Search Results

Search found 30014 results on 1201 pages for 'go yourself'.

Page 602/1201 | < Previous Page | 598 599 600 601 602 603 604 605 606 607 608 609  | Next Page >

• Getting Steam.exe to run through a http proxy

  - by Kryptonite

  I'm sitting behind an http proxy which Steam refuses to go through. Trying Proxifier to fix the solution rendered an error about having to use an https proxy, though research shows that it shouldn't need one. Is it possible to make a target parameter in a shortcut? ie. "C:\Program Files\Steam\Steam.exe" --http-proxy=myusername:mypassword@SERVERNAME:8080 I have the server name and port number, though I'm yet to understand the relevance of 'myusername:mypassword', or infact which username and password these instructions were referring to. Of course, if a target parameter wouldn't work, would there be another way to get Steam to work?

  Read the article

• Network not detected, but internet working

  - by Dave

  I am using a brand new HP computer with Windows 7 64 bit. When I first hooked it up it detected my network (hooked up through ethernet) easily. However, after I uninstalled Norton Internet Security, it stopped being able to detect my home network. I can still use the internet as if connected, but I can't go into the network options to communicate with other computers. I had this same problem on Windows Vista on my previous computer. Is there any way to fix this so it detects the network?

  Read the article

• How to emulate a domain name - Webmin Setup

  - by theonlylos

  I am currently working on a client project where they are using a custom CMS which relies on having the specific domains configured for it to work properly. So in English, that means that when I try running the site on my test environment, the entire website fails because it isn't located on the primary domain (and I'm pretty sure the domain is hard coded since there's no control panel to adjust the file locations). Anyway what I wanted to ask is whether it is possible to use my test environment URL but have Apache and the DNS emulate my clients website URL locally, rather than calling the actual name servers. Right now I have a virtual host setup in Apache but I am not sure where to go from there. Any assistance is greatly appreciated.

  Read the article

• What could be causing LVM errors on first boot after install in Debian?

  - by ianfuture

  Hi, I've installed Debian (lenny) on a machine at home. It was set up during install to have a /boot partition, then the rest was encrypted, then had an LVM ontop of that, then all the other partitons inside LVM. After install completed and on first boot it asked for password to un-encrypt(same password for both drives) then it showed an error which said LVM could not find a physical device with a particular UUID or something similar. LVM install is over two HDs. One is 120GB and one 40GB. 120GB is Master on its IDE cable and this has /boot on it. 40GB is slave on the other IDE cable. Is there anything that could be done to rescue this install? Or diagnose problem? It took ages to get installed due to time spent enrypting drives and I'd rather not go through that again. :( Thanks.. Ian

  Read the article

• (Windows 7) Dial Up Connection Locks up the Networking Service

  - by Nick

  I connect to the internet by using my cell phone as a dial up modem. (shh, don't tell my service provider) The connection is usually seamless and the speed is good (150kbps) but occasionally, the connection will get terminated by either the phone or the network, I'm not sure which and then Windows7 stubbornly doesn't acknowledge that the connection is dead so I can re-dial. I have tried to manually kill the connection, but then anything related to the network service refuses to open and the connection is still there. No "Network and Sharing Center", "Network Devices" and often the tray menu will refuse to pop open. The only way I have found to clear the problem is a full restart which. Logging off doesn't work and I haven't been able to find the service that is frozen. If anyone knows how to fix this or prevent this from happening or even how to go about troubleshooting I would be very grateful. ps. This problem is non-existant when tethering in linux on the same machine. (Ubunutu 9 and JoliOS)

  Read the article

• C Language preprocessing doubt

  - by khanna_param

  Hi, There are different kind of macros in C language, nested macro is one of them. Considering a program with the following macro define HYPE(x,y) (SQUR(x)+SQUR(y)) define SQUR(x) (x*x) using this we can successfully complile to get the result. My question:- As we all know the C preprocessor replaces all the occurrence of the identifiers with the replacement-string. Considering the above example i would like to know how many times the C compiler traverses the program to replace the macro with the replacement values. I assume it cannot be done in one go. Thanks.

  Read the article

• Server 2003 Filter mobile devices via MAC

  - by msindle

  At one of my client's sites I need to keep my users unauthorized devices off the wireless. They all know the SSID and Password because many of them have laptops that need the wireless. I'm running out of IP address's and we have sent out numerous emails asking them to stay off, but like most users they ignore IT's email. I'm currently running Server 2003 as the GC/DC (but have 2008 servers in place) and 2 Netgear WNAP320. I've seen several posts similar to what I'm looking for but they seem to deal with Linux. My question is how do I go about doing this without migrating (scheduled for the end of the year) to a new server and is it possible to do this within Server 2003? Thanks msindle

  Read the article

• Can I see if and when a file was deleted on Windows Server 2003?

  - by user316687

  On Windows Server 2003, is there a way to see if and when a file was deleted? It's a web server with IIS, our web application let our users to load Word documents into server. However, we found that one Word file is missing, and would like to know is it was deleted or never existed (web app could'nt load it). EDIT: I tried to follow this: Enable auditing the folder you want to keep track of. Just right click on the folder, go to “sharing and security”, then “security” tab, at the bottom click on “advanced”. Select the auditing tab, click add, select the group or users to track, then pick what actions you want to track. To track file deletion you would enable: Create files/Write data Success/Fail Create folders / append data Success/Fail Delete Subfolders/Files Success/Fail Delete Suceess/Fail This one will apply from now on, past actions wouldn't be able to track?

  Read the article

• 1080p HD TV + what is minimum spec pc required to stream HD movie files to it?

  - by rutherford

  I want to stream hi-def (non flash-based) movies from my future minimum spec pc to my network-ready HDTV. What I want to know is a) when streaming from a computer (local wifi network), is the computer's cpu/video/ram resources used to the same extent as it would be if playing back on the computers local screen? If not what are the differences? b) So with streaming hd content what is the minimum spec processor I should go for, if i) only one TV is acting as client ii) two TVs are simultaneous clients.

  Read the article

• Nagios: Is it possible to have multiple IPs for a host?

  - by Aknosis

  In our office we have dual WAN setup, if our cable connection drops we still get connectivity via our T1. The only issue is that our office network is no longer available on the same IP so all Nagios check go critical because they can't connect. What'd be awesome is if I could have Nagios try IP 1 by default but if for some reason its failing on that IP try IP 2. I doubt this is possible with a default install but I'm wondering if there is any add-ons or some other magic that could make this work?

  Read the article

• Is there a way to watch EyeTV in alarm-clock style "sleep" mode on your iMac?

  - by Mark S.

  My wife likes to watch TV to go to sleep, the only trouble is that the only TV we have in our house is the iMac with the EyeTV Hybrid. I'd like to have the TV turn off after 1.5 hours of watching without changing the channels/volume--sortof like an alarm clock 'sleep' function. Do you know of a way to do this either with an EyeTV plugin or an App that might be able to try to detect such conditions and shut down the display? Right now EyeTV overrides the screensaver. The Power saver functions don't really work because she doesn't start watching at the same time every night and periodically she will want to record a 2 or 3 AM show. All I want to do is "close" (but not quit) EyeTV and shut off the display.

  Read the article

• Accessing our Intranet from outside our Network - WITHOUT VPN

  - by westexasman

  We just upgraded our company intranet from an IIS based, ASP (poorly written) server/code base to a Windows Server 2008 r2 (Apache/MySQL/PHP) server. The old server allowed users to login to intranet.xxx.org using there AD user/pass which then lead them to the company Intranet from basically anywhere they had Internet access. We want to mimic that functionality (or change it to something more secure) with the new setup. This was seemingly setup for off-site employees running on a state network. The state network does not allow VPN, therefor, we needed a way to allow those employees access to the Intranet. So, how do we go about allowing users to login from the outside world and gain access to our Intranet?

  Read the article

• Creating a webserver from scratch

  - by Val

  I know this is going to sound a humongous task and many of you would think why in the world would you want to do so or why re-invent the wheel. However I just want a project I can work on the side see how it goes and experiment ( I got a thirst for learning something new and this is a great challenge). Question Where would I start creating a server-side scripting like php, asp and (now) node.js I would like to have a few examples, and most importantly a CODEX/documentation where I can learn and find out more how it works. I guess I am asking for directions where to go to read and find out more about this. Many thanks,

  Read the article

• Lost Linux root password - Recovery mode and init=/bin/bash fail

  - by Albeit

  I lost/forgot the root password to a server sitting beside me and am trying to reset it. I would rather not have to wipe and re-install or use a Live CD (server is running Ubuntu Server 12.04). What I've tried so far... 1) Boot into "Recovery mode" from Grub2 boot menu then drop into root shell prompt. I am prompted to "Give root password for maintenance". No-go. 2) Change the boot parameters for the main boot option to include "rw" and "init=/bin/bash". When I then boot with Ctrl-X, the screen goes black, and nothing happens (I've waited five minutes). init=/bin/sh and init=/bin/static-sh both do the same thing, while init=/sbin/init boots as normal. Is there anything else I can try to reset the root password? Thank you!

  Read the article

• Excel Document Size is at 0KB, can't be opened

  - by Bassam

  After I saved an Excel document, I remembered that I needed to change something in it, so I go back to open it and it said Excel cannot open the file, because the file format or the file extension is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. I know when I saved before, around 2hours ago, it worked just fine. The document size is at 0KB now. How do I recover this document? Its crucial for my business!

  Read the article

• Resetting default Input Method in Mac OS 10.6

  - by Tim Visher

  I'm a Dvorak guy. I recently installed a new machine at the inlaws who are not Dvorak people. I stupidly selected Dvorak as my Input Method of choice while installing OS X. Now, all of the users I created default to Dvorak and need to go through the manual process of removing Dvorak as their Input Method of choice and instead choosing U.S. I have no idea how far reaching the implications might be. Could be that any time another user is added they will default to Dvorak. Right now, I'd like to set the default back to U.S. How can I do that? Behaviors I'm looking for include that when the Input Menu is not shown at the Login Screen, U.S. is the keyboard layout. Any future users created should default to U.S. with no Input Menu in the menu bar. Any users created already should have their default layout be U.S. Thanks in advance!

  Read the article

• Windows Reformatting

  - by Shimz187

  I recently began formatting a hard drive via USB extenal drive when the power went off. When i powered it up again and connected the drive the drives dont show up under my computer. When i go to disk management, i see the drive but now it says unallocated space. The drive was initialy partitioned into 2 drives. I cant see both drives now. Tried running GetDataBack NTFS recovery tool and it only comes up with errors. There seem to be no information on the drive from the data recovery utility. I know the information is there but how do i find it. HELP!!!!

  Read the article

• Does a receiving mail server (the ultimate destination) see emails delivered directly to it vs. to an external relay which then forwards them to it?

  - by Matt

  Let's say my users have accounts on some mail server mail.example.com. I currently have my mx record set to mail.example.com and all is good. Now let's say I want to have mails initially delivered to an external service (e.g. Postini. Note that this is not a postini-specific question though). In the normal situation where my mx is set directly to my mail server mail.example.com, sending MTAs will of course look up my MX and send to mail.example.com. In my new situation I'd have my mx set to mx.othermailservice.com and emails would be received there. OtherEmailService.com will then relay the emails (while keeping the return-path header the same) to mail.example.com. Do the emails that are received at mail.example.com after be relayed from the other service "look" any different than emails that go directly to it as would be the case where the mx was set to mail.example.com?

  Read the article

• I can't set the resolution to that recommended by my monitor

  - by F4r-20

  Firstly, I have looked here but didn't find what I needed. I have a Dell Optiplex 380 only using the on-board graphics (believe its the Intel G41 Express Chipset) but I can't seem to get the resolution right. The monitor I'm using (HP LE1901w) wants me to use 1440x900 but the only options I get are: 1600 x 1200 1366 x 768 1360 x 768 1280 x 1024 1280 x 960 1152 x 864 1024 x 768 800 x 600 So it will allow me to go higher or lower but not 1440x900. I've tried getting the driver from various different sources (Dell, Intel, Windows 7 Update) but still can't get that option. Does anybody know what else I can try?

  Read the article

• How to recover the data from the crashed (external) hard disk drive (NTFS)?

  - by shveerab

  The 300 GB harddisk has 2 partitions,90 GB and 200 GB! I can see the drives in windows(XP) but unable to access them, the file system is shown as RAW, 0 used space and 0 free space!..chkdsk returns the error "unable to determine volume version and date. chkddsk aborted." Is the MBR corrupt? How do I restore it? TestDisk tool isn't recognizing the partitions and says invalid entry for heads/cylinder, 15 and should be 255 and suggests to change it..Should I go ahead and change it? Please advise!

  Read the article

• What's the best way to install mod-wsgi for a specific version of python (2.7) on Debian (squeeze)?

  - by Pascal Polleunus

  System info: Debian Squeeze Python versions: 2.6.6 (default) & 2.7.2 mod-wsgi: 3.3-2 in /usr/lib/apache2/modules: mod_wsgi.so -> mod_wsgi.so-2.6 mod_wsgi.so-2.5 mod_wsgi.so-2.6 I've a virtualenv configured with Python 2.7 but my application runs 2.6.6, apparently because mod-wsgi is using the default version of the system. The way to go seems to configure mod-wsgi to use 2.7 (i.e. system-wide, not specific to a virtualenv). How can I install mod_wsgi.so-2.7? After installing that, I'll just have to change the symlink mod_wsgi.so to mod_wsgi.so-2.7.

  Read the article

• PC3200 RAM in Older Computer?

  - by skaz

  Hello all, I am inheriting a Dell Dimension 8200, but it needs RAM to get up and running. I have PC3200 sticks lying around, but I am not sure how to go about figuring out if the RAM is compatible, as RAM has always confused me. Here is the Dell Dimension 8200 Tech Specs: http://support.dell.com/support/edocs/systems/dim8200/specs.htm For RAM, it says: Memory type PC800 (non-ECC) I don't know if that is just the kind that comes with it, and I can put in PC3200 (I think, if it worked, this would run at the lower rating? Is that true?), or if that means only PC800 is compatible. Any help would be appreciated.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Updating Applications in a Corporate Environment

  - by user145133

  I am very new to this subject and was hoping someone could shed some light on it. I am working on creating a corporate network that will obviously have multiple servers and multiple workstations. Let's say a new version of Adobe Flash comes out. I would think that you would want to test this update in a test environment before "pushing it out" to the servers and workstations. How do you guys go about controlling, testing and then pushing the application updates out? (i am not talking about windows updates). Do you use a 3rd party sysadmin tool? Home grown software? Any info will greatly be appreciated :)

  Read the article

• error when using OWA access to mail server exchange 2010

  - by e0594cn

  Suddenly it will come out the below error when accessing the exchange 2010 mail server using OWA after clicking sign in button on initial page? ***The website cannot display the page HTTP 500 Most likely causes: •The website is under maintenance. •The website has a programming error. What you can try: Refresh the page. Go back to the previous page. More information This error (HTTP 500 Internal Server Error) means that the website you are visiting had a server problem which prevented the webpage from displaying. For more information about HTTP errors, see Help.* Any suggestion? Thanks!

  Read the article

< Previous Page | 598 599 600 601 602 603 604 605 606 607 608 609  | Next Page >