Search Results

Search found 28590 results on 1144 pages for 'best of'.

Page 616/1144 | < Previous Page | 612 613 614 615 616 617 618 619 620 621 622 623  | Next Page >

• Maker/ Checker Design Module

  - by user288198

  i want to design maker/ checker module in my project like if user A add new user so the another User B will approve or reject this adding. i want to know the best practices of design for this module in the database ....... any help

  Read the article

• Is MapReduce such a generalisation of another programming principle?

  - by Zubair

  I'm getting into parallel programming and I'm studying mapreduce and other distributed algorithms. Is it best just to learn mapreduce or is there a more general algorithm that will serve me better?

  Read the article

• How to use nhibernate with ASP.NET 3.5 (not MVC)

  - by ChaosSpeeder

  What is the best way to interop with NHibernate 2.0 and ASP.NET 3.5? How can I easily develop a CRUD application? Is the ObjectDataSource the way to go? Thank you.

  Read the article

• How to check if a given Regex is valid? (Java)

  - by Philipp Andre

  Hi folks, I have a little program allowing users to type-in some regular expressions. afterwards i like to check if this input is a valid regex or not. I'm wondering if there is a build-in method in Java, but could not find such jet. Can you give me some advice? Best regards Phil

  Read the article

• textbox character countdown asp.net

  - by Ugene

  i have many textboxes on a form and all textboxes require to have a character limit / character countdown (50 character left of 150), what is the best way to achieve this and can anyone please provide code to implement. Much Grateful Thanks

  Read the article

• Low delay audio on Android via NDK

  - by hkhauke

  Hi, it seems that this question has been asked before, I just would like to know whether there is an update in Android. I plan to write an audio application involving low delay audio I/O (appr. < 10 ms). It seems not to be possible based on the methods proposed by the SDK, hence is there - in the meantime - a way to achieve this goal using the NDK? Best regards, HK

  Read the article

• Is there a way to get each row's value from a database into an array?

  - by Guyver

  Say I have a query like the one below. What would be the best way to put each value into an array if I don't know how many results there will be? Normally I would do this with a loop, but I have no idea how many results there are. Would I need run another query to count the results first? <CFQUERY name="alllocations" DATASOURCE="#DS#"> SELECT locationID FROM tblProjectLocations WHERE projectID = '#ProjectName#' </CFQUERY>

  Read the article

• How can I implement incremental search on command line?

  - by florianbw

  I'd like to write small scripts which feature incremental search (find-as-you-type) on the command line. Use case: I have my mobile phone connected via USB, Using gammu --sendsms TEXT I can write text messages. I have the phonebook as CSV, and want to search-as-i-type on that. What's the easiest/best way to do it? It might be in bash/zsh/Perl/Python or any other scripting language.

  Read the article

• Accessing a database using visual c++ and OLEDB

  - by Shadi

  Does anybody have an example of working with database using Visual C++ and OLEDB? What should I include on top of my code? I have searched the internet and most examples are using C# or VB. Examples written by C++ are usually not complete. I really appreciate your help. Best, Shadi.

  Read the article

• How to determine if NSString is empty

  - by Mark S.

  What is the best was to determine if an NSString is empty? Right now I am using the following: if (string == nil || [string isEqualToString:@""]) { // do something } Thanks for any advice.

  Read the article

• Java connecting to Http which method to use?

  - by jax

  I have been looking around at different ways to connect to URLs and there seem to be a few. My requirements are to do POST and GET queries on a URL and retrieve the result. I have seen URL class DefaultHttpClient class And there were some others in apache commons which method is best?

  Read the article

• sed or greo or awk to match very very long lines

  - by yael

  more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

  Read the article

• Logging in MVC (Zend Framework)

  - by superdario

  Is there a best-practice when it comes to where to put the logging functionality in an MVC application, for example a Zend Framework application (Zend_Log)? Should I put the logging in the controller or in the model? Or in both? If in both, should they have the same logger or a separate one?

  Read the article

• Android - Help needed with designing a screen with either table layout or list views

  - by A. Cusano

  I am currently developing an android app that is to be a counterpart to its sister iphone prototype. My task is to recreate the screen from a design mockup from the iphone app in android, as shown here (can't display an image as a new user - sorry!): http://img.photobucket.com/albums/v439/thrawn891/iphone.jpg What would be the best layouts / views to use for replicating this screen in an activity? Thanks.

  Read the article

• NHibernate (or other worth recommendation ORM), real life example?

  - by migajek

  I'd like to learn database applications in C# and I'm about to select some framework. I heard many recommendations of NHibernate, however I haven't decided yet. Anyway, I'd like to know if there's any real-life example (with sources) of NHibernate in C#, to learn best practices etc.? I know all of them are probably covered in the docs, but working example helps a lot understanding the proper development pattern.

  Read the article

• Compare string with all values in array

  - by Hallik

  I am trying to fumble through python, and learn the best way to do things. I have a string where I am doing a compare with another string to see if there is a match: if paid[j].find(d)>=0: #BLAH BLAH If 'd' were an array, what is the most efficient way to see if the string contained in paid[j] has a match to any value in 'd'?

  Read the article

• export gridview data

  - by Eric

  What is the best way to export a gridview into an Excel spreadsheet? This seems easy except that my Gridview doesn't have an export attribute. What is the quickest way to do this?

  Read the article

• How to implement a login page in a GWT app?

  - by Gatis

  My WebApp needs to authenticate user before allowing any sort of access. The scenario I'm trying to implement is a login page with username and password fields. Once user hits "send" button, a sign like "Verifing..." should be shown up while an RPC call verifies credentials. In case of success, load the main app screen. What is the best way to implement that?

  Read the article

• Replace first Letter in a field Oracle

  - by Stanley

  Hi Guys I have this Table I need to replace the First Letter in ACCT_NAME with the First Name of ACCT_SHORT_NAME. Records like the Higliighted(RAFFMAN) should not be changed. I have tried: select acct_name, ACCT_SHORT_NAME,replace(acct_name, substr(acct_name, 1, 1), ACCT_SHORT_NAME) from tbaadm.gam where schm_type = 'TDA' and rcre_user_id = 'SYSTEM' and substr(acct_name,2,1) = ' ' I am getting: This means that am Picking the whole value in ACCT_SHORT_NAME. WHat is the best way to do what am trying to do?

  Read the article

• HTML table print large column

  - by Emma

  Windows XP, IE 7 If the data in one of the column in table is more than say 800 bytes, it seems to print partial pages. Previews also appears same (span into multiple partial pages). What is the best way so that large number of rows with wide coulumns (fixed width) are printed properly without giving blank or partial page. Used table with thead and colgroup with width in 14%.

  Read the article

• How do I check if an integer is even or odd?

  - by chustar

  How best can I check if an integer is even or odd in C? I considered how I'd do this in Java, but I couldn't come up with an answer either. Thanks.

  Read the article

• Type hinting for functions in Clojure

  - by mikera

  I'm trying to resolve a reflection warning in Clojure that seems to result from the lack of type inference on function return values that are normal Java objects. Trivial example code that demonstrates the issue: (set! *warn-on-reflection* true) (defn foo [#^Integer x] (+ 3 x)) (.equals (foo 2) (foo 2)) => Reflection warning, NO_SOURCE_PATH:10 - call to equals can't be resolved. true What is the best way to solve this? Can this be done with type hints?

  Read the article

• limiting user actions by months

  - by Ahmet vardar

  hi my users upload photo and all uploads recorded in mysql with the date info. i want to limit uploads by the months. user may just upload 3 pics in a month. what is the best way to do this ? cheers

  Read the article

• Pass authentication between php and Ruby On Rails application

  - by Li

  Hi, I have a simple Ruby on rails application that I want to integrate with an existing php website. I only want that users who's been authenticated by the php application would have access to my Ruby on Rails application (it should appear to the user as the same website, in the same domain, though it can be a different sub-domain if I chose to) What's the best way to do that? Thanks for the help, Li

  Read the article

• Visual Map about Microsoft development products

  - by Eduardo

  Hello: I listen much about new Microsoft terminologies such as WPF, WCF, WWF, ASP.NET MVC, Silverlight, entity framework, LINQ. I would like to see in a visual map: 1) how these products interrelate 2) Which are complements of which. 3) Order of priority to learn I think all the names that I mentioned, together with the use of Visual Studio applies to web developments. I need a good answer to guide my efforts of Web development in the best way. Thanks.

  Read the article

< Previous Page | 612 613 614 615 616 617 618 619 620 621 622 623  | Next Page >