Search Results

Search found 28593 results on 1144 pages for 'best pratices'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 616/1144 | < Previous Page | 612 613 614 615 616 617 618 619 620 621 622 623  | Next Page >

  • Javascript + HTML5 localstorage

    - by Alai
    So I'm searching for a good crash course on localstorage and interacting with it in Javascript. I want to build a to-do list webapp with some extra functionality but it would be just for 1 user. I don't want to mess with php/mysql and have the server doing anything. Links to tutorials would be best :-D

    Read the article

  • Php pi help... (Loops)

    - by James Rattray
    Is this iteration the best? (Pi^2)/12 = 1 - 1/4 + 1/9 - 1/16 + 1/25 etc. -For converging faster? If not please answer with the iteration -preferably in the form above (an example) -not a splat of algebra ... I'm doing this to find Pi to 1,000,000,000 places online. http://www.zombiewrath.com/superpi.php or my 10,000 one: http://www.zombiewrath.com/pi.php

    Read the article

  • Logging in MVC (Zend Framework)

    - by superdario
    Is there a best-practice when it comes to where to put the logging functionality in an MVC application, for example a Zend Framework application (Zend_Log)? Should I put the logging in the controller or in the model? Or in both? If in both, should they have the same logger or a separate one?

    Read the article

  • Copying subversion commit messages

    - by Falcor
    I know this isn't the BEST practice, but every once in a while when I'm merging up a huge batch up changes with the trunk (and I know my branch is current), I will simply delete the contents of the trunk and then copy the contents of my branch up, so that I don't have to deal with resolving conflicts for an hour. The problem is that I seem to lose the entire history of commit messages for each file. My branch still has the correct history of commit messages... how can I merge them up?

    Read the article

  • Update Multiple records in SQL Server

    - by Yongwei Xing
    Hi all Here is my situation: I use the SqlCommond to update some records in the SQL Server in a ASP.NET web site. Users can choose which records they want to update. Sometimes they may choose 40 or 60 records to update at a time.Is there any good way to do it? I do not want to do like it foreach(string ID in List) { Update here } Best Regards,

    Read the article

  • Accessing a database using visual c++ and OLEDB

    - by Shadi
    Does anybody have an example of working with database using Visual C++ and OLEDB? What should I include on top of my code? I have searched the internet and most examples are using C# or VB. Examples written by C++ are usually not complete. I really appreciate your help. Best, Shadi.

    Read the article

  • Low delay audio on Android via NDK

    - by hkhauke
    Hi, it seems that this question has been asked before, I just would like to know whether there is an update in Android. I plan to write an audio application involving low delay audio I/O (appr. < 10 ms). It seems not to be possible based on the methods proposed by the SDK, hence is there - in the meantime - a way to achieve this goal using the NDK? Best regards, HK

    Read the article

  • How can I implement incremental search on command line?

    - by florianbw
    I'd like to write small scripts which feature incremental search (find-as-you-type) on the command line. Use case: I have my mobile phone connected via USB, Using gammu --sendsms TEXT I can write text messages. I have the phonebook as CSV, and want to search-as-i-type on that. What's the easiest/best way to do it? It might be in bash/zsh/Perl/Python or any other scripting language.

    Read the article

  • Replace first Letter in a field Oracle

    - by Stanley
    Hi Guys I have this Table I need to replace the First Letter in ACCT_NAME with the First Name of ACCT_SHORT_NAME. Records like the Higliighted(RAFFMAN) should not be changed. I have tried: select acct_name, ACCT_SHORT_NAME,replace(acct_name, substr(acct_name, 1, 1), ACCT_SHORT_NAME) from tbaadm.gam where schm_type = 'TDA' and rcre_user_id = 'SYSTEM' and substr(acct_name,2,1) = ' ' I am getting: This means that am Picking the whole value in ACCT_SHORT_NAME. WHat is the best way to do what am trying to do?

    Read the article

  • textbox character countdown asp.net

    - by Ugene
    i have many textboxes on a form and all textboxes require to have a character limit / character countdown (50 character left of 150), what is the best way to achieve this and can anyone please provide code to implement. Much Grateful Thanks

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • C++ Performance/memory optimization guidelines

    - by ML
    Hi All, Does anyone have a resource for C++ memory optimization guidelines? Best practices, tuning, etc? As an example: Class xxx { public: xxx(); virtual ~xxx(); protected: private: }; Would there be ANY benefit on the compiler or memory allocation to get rid of protected and private since there there are no items that are protected and private in this class?

    Read the article

  • NHibernate (or other worth recommendation ORM), real life example?

    - by migajek
    I'd like to learn database applications in C# and I'm about to select some framework. I heard many recommendations of NHibernate, however I haven't decided yet. Anyway, I'd like to know if there's any real-life example (with sources) of NHibernate in C#, to learn best practices etc.? I know all of them are probably covered in the docs, but working example helps a lot understanding the proper development pattern.

    Read the article

  • Emacs bulk indent for Python

    - by Vernon
    Working with Python in Emacs if I want to add a try/catch to a block of code, I often find that I am having to indent the whole block, line by line. In Emacs, how do you indent the whole block at once. I am not an experienced Emacs user, but just find it is the best tool for working through ssh. I am using Emacs on the command line(Ubuntu), not as a gui, if that makes any difference.

    Read the article

  • A cross-platform application WPF, ASP.NET, Silverlight, WP7, XAML

    - by J. Lennon
    Considering the fact that all applications will interact with the web project (which will use the cloud or web services).. Is there any way to share my class models between applications? If yes, what is the best way to do it? About sending / receiving data from the Webservice, serialize and deserialize, how can I do this in a simple way without having to manually populate the objects? Any information about this applications would be really helpful!

    Read the article

  • export gridview data

    - by Eric
    What is the best way to export a gridview into an Excel spreadsheet? This seems easy except that my Gridview doesn't have an export attribute. What is the quickest way to do this?

    Read the article

  • How to implement a login page in a GWT app?

    - by Gatis
    My WebApp needs to authenticate user before allowing any sort of access. The scenario I'm trying to implement is a login page with username and password fields. Once user hits "send" button, a sign like "Verifing..." should be shown up while an RPC call verifies credentials. In case of success, load the main app screen. What is the best way to implement that?

    Read the article

  • Compare string with all values in array

    - by Hallik
    I am trying to fumble through python, and learn the best way to do things. I have a string where I am doing a compare with another string to see if there is a match: if paid[j].find(d)>=0: #BLAH BLAH If 'd' were an array, what is the most efficient way to see if the string contained in paid[j] has a match to any value in 'd'?

    Read the article

  • svn: default name for a tag when name is not important?

    - by Jason S
    I need to tag the current state of my source tree in svn. My problem is I don't care what the name is, I just need to mark the current revision in an immutable* manner. (*subject to malicious behavior) What's the best way to do this? branches/ tags/ ??? trunk/ should ??? be the date, an incrementing sequence, the repository rev # ...?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 612 613 614 615 616 617 618 619 620 621 622 623  | Next Page >