Search Results

Search found 82719 results on 3309 pages for 'image file'.

Page 60/3309 | < Previous Page | 56 57 58 59 60 61 62 63 64 65 66 67  | Next Page >

  • Perl+Image::Magick usage: how to assemble several areas in one image into a new image?

    - by Jin
    Hi Everybody, I'm new to ImageMagick and haven't figured out how to assemble several areas into a new image. E.g., I know the "geometry" of words "hello" and "world" respectively in an image, what I need to do is to retrieve the word images and put then into one line image while keep their relative positions. Question1: Suppose I use the perl API, how should I use Composite() or other correct methods to do this? my $geom = sprintf('%dx%x+%d+%d', $word->{width}, $word->{height}, $offsetx, $offsety); $x = $lineimg->Composite($wordimg, $geom); warn "$x" if "$x"; Suppose $lineimg's size is big enough to hold all word images and the geometry has been computed. This code gives out a complain by ImageMagick: Exception 410: composite image required `Image::Magick' @ Magick.xs/XS_Image__Magick_Mogrify/7790 ... Question2: currently I only know how to crop a word image out of the original one and then Clone() method to restore the original image. Is there a way to copy instead of crop a specific area from a image? This way can save the time to copy back and forth the whole image several times. Does anybody know how to write this kind of processing? I appreciate all your help and suggestions! -Jin

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Image reflection in Silverlight 4

    - by Phani Kumar PV
    I am developing a product scrolling feature where products info( product image, Name, price)will be shown side by side horizontally. i need to show the image of the product and also its reflection. under the reflected image i need to show the Prod Name and its price. The problem here is i dont want to show the complete reflected image. the oputput should be something like this Image Height-100% Reflected Image Height-20% Product name Product Price The above pattern will repeat horizontally. I am able to get the desired output with some problem. The reflected image is shown up with hieght 100% and the sapce between the actual image and product name is very high. My reflected image should be a rotated image of the actual image and only half part of the actual image should be shown. Any pointers even is highly appreciated

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • Resize and center image in html/css?

    - by Derek
    Is there a way I can resize, crop, and center an image using html/css only? (img tag or css sprite) For example if I have a 500x500 pixel image, I want to resize that to a 250x250 pixel image I want to make the actual visible image to be 100x100, but still have the scale of a 250x250 sized image. I want the center of the image to be at a location x,y. Is that possible with only html/css, if not, how do you propose I go about it with javascript? Edit - ????: For (2), say my scaled image is now 200x200, and I want my visible image to be 100x100: So I guess what I mean is I want the scale and resolution of the image to be 200x200 but I want the visible image to be 100x100 or in other words the visible image would be at coordinates x,y: 0,0; 0,100; 100,0; 100,100; of the 200x200 image. Sorry, but I'm not good at explaining this.

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • Image size in DB?

    - by user1104916
    I made an application that store Item pictures (jpeg) in SQL Server DB, the use shot pictures with his camera (file size ~ 2 M), in my aaplication I check if picture.Width 800 or picture.Height 600, I resize the picture to 800x600. -- if I export picture from DB, the file size is about 100k, if I open the same picture in photoshop, the image size shows 1.37M. 01-- I want to know the space that takes this picture in my DB. The reason I'm resizing the picture before storing it in my DB, is that I imagine it take a huge space in my DB. 02-- How to resize a picture to keep it' s aspect ratio?

    Read the article

  • change images by clicking left and right

    - by Qin
    I want to display an image in the center of the page, then 2 buttons, left, and right, when I click on left, the image changes to previous one, and move to next image by clicking right. And my question is, the code doesn't work..=.=, very obvious, can anybody tell me where the mistakes are? <table id="frontpage"> <tr> <td><input type="button" id="left" value="left"/></td> <td><img id="image" alt="Image" src="./image/guildwars2/gw2_fight.jpg"/></td> <td><input type="button" id="right" value="right"/></td> </tr> </table> $(document).ready(function(){ var image=new Array(); var current=0; image[0]=new Image(); image[0].src="./image/guildwars2/gw2_fight.jpg"; image[1]=new Image(); image[1].src="./image/diablo3/d3.jpg"; image[2]=new Image(); image[2].src="./image/dota2/catOnWater.jpg"; $("#left").click(function(){ if(current-1<0){ current=image.length-1; $("#image").attr("src")=image[current].src; } else{ --current; $("#image").attr("src")=image[current].src; } }); $("#right").click(function(){ if(current+1>image.length-1){ current=0; $("#image").attr("src")=image[current].src; } else{ ++current; $("#image").attr("src")=image[current].src; } }); })

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

  • Add an Image Properties Listing to the Context Menu in Chrome and Iron

    - by Asian Angel
    Is the lack of an Image Properties listing in the Context Menu of your favorite Chromium-based browser driving you crazy? If you have been missing this extremely useful function, then the Image Properties Context Menu extension is here to save the day. As soon as you get the extension installed you can start enjoying access to image property information as seen here. Very nice! Image Properties Context Menu [via Shankar Ganesh (@shankargan)] Latest Features How-To Geek ETC How To Make Hundreds of Complex Photo Edits in Seconds With Photoshop Actions How to Enable User-Specific Wireless Networks in Windows 7 How to Use Google Chrome as Your Default PDF Reader (the Easy Way) How To Remove People and Objects From Photographs In Photoshop Ask How-To Geek: How Can I Monitor My Bandwidth Usage? Internet Explorer 9 RC Now Available: Here’s the Most Interesting New Stuff Never Call Me at Work [Humorous Star Wars Video] Add an Image Properties Listing to the Context Menu in Chrome and Iron Add an Easy to View Notification Badge to Tabs in Firefox SpellBook Parks Bookmarklets in Chrome’s Context Menu Drag2Up Brings Multi-Source Drag and Drop Uploading to Firefox Enchanted Swing in the Forest Wallpaper

    Read the article

  • Mount an image created from ddrescue

    - by oshirowanen
    I know this question has been asked before, but following those answers does not seem to work for me. I have created an image of a USB stick this is on my laptop harddrive. How do I mount this image? The command I used to create the image was: ddrescue --no-split /dev/sdb usb_recovered usb_recovery_log What am I supposed to do next? Mount it? Fix it then mount it? Mount it then fix it? And how? UPDATE: What I want to recover are the files in the image. How? I don't know as I have tried testdisk and it can't find partitions, and I have tried fdisk and it can't find a partition table in the image either.

    Read the article

  • Replace broken image with noimage icon using Jquery

    - by hmloo
    Sometimes when the image isn't available on server, the web page will show a broken image. so we can display a "no image available" image for good user experience. I will implement it using Jquery. $(document).ready(function() { $("img").error(function() { $(this).hide(); }) .attr("src", "noimage.jpg"); }); Please note that we must first hide the broken image, or else even if we set the src to noimage, it still can not show  noimage icon.

    Read the article

  • Java script Gallery - how to show a next image with an arrow - shiftImg(1)

    - by Srikanth Naidu
    //html file Image slideshow </script>   Loading image. Please wait 1     1/12 2/12 3/12 4/12 5/12 6/12 7/12 8/12   // //JS File var displayWaitMessage=true; // Display a please wait message while images are loading? var activeImage = false; var imageGalleryLeftPos = false; var imageGalleryWidth = false; var imageGalleryObj = false; var maxGalleryXPos = false; var slideSpeed = 0; var imageGalleryCaptions = new Array(); function startSlide(e) { if(document.all)e = event; var id = this.id; this.getElementsByTagName('IMG')[0].src = 'images/' + this.id + '_over.gif'; if(this.id=='arrow_right'){ slideSpeedMultiply = Math.floor((e.clientX - this.offsetLeft) / 5); slideSpeed = -1*slideSpeedMultiply; slideSpeed = Math.max(-10,slideSpeed); }else{ slideSpeedMultiply = 10 - Math.floor((e.clientX - this.offsetLeft) / 5); slideSpeed = 1*slideSpeedMultiply; slideSpeed = Math.min(10,slideSpeed); if(slideSpeed<0)slideSpeed=10; } } function releaseSlide() { var id = this.id; this.getElementsByTagName('IMG')[0].src = 'images/' + this.id + '.gif'; slideSpeed=0; } function gallerySlide() { if(slideSpeed!=0){ var leftPos = imageGalleryObj.offsetLeft; leftPos = leftPos/1 + slideSpeed; if(leftPos>maxGalleryXPos){ leftPos = maxGalleryXPos; slideSpeed = 0; } if(leftPos<minGalleryXPos){ leftPos = minGalleryXPos; slideSpeed=0; } imageGalleryObj.style.left = leftPos + 'px'; } setTimeout('gallerySlide()',20); } function showImage() { if(activeImage){ activeImage.style.filter = 'alpha(opacity=50)'; activeImage.style.opacity = 0.5; } this.style.filter = 'alpha(opacity=100)'; this.style.opacity = 1; activeImage = this; } function initSlideShow() { document.getElementById('arrow_left').onmousemove = startSlide; document.getElementById('arrow_left').onmouseout = releaseSlide; document.getElementById('arrow_right').onmousemove = startSlide; document.getElementById('arrow_right').onmouseout = releaseSlide; imageGalleryObj = document.getElementById('theImages'); imageGalleryLeftPos = imageGalleryObj.offsetLeft; imageGalleryWidth = document.getElementById('galleryContainer').offsetWidth - 80; maxGalleryXPos = imageGalleryObj.offsetLeft; minGalleryXPos = imageGalleryWidth - document.getElementById('slideEnd').offsetLeft; var slideshowImages = imageGalleryObj.getElementsByTagName('IMG'); for(var no=0;no<slideshowImages.length;no++){ slideshowImages[no].onmouseover = showImage; } var divs = imageGalleryObj.getElementsByTagName('DIV'); for(var no=0;no<divs.length;no++){ if(divs[no].className=='imageCaption')imageGalleryCaptions[imageGalleryCaptions.length] = divs[no].innerHTML; } gallerySlide(); } function showPreview(imagePath,imageIndex){ var subImages = document.getElementById('previewPane').getElementsByTagName('IMG'); if(subImages.length==0){ var img = document.createElement('IMG'); document.getElementById('previewPane').appendChild(img); }else img = subImages[0]; if(displayWaitMessage){ document.getElementById('waitMessage').style.display='inline'; } document.getElementById('largeImageCaption').style.display='none'; img.onload = function() { hideWaitMessageAndShowCaption(imageIndex-1); }; img.src = imagePath; } function hideWaitMessageAndShowCaption(imageIndex) { document.getElementById('waitMessage').style.display='none'; document.getElementById('largeImageCaption').innerHTML = imageGalleryCaptions[imageIndex]; document.getElementById('largeImageCaption').style.display='block'; } function shiftImg(imageIndex){ } window.onload = initSlideShow;

    Read the article

  • how to do android image animation

    - by user270811
    hi, i am trying to get a simple image animation going. i want to make it looks as if the helicopter's propeller blades are turning. i have 3 images for the helicopter, and i am showing one of these images depending on the animation progress. the problem is that all three images end up overlapping each other as opposed to just one image showing up at one time, thereby creating the animation. this is what i did so far, i even tried to clear canvas by doing this canvas.drawColor(Color.BLACK), but that would clear out the whole canvas, which is not what i want. this is what i have: 1) in the View class: static class Helicopter { private long mLastUpdate; private long mProgress = 0; private final float mX; private final float mY; private final Bitmap mHelicopter1; private final Bitmap mHelicopter2; private final Bitmap mHelicopter3; private final float mRadius; Helicopter(long mLastUpdate, float mX, float mY, Bitmap helicopter1, Bitmap helicopter2, Bitmap helicopter3) { this.mLastUpdate = mLastUpdate; this.mX = mX; this.mY = mY; this.mHelicopter1 = helicopter1; this.mHelicopter2 = helicopter2; this.mHelicopter3 = helicopter3; mRadius = ((float) mHelicopter1.getWidth()) / 2f; } public void update(long now) { mProgress += (now - mLastUpdate); if(mProgress >= 400L) { mProgress = 0; } mLastUpdate = now; } public void setNow(long now) { mLastUpdate = now; } public void draw(Canvas canvas, Paint paint) { if (mProgress < 150L) { canvas.drawBitmap(mHelicopter1, mX - mRadius, mY - mRadius, paint); } else if (mProgress < 300L) { canvas.drawBitmap(mHelicopter2, mX - mRadius, mY - mRadius, paint); } else if(mProgress < 400L) { canvas.drawBitmap(mHelicopter3, mX - mRadius, mY - mRadius, paint); } } public boolean done() { return mProgress > 700L; } } private ArrayList<Helicopter> mHelicopters = new ArrayList<Helicopter>(); 2) this is being called in the run() of a thread: private void doDraw(Canvas canvas) { final long now = SystemClock.elapsedRealtime(); canvas.save(); for (int i = 0; i < mHelicopters.size(); i++) { final Helicopter explosion = mHelicopters.get(i); explosion.update(now); } for (int i = 0; i < mHelicopters.size(); i++) { final Helicopter explosion = mHelicopters.get(i); explosion.draw(canvas, mPaint); } canvas.restore(); } can someone help me? i have looked at a lot of the examples on the web on animation, they seem to always involve text, but not images. thanks.

    Read the article

  • excel cannot open the file xxx.xlsx' because the file format is not valid error

    - by Yavuz
    I have difficulty open opening word and excel files suddenly. Only particular office file give me the problem. These files were previously scanned by combo fix and I believe they were damaged. The error response that I from office is Excel cannot open the file xxx.xlsx because the file format is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. This is for excel and a similar kind of error response comes for word. The file looks fine. I mean the size vise... Please help me with this problem. I really appreciate your help and time....

    Read the article

  • Upon clicking on a file, excel opens but not the file itself

    - by william
    Platform: Windows XP SP2, Excel 2007 Problem description: Upon clicking on a file in Windows Explorer (file is either .xls or .xlsx) Excel 2007 opens, but does not open the file itself. I need either to click on a file again in Windows Explorer or open it manually with File/Open ... from Excel. Does anyone know what could cause this rather strange behaviour ? The old versions of Excel worked "normally" ... i.e. upon clicking on a file, an Excel would open along with the file. Please, help !

    Read the article

  • How to convert a 32bpp image to an indexed format?

    - by Ed Swangren
    So here are the details (I am using C# BTW): I receive a 32bpp image (JPEG compressed) from a server. At some point, I would like to use the Palette property of a bitmap to color over-saturated pixels (brightness 240) red. To do so, I need to get the image into an indexed format. I have tried converting the image to a GIF, but I get quality loss. I have tried creating a new bitmap in an index format by these methods: // causes a "Parameter not valid" error Bitmap indexed = new Bitmap(orig.Width, orig.Height, PixelFormat.Indexed) // no error, but the resulting image is black due to information loss I assume Bitmap indexed = new Bitmap(orig.Width, orig.Height, PixelFormat.Format8bppIndexed) I am at a loss now. The data in this image is changed constantly by the user, so I don't want to manually set pixels that have a brightness 240 if I can avoid it. If I can set the palette once when the image is created, my work is done. If I am going about this the wrong way to begin with please let me know. EDIT: Thanks guys, here is some more detail on what I am attempting to accomplish. We are scanning a tissue slide at high resolution (pathology application). I write the interface to the actual scanner. We use a line-scan camera. To test the line rate of the camera, the user scans a very small portion and looks at the image. The image is displayed next to a track bar. When the user moves the track bar (adjusting line rate), I change the overall intensity of the image in an attempt to model what it would look like at the new line rate. I do this using an ImageAttributes and ColorMatrix object currently. When the user adjusts the track bar, I adjust the matrix. This does not give me per pixel information, but the performance is very nice. I could use LockBits and some unsafe code here, but I would rather not rewrite it if possible. When the new image is created, I would like for all pixels with a brightness value of 240 to be colored red. I was thinking that defining a palette for the bitmap up front would be a clean way of doing this.

    Read the article

  • How to write files in specific order?

    - by Bernie
    Okay, here's a weird problem -- My wife just bought a 2014 Nissan Altima. So, I took her iTunes library and converted the .m4a files to .mp3, since the car audio system only supports .mp3 and .wma. So far so good. Then I copied the files to a DOS FAT-32 formatted USB thumb drive, and connected the drive to the car's USB port, only to find all of the tracks were out of sequence. All tracks begin with a two digit numeric prefix, i.e., 01, 02, 03, etc. So you would think they would be in order. So I called Nissan Connect support and the rep told me that there is a known problem with reading files in the correct order. He said the files are read in the same order they are written. So, I manually copied a few albums with the tracks in a predetermined order, and sure enough he was correct. So I copied about 6 albums for testing, then changed to the top level directory and did a "find . music.txt". Then I passed this file to rsync like this: rsync -av --files-from=music.txt . ../Marys\ Music\ Sequenced/ The files looked like they were copied in order, but when I listed the files in order of modified time, they were in the same sequence as the original files: ../Marys Music Sequenced/Air Supply/Air Supply Greatest Hits ls -1rt 01 Lost In Love.mp3 04 Every Woman In The World.mp3 03 Chances.mp3 02 All Out Of Love.mp3 06 Here I Am (Just When I Thought I Was Over You).mp3 05 The One That You Love.mp3 08 I Want To Give It All.mp3 07 Sweet Dreams.mp3 11 Young Love.mp3 So the question is, how can I copy files listed in a file named music.txt, and copy them to a destination, and ensure the modification times are in the same sequence as the files are listed?

    Read the article

< Previous Page | 56 57 58 59 60 61 62 63 64 65 66 67  | Next Page >