person class: VS 2010 allows you to optionally customize each UI binding further by selecting a control, and then right-click on any of its properties within the property-grid and pull up the “Apply Bindings” dialog: This will bring up a floating data-binding dialog that enables you to easily configure things like the binding path on the data source object, specify a format convertor, specify string-format settings, specify how validation errors should be handled, etc: In addition to providing WYSIWYG designer support for WPF and Silverlight applications, VS 2010 also provides rich XAML intellisense and code editing support – enabling a rich source editing environment. Silverlight 4 Tool Enhancements Today’s Silverlight 4 Tooling Release for VS 2010 includes a bunch of nice new features.  These include: Support for Silverlight Out of Browser Applications and Elevated Trust Applications You can open up a Silverlight application’s project properties window and click the “Enable Running Application Out of Browser” checkbox to enable you to install an offline, out of browser, version of your Silverlight 4 application.  You can then customize a number of “out of browser” settings of your application within Visual Studio: Notice above how you can now indicate that you want to run with elevated trust, with hardware graphics acceleration, as well as customize things like the Window style of the application (allowing you to build a nice polished window style for consumer applications). Support for Implicit Styles and “Go to Value Definition” Support: Silverlight 4 now allows you to define “implicit styles” for your applications.  This allows you to style controls by type (for example: have a default look for all buttons) and avoid you having to explicitly reference styles from each control.  In addition to honoring implicit styles on the designer-surface, VS 2010 also now allows you to right click on any control (or on one of it properties) and choose the “Go to Value Definition…” context menu to jump to the XAML where the style is defined, and from there you can easily navigate onward to any referenced resources.  This makes it much easier to figure out questions like “why is my button red?”: Style Intellisense VS 2010 enables you to easily modify styles you already have in XAML, and now you get intellisense for properties and their values within a style based on the TargetType of the specified control.  For example, below we have a style being set for controls of type “Button” (this is indicated by the “TargetType” property).  Notice how intellisense now automatically shows us properties for the Button control (even within the <Setter> element): Great Video - Watch the Silverlight Designer Features in Action You can see all of the above Silverlight 4 Tools for Visual Studio 2010 features (and some more cool ones I haven’t mentioned) demonstrated in action within this 20 minute Silverlight.TV video on Channel 9: WCF RIA Services Today we also shipped the V1 release of WCF RIA Services.  It is included and automatically installed as part of the Silverlight 4 Tools for Visual Studio 2010 setup. WCF RIA Services makes it much easier to build business applications with Silverlight.  It simplifies the traditional n-tier application pattern by bringing together the ASP.NET and Silverlight platforms using the power of WCF for communication.  WCF RIA Services provides a pattern to write application logic that runs on the mid-tier and controls access to data for queries, changes and custom operations. It also provides end-to-end support for common tasks such as data validation, authentication and authorization based on roles by integrating with Silverlight components on the client and ASP.NET on the mid-tier. Put simply – it makes it much easier to query data stored on a server from a client machine, optionally manipulate/modify the data on the client, and then save it back to the server.  It supports a validation architecture that helps ensure that your data is kept secure and business rules are applied consistently on both the client and middle-tiers. WCF RIA Services uses WCF for communication between the client and the server  It supports both an optimized .NET to .NET binary serialization format, as well as a set of open extensions to the ATOM format known as ODATA and an optional JavaScript Object Notation (JSON) format that can be used by any client. You can hear Nikhil and Dinesh talk a little about WCF RIA Services in this 13 minutes Channel 9 video. Putting it all Together – the Silverlight 4 Training Kit Check out the Silverlight 4 Training Kit to learn more about how to build business applications with Silverlight 4, Visual Studio 2010 and WCF RIA Services. The training kit includes 8 modules, 25 videos, and several hands-on labs that explain Silverlight 4 and WCF RIA Services concepts and walks you through building an end-to-end application with them.    The training kit is available for free and is a great way to get started. Summary I’m really excited about today’s release – as they really complete the Silverlight development story and deliver a great end to end runtime + tooling story for building applications.  All of the above features are available for use both in VS 2010 as well as the free Visual Web Developer 2010 Express Edition – making it really easy to get started building great solutions. Hope this helps, Scott P.S. In addition to blogging, I am also now using Twitter for quick updates and to share links. Follow me at: twitter.com/scottgu

    Read the article

  • Simple way of converting server side objects into client side using JSON serialization for asp.net websites

    - by anil.kasalanati
     Introduction:- With the growth of Web2.0 and the need for faster user experience the spotlight has shifted onto javascript based applications built using REST pattern or asp.net AJAX Pagerequest manager. And when we are working with javascript wouldn’t it be much better if we could create objects in an OOAD way and easily push it to the client side.  Following are the reasons why you would push the server side objects onto client side -          Easy availability of the complex object. -          Use C# compiler and rick intellisense to create and maintain the objects but use them in the javascript. You could run code analysis etc. -          Reduce the number of calls we make to the server side by loading data on the pageload.   I would like to explain about the 3rd point because that proved to be highly beneficial to me when I was fixing the performance issues of a major website. There could be a scenario where in you be making multiple AJAX based webrequestmanager calls in order to get the same response in a single page. This happens in the case of widget based framework when all the widgets are independent but they need some common information available in the framework to load the data. So instead of making n multiple calls we could load the data needed during pageload. The above picture shows the scenario where in all the widgets need the common information and then call GetData webservice on the server side. Ofcourse the result can be cached on the client side but a better solution would be to avoid the call completely.  In order to do that we need to JSONSerialize the content and send it in the DOM.                                                                                                                                                                                                                                                                                                                                                                                            Example:- I have developed a simple application to demonstrate the idea and I would explaining that in detail here. The class called SimpleClass would be sent as serialized JSON to the client side .   And this inherits from the base class which has the implementation for the GetJSONString method. You can create a single base class and all the object which need to be pushed to the client side can inherit from that class. The important thing to note is that the class should be annotated with DataContract attribute and the methods should have the Data Member attribute. This is needed by the .Net DataContractSerializer and this follows the opt-in mode so if you want to send an attribute to the client side then you need to annotate the DataMember attribute. So if I didn’t want to send the Result I would simple remove the DataMember attribute. This is default WCF/.Net 3.5 stuff but it provides the flexibility of have a fullfledged object on the server side but sending a smaller object to the client side. Sometimes you may hide some values due to security constraints. And thing you will notice is that I have marked the class as Serializable so that it can be stored in the Session and used in webfarm deployment scenarios. Following is the implementation of the base class –  This implements the default DataContractJsonSerializer and for more information or customization refer to following blogs – http://softcero.blogspot.com/2010/03/optimizing-net-json-serializing-and-ii.html http://weblogs.asp.net/gunnarpeipman/archive/2010/12/28/asp-net-serializing-and-deserializing-json-objects.aspx The next part is pretty simple, I just need to inject this object into the aspx page.   And in the aspx markup I have the following line – <script type="text/javascript"> var data =(<%=SimpleClassJSON  %>);   alert(data.ResultText); </script>   This will output the content as JSON into the variable data and this can be any element in the DOM. And you can verify the element by checking data in the Firebug console.    Design Consideration – If you have a lot of javascripts then you need to think about using Script # and you can write javascript in C#. Refer to Nikhil’s blog – http://projects.nikhilk.net/ScriptSharp Ensure that you are taking security into consideration while exposing server side objects on to client side. I have seen application exposing passwords, secret key so it is not a good practice.   The application can be tested using the following url – http://techconsulting.vpscustomer.com/Samples/JsonTest.aspx The source code is available at http://techconsulting.vpscustomer.com/Source/HistoryTest.zip

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 2 3 4 5 6