Search Results

Search found 40167 results on 1607 pages for 'try catch finally'.

Page 62/1607 | < Previous Page | 58 59 60 61 62 63 64 65 66 67 68 69  | Next Page >

  • Application Composer: Exposing Your Customizations in BI Analytics and Reporting

    - by Richard Bingham
    Introduction This article explains in simple terms how to ensure the customizations and extensions you have made to your Fusion Applications are available for use in reporting and analytics. It also includes four embedded demo videos from our YouTube channel (if they don't appear check the browser address bar for a blocking shield icon). If you are new to Business Intelligence consider first reviewing our getting started article, and you can read more about the topic of custom subject areas in the documentation book Extending Sales. There are essentially four sections to this post. First we look at how custom fields added to standard objects are made available for reporting. Secondly we look at creating custom subject areas on the standard objects. Next we consider reporting on custom objects, starting with simple standalone objects, then child custom objects, and finally custom objects with relationships. Finally this article reviews how flexfields are exposed for reporting. Whilst this article applies to both Cloud/SaaS and on-premises deployments, if you are an on-premises developer then you can also use the BI Administration Tool to customize your BI metadata repository (the RPD) and create new subject areas. Whilst this is not covered here you can read more in Chapter 8 of the Extensibility Guide for Developers. Custom Fields on Standard Objects If you add a custom field to your standard object then it's likely you'll want to include it in your reports. This is very simple, since all new fields are instantly available in the "[objectName] Extension" folder in existing subject areas. The following two minute video demonstrates this. Custom Subject Areas for Standard Objects You can create your own subject areas for use in analytics and reporting via Application Composer. An example use-case could be to simplify the seeded subject areas, since they sometimes contain complex data fields and internal values that could confuse business users. One thing to note is that you cannot create subject areas in a sandbox, as it is not supported by BI, so once your custom object is tested and complete you'll need to publish the sandbox before moving forwards. The subject area creation processes is essentially two-fold. Once the request is submitted the ADF artifacts are generated, then secondly the related metadata is sent to the BI presentation server API's to make the updates there. One thing to note is that this second step may take up to ten minutes to complete. Once finished the status of the custom subject area request should show as 'OK' and it is then ready for use. Within the creation processes wizard-like steps there are three concepts worth highlighting: Date Flattening - this feature permits the roll up of reports at various date levels, such as data by week, month, quarter, or year. You simply check the box to enable it for that date field. Measures - these are your own functions that you can build into the custom subject area. They are related to the field data type and include min-max for dates, and sum(), avg(), and count() for  numeric fields. Implicit Facts - used to make the BI metadata join between your object fields and the calculated measure fields. The advice is to choose the most frequently used measure to ensure consistency. This video shows a simple example, where a simplified subject area is created for the customer 'Contact' standard object, picking just a few fields upon which users can then create reports. Custom Objects Custom subject areas support three types of custom objects. First is a simple standalone custom object and for which the same process mentioned above applies. The next is a custom child object created on a standard object parent, and finally a custom object that is related to a parent object - usually through a dynamic choice list. Whilst the steps in each of these last two are mostly the same, there are differences in the way you choose the objects and their fields. This is illustrated in the videos below.The first video shows the process for creating a custom subject area for a simple standalone custom object. This second video demonstrates how to create custom subject areas for custom objects that are of parent:child type, as well as those those with dynamic-choice-list relationships. &lt;span id=&quot;XinhaEditingPostion&quot;&gt;&lt;/span&gt; Flexfields Dynamic and Extensible Flexfields satisfy a similar requirement as custom fields (for Application Composer), with flexfields common across the Fusion Financials, Supply Chain and Procurement, and HCM applications. The basic principle is when you enable and configure your flexfields, in the edit page under each segment region (for both global and context segments) there is a BI Enabled check box. Once this is checked and you've completed your configuration, you run the Scheduled Process job named 'Import Oracle Fusion Data Extensions for Transactional Business Intelligence' to generate and migrate the related BI artifacts and data. This applies for dynamic, key, and extensible flexfields. Of course there is more to consider in terms of how you wish your flexfields to be implemented and exposed in your reports, and details are given in Chapter 4 of the Extending Applications guide.

    Read the article

  • bumblebee does not work with metacity and KWin, but works with compiz

    - by cpu2
    If I try to launch something with optirun under compiz, it works. If I try to launch something with optirun under KDE or metacity, it gives me: [ 247.384077] [ERROR]Cannot access secondary GPU - error: [XORG] (EE) [ 247.384117] [ERROR]Aborting because fallback start is disabled. If it matters, I'm trying to launch Portal 2 with wine I have: Nvidia GeForce GT540M with optimus Acer Aspire Timeline X Intel core i5 and 3000 Integrated Graphics

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to move MOSS 2007 to another SharePoint Farm

    - by DipeshBhanani
    It was time of my first onsite client assignment on SharePoint. Client had one server production environment. They wanted to upgrade the topology with completely new SharePoint Farm of three servers. So, the task was to move whole MOSS 2007 stuff to the new server environment without impacting data. The last three words “… without impacting data…” were actually putting pressure on my head. Moreover SSP was required to move because additional information has been added for users apart from AD import.   I thought I had to do only backup and restore. It appeared pretty easy at first thought. Just because of these three damn scary words, I thought to check out on internet for guidance related to this scenario. I couldn’t get anything except general guidance of moving server on Microsoft TechNet site. I promised myself for starting blogs with this post if I would be successful in this task. Well, I took long time to write this but finally made it. I hope it will be useful to all guys looking for SharePoint server movement.   Before beginning restoration, make sure that, there is no difference in versions of SharePoint at source and destination server. Also check whether the state of SharePoint Installation at the time of backup and restore is same or not. (E.g. SharePoint related service packs and patches if any)   The main tasks of the server movement are as follow:   1.        Backup all the databases 2.        Install and configure SharePoint on new environment 3.        Deploy all solutions (WSP Files) globally to destination server- for installing features attached to the solutions 4.        Install all the custom features 5.        Deploy/Copy custom pages/files which are added to the “12Hive” folder later 6.        Restore SSP 7.        Restore My Site 8.        Restore other web application   Tasks 3 to 5 are for making sure that we have configured the environment well enough for the web application to be restored successfully. The main and complex task was restoring SSP. I have started restoring SSP through Central Admin. After a while, the restoration status was updated to “unsuccessful”. “Damn it, what went wrong?” I thought looking at the error detail down the page. I couldn’t remember the error message but I had corrected and restored it again.   Actually once you fail restoring SSP, until and unless you don’t clean all related stuff well, your restoration will be failed again and again. I wanted to find the actual reason. So cleaned, restored, cleaned, restored… I had tried almost 5-6 times and finally, I succeeded. I had realized how pleasant it is, to see the word “Successful” on the screen. Without wasting your much time to read, let me write all the detailed steps of restoring SSP:   1.        Delete the SSP through following STSADM command. stsadm -o deletessp -title <SSP name> -deletedatabases -force e.g.: stsadm -o deletessp -title SharedServices1 -deletedatabases –force 2.        Check and delete the web application associated with SSP if it exists. 3.        Remove Link from Check and remove “Alternate Access Mapping” associated with SSP if it exists. 4.        Check and delete IIS site as well as application pool associated with SSP if it exists. 5.        Stop following services: ·         Office SharePoint Server Search ·         Windows SharePoint Services Search ·         Windows SharePoint Services Help Search   6.        Delete all the databases associated/related to SSP from SQL Server. 7.        Reset IIS. 8.        Start again following services: ·         Office SharePoint Server Search ·         Windows SharePoint Services Search ·         Windows SharePoint Services Help Search   9.        Restore the new SSP.   After the SSP restoration, all other stuffs had completed very smoothly without any more issues. I did few modifications to sites for change of server name and finally, the new environment was ready.

    Read the article

  • Customizing / overriding ComboBox (2 replies)

    Hi, I would override a Windows.Forms.Combobox to have a MyObjectCollection instead of a ObjectCollection as Items property. I've try writing this code, but it seems that items are stored somewhere else (not in Items property). I can add items to collection but when I try to select an item from the combobox (at runtime) an exception tells me that there is no such element in Items (litterally it tel...

    Read the article

  • determine if udp socket can be accessed via external client

    - by JohnMerlino
    I don't have access to company firewall server. but supposedly the port 1720 is open on my one ubuntu server. So I want to test it with netcat: sudo nc -ul 1720 The port is listening on the machine ITSELF: sudo netstat -tulpn | grep nc udp 0 0 0.0.0.0:1720 0.0.0.0:* 29477/nc The port is open and in use on the machine ITSELF: lsof -i -n -P | grep 1720 gateway 980 myuser 8u IPv4 187284576 0t0 UDP *:1720 Checked the firewall on current server: sudo ufw allow 1720/udp Skipping adding existing rule Skipping adding existing rule (v6) sudo ufw status verbose | grep 1720 1720/udp ALLOW IN Anywhere 1720/udp ALLOW IN Anywhere (v6) But I try echoing data to it from another computer (I replaced the x's with the real integers): echo "Some data to send" | nc xx.xxx.xx.xxx 1720 But it didn't write anything. So then I try with telnet from the other computer as well: telnet xx.xxx.xx.xxx 1720 Trying xx.xxx.xx.xxx... telnet: connect to address xx.xxx.xx.xxx: Operation timed out telnet: Unable to connect to remote host Although I don't think telnet works with udp sockets. I ran nmap from another computer within the same local network and this is what I got: sudo nmap -v -A -sU -p 1720 xx.xxx.xx.xx Starting Nmap 5.21 ( http://nmap.org ) at 2013-10-31 15:41 EDT NSE: Loaded 36 scripts for scanning. Initiating Ping Scan at 15:41 Scanning xx.xxx.xx.xx [4 ports] Completed Ping Scan at 15:41, 0.10s elapsed (1 total hosts) Initiating Parallel DNS resolution of 1 host. at 15:41 Completed Parallel DNS resolution of 1 host. at 15:41, 0.00s elapsed Initiating UDP Scan at 15:41 Scanning xtremek.com (xx.xxx.xx.xx) [1 port] Completed UDP Scan at 15:41, 0.07s elapsed (1 total ports) Initiating Service scan at 15:41 Initiating OS detection (try #1) against xtremek.com (xx.xxx.xx.xx) Retrying OS detection (try #2) against xtremek.com (xx.xxx.xx.xx) Initiating Traceroute at 15:41 Completed Traceroute at 15:41, 0.01s elapsed NSE: Script scanning xx.xxx.xx.xx. NSE: Script Scanning completed. Nmap scan report for xtremek.com (xx.xxx.xx.xx) Host is up (0.00013s latency). PORT STATE SERVICE VERSION 1720/udp closed unknown Too many fingerprints match this host to give specific OS details Network Distance: 1 hop TRACEROUTE (using port 1720/udp) HOP RTT ADDRESS 1 0.13 ms xtremek.com (xx.xxx.xx.xx) Read data files from: /usr/share/nmap OS and Service detection performed. Please report any incorrect results at http://nmap.org/submit/ . Nmap done: 1 IP address (1 host up) scanned in 2.04 seconds Raw packets sent: 27 (2128B) | Rcvd: 24 (2248B). The only thing I can think of is a firewall or vpn issue. Is there anything else I can check for before requesting that they look at the firewall server again?

    Read the article

  • java webservice requires usernametoken over basichttpbinding (3 replies)

    I need to call a Java webservice. I can add a service reference without problems, and I get Intellisense in Visual Studio. However, when I try to call a service method I get an error message saying &quot;Missing (user) Security Information&quot;. I n my code I try to set usercredentials: testWS.WarrantyClaimServiceClient svc new TestClient.testWS.WarrantyClaimServiceClient(); svc.ClientCredentials.UserName....

    Read the article

  • hibernate not picking sessionFactory

    - by Satya
    My application-context.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE beans PUBLIC "-//SPRING//DTD BEAN//EN" "http://www.springframework.org/dtd/spring-beans.dtd"> <beans> <bean id="myDataSource" class="org.apache.commons.dbcp.BasicDataSource" destroy-method="close"> <property name="driverClassName"><value>com.mysql.jdbc.Driver</value></property> <property name="url"><value>jdbc:mysql://localhost:3306/myDB</value></property> <property name="username"><value>myUser</value></property> <property name="password"><value>myUser</value></property> </bean> <bean id="mySessionFactory" class="org.springframework.orm.hibernate3.LocalSessionFactoryBean"> <property name="mappingResources"> <property name="dataSource"><ref bean="myDataSource"/></property> <list> <value>com/x/model/config/hibernate/user.hbm.xml</value> </list> </property> <property name="hibernateProperties" > <value> hibernate.dialect=org.hibernate.dialect.MySQLDialect </value> </property> </bean> <bean id="userdao" class="com.x.y.z.UserDao"> <property name="sessionFactory"><ref bean="mySessionFactory"/></property> </bean> </beans> user.hbm.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="com.cpt.model"> <class name="User" table="user"> <id name="userId" column="id"> <generator class="native"/> </id> <property name="firstname" column="firstName" /> <property name="lastName" column="lastName"/> <property name="login" column="login"/> <property name="pass" column="pass"/> <property name="superemail" column="superEmail"/> </class> </hibernate-mapping> and the UserDao is package com.x.y.z; import java.sql.Connection; import java.sql.DriverManager; import java.sql.SQLException; import java.sql.Statement; import org.hibernate.HibernateException; import org.hibernate.Session; import org.hibernate.SessionFactory; import org.hibernate.cfg.Configuration; import org.springframework.beans.factory.annotation.Autowired; import org.springframework.orm.hibernate.support.HibernateDaoSupport; import org.springframework.stereotype.Component; import com.x.model.User; @Component public class UserDao { private SessionFactory sessionFactory; public void addUser(User user) { Session session; try { try { session = getSessionFactory().openSession(); // session = sessionFactory.openSession(); session.save(user); } catch (RuntimeException e) { // TODO Auto-generated catch block e.printStackTrace(); } } catch (HibernateException e) { // TODO Auto-generated catch block System.out.println("printing in the catch"); e.printStackTrace(); } } public SessionFactory getSessionFactory() { System.out.println("returning session factory ::: sessionFactory == null :: "+sessionFactory.openSession()); return sessionFactory; } public void setSessionFactory(SessionFactory sessionFactory) { System.out.println("this is setting session factory" + sessionFactory.getClass()); System.out.println("setting session factory ::: sessionFactory == null :: "+sessionFactory==null); this.sessionFactory = sessionFactory; System.out.println("setting session factory ::: sessionFactory == null :: "+this.sessionFactory.openSession().getClass()); System.out.println(getSessionFactory().openSession().isOpen()); } } However, I keep getting 14:45:09,929 INFO [org.hibernate.impl.SessionFactoryImpl] building session fact ory 14:45:09,933 WARN [net.sf.ehcache.config.Configurator] No configuration found. Configuring ehcache from ehcache-failsafe.xml found in the classpath: vfs:/C:/jb /server/default/deploy/C.war/WEB-INF/lib/ehcache-1.1.jar/ehcache-failsafe.xml 14:45:10,007 INFO [org.hibernate.impl.SessionFactoryObjectFactory] Not binding factory to JNDI, no JNDI name configured 14:45:10,008 INFO [org.hibernate.impl.SessionFactoryImpl] Checking 0 named quer ies 14:45:10,017 INFO [STDOUT] this is setting session factoryclass $Proxy178 14:45:10,017 INFO [STDOUT] false 14:45:10,019 INFO [STDOUT] setting session factory ::: sessionFactory == null : : class org.hibernate.impl.SessionImpl 14:45:10,020 INFO [STDOUT] returning session factory ::: sessionFactory == null :: org.hibernate.impl.SessionImpl(PersistentContext[entitiesByKey={}] ActionQue ue[insertions=[] updates=[] deletions=[] collectionCreations=[] collectionRemova ls=[] collectionUpdates=[]]) It is giving sessionFactory null . Any Idea where am I failing ? Thanks

    Read the article

  • permission denied to move files

    - by James
    i want to clear space on my computer in order to download drivers for my internet, so i tried moving files to a different location, unfortunately i dont have permission to do this, how do i change this, i should point out that i am not logged in, i think im a guest or something because if i log in i can not gain access to the internet to download the drivers that i need, so im using the cd and using the try ubunt feature to try achieve downloading the drivers. this is very frustrating for me as im new and have not got a clue how to do this

    Read the article

  • How to configure dbus to allow ssh-user to suspend server?

    - by Produnis
    I try to suspend my server using dbus and UPower. The server runs Ubuntu LucidLynx 64bit. While everything works fine if I am sitting directly at the machine, it won't work via ssh. If I connect to the server via ssh and try to suspend the machine using dbus and upower, it gives back dbus.exceptions.DBusException: org.freedesktop.UPower.GeneralError: not authorized Could anyone please tell me how to configure dbus in order to allow ssh-users to suspend the machine?

    Read the article

  • Yes, I did it - Skydiving in Mauritius

    Finally, I did it or better said we did it. Already back in November last year I saw the big billboard advertisement of Skydive Austral Mauritius near Caudan Waterfront in Port Louis and decided for myself that this is going to be the perfect birthday gift for my wife. Simply out of curiosity I would join her tandem jump with a second instructor. Due to her pregnancy of our son I had to be patient... But then finally, her birthday had arrived and on our midnight celebration session I showed her her netbook with the website preloaded. Actually, it was the "perfect" timing... Recovery from her cesarean is fine, local weather conditions are gorgious and the children were under surveillance of my mum - spending her annual holidays on the island. So, after late wake-up in the morning, we packed our stuff and off we went. According to Google Maps direction indication we had to drive for roughly 50km (only) but traffic here in Mauritius is always challenging. The dropzone is at the Zone Industrielle Mon Loisir Sugar Estate near Riviere du Rempart at the northern east coast. Anyways, we were not in a hurry and arrived there shortly after noon. The access road to the airfield are just small down-driven paths through sugar cane fields and according to our daughter "it's bumpy!". True true true... The facilities at Skydive Austral Mauritius are complete except for food. Enough space for parking, easy handling at the reception and a lot to see for the kids. There's even a big terrace with several sets of tables and chairs, small bar for soft drinks, strictly non-alcoholic. The team over there is all welcoming and warm-hearthy! Having the kids with us was no issue at all. Quite the opposite, our daugther was allowed to discover a lot of things than we adults did. Even visiting the small air plane was on the menu for her. Really great stuff! While waiting for our turn we enjoyed watching other people getting ready in the jump gear, taking off with the Cessna, and finally coming back down on the tandem parachute. Actually, the different expressions on their faces was one of the best parts while waiting. Great mental preparation as my wife was getting more anxious about her first jump... {loadposition content_adsense} First, we got some information about the procedures on the plane about how to get seated, tight up with our instructors and how to get ready for the jump off the plane as soon as we arrive the height of 10.000 ft. All well explained and easy to understand after all.Next, we met with our jumpers Chris and Lee aka "Rasta" to get dressed and ready for take-off. Those guys are really cool and relaxed for their job. From that point on, the DVD session / recording for my wife's birthday started and we really had a lot of fun... The difference between that small Cessna and a commercial flight with an Airbus or a Boeing is astronomic! The climb up to 10.000 ft took us roughly 25 minutes and we enjoyed the magnificent view over the turquoise lagunes near Poste de Flacq, Lafayette and Isle d'Ambre on the north-east coast. After flying through the clouds we sun-bathed and looked over "iced-sugar covered" Mauritius. You might have a look at the picture gallery of Skydive Mauritius for better imagination. The moment of truth, or better said, point of no return came after approximately 25 minutes. The door opens, moving into position on the side on top of the wheel and... out! Back flip and free fall! Slight turns and Wooooohooooo! through the clouds... It so amazing and breath-taking! So undescribable! You have to experience this yourself! Some seconds later the parachute opened and we glided smoothly with some turns and spins back down to the dropzone. The rest of the family could hear and see us soon and the landing was easy going. We never had any doubts or fear about our instructors. They did a great job and we are looking forward to book our next job. I might even consider to follow educational classes on skydiving and earn a license. By the way, feel free to get in touch with Skydive Austral Mauritius. Either via contact details on their website or tweeting a little bit with them. Follow the tweets of Chris and fellows on SkydiveAustral.

    Read the article

  • Can not authenticate to run GParted

    - by alfish
    Whenever I try to run a program from gnome gui, I get message Authenticated is required to run the Gparted Partition Editor The same goes for all programs that need root permission and I try to run from 'System tools' in my gnome-fallback. However the same user can become root in gnome terminal with no problem (I added the user to sudoers). I must mention that I've changed the user's password after OS install, so I think I need to update something but don't know what. I appreciate your hints.

    Read the article

  • Can not authenticate form system tools

    - by alfish
    Whenever I try to run a program from gnome, I get messages like Authenticated is required to run the Gparted Partition Editor The same goes for all programs that need root permission and I try to run from 'System tools' in my gnome-fallback. However the same user can become root in gnome terminal with no problem (I added the user to sudoers). I must mention that I've changed the user's password after OS install, so I think I need to update something but don't know what. I appreciate your hints.

    Read the article

  • Brocken package manager due to incorrect Banshee package

    - by user54974
    Sup, so, I'm not familiar with linux at all so help is much appreciated. I've been trying to boot my pc up from a live CD unsuccessfully. I get to the stage at which there are the options to test without installing or install or so on where I select 'Install Ubuntu.' Here it relays through some fast DOS commands until it reaches 'end trace' and then, eventually, 'Killed.' I have already got a functional 11.10 version installed, could this be a problem? The reason I am attempting a reinstall is because the package system is damaged inside 11.10, a problem I can't seem to solve. If I try to install any new software from within the software centre it tells me that two banshee extensions must be removed. I try to remove these from inside the terminal, using apt-get remove, which results in:** You might want to run apt-get -f install to correct these: The following packages have unmet dependencies. banshee-extension-ubuntuonemusicstore : Depends: banshee (>= 2.2.1) but 2.2.0-1ubuntu2 is to be installed E: Unmet dependencies. Try 'apt-get -f install' with no packages (or specify a solution). The software centre suggests that I disable all third party repositories and run apt-get install -f I have done so but the package system remains damaged and apt-get install -fattempts to install banshee 2.2.1 but returns: Errors were encountered while processing: /var/cache/apt/archives/banshee_2.2.1-1ubuntu3_i386.deb E: Sub-process /usr/bin/dpkg returned an error code (1) I have also tried apt-get update (runs fine) and apt-get upgrade. The upgrade command apt-get upgrade results in: Reading package lists... Done Building dependency tree Reading state information... Done You might want to run ‘apt-get -f install’ to correct these. The following packages have unmet dependencies. banshee-extension-soundmenu : Depends: banshee (>= 2.2.1) but 2.2.0-1ubuntu2 is installed banshee-extension-ubuntuonemusicstore : Depends: banshee (>= 2.2.1) but 2.2.0-1ubuntu2 is installed E: Unmet dependencies. Try using -f. I seem to be going round and round in circles here! If only I could reinstall successfully. Only proposed updates (oneiric proposed) is not enabled.

    Read the article

  • install Ubuntu and remove Windows 7

    - by dani
    I'm using Windows 7 on my laptop (2GB RAM, 250 GB HDD). I want to install Ubuntu and remove Windows 7. I have Partitioned my laptop into 2 partitions: , C Drive - 105 GB and D Drive - 145 GB. I want to install Ubuntu on C drive all my data in D drive, no backup I have already selected the "Try something else option " /dev/sdb /dev/sdb1 ntfs 104855 MB unknown C drive /dev/sdb5 ntfs 145192 MB unknown D drive I need help using the "Try Something Else" Option My course of action: laptop power on bootubuntu nextsomething elsepartition.

    Read the article

  • ssh: connect to host 192.168.1.7 port 22: Connection refused

    - by Rudra
    I get this error when ever I try to connect my desktop with another desktop using SSH, but I'm able to ping the other desktop successfully. ssh: connect to host 192.168.1.7 port 22: Connection refused When I try to restart sshd, it says sshd : unrecognized service I can connect to remote server using SSH but I'm not able to connect within the local network. Please help me in this regards, Thanks in advance.

    Read the article

  • NIS client authentication

    - by Tarun Gupta
    How to configure the nis client on ubuntu? and how to configure system authentication? there is no option for system authentication like system setting system info in my system etc. when ever i go to software center and search them nis authentication then i got one package for nis authentication and i try to install them then one error occur that is remove hostname utility. when i try to remove hostname utility then it does not remove.

    Read the article

  • Deleting Large Number of Records

    Often someone will try to perform a delete on a large number of records and run into a number of problems. Slow performance, log growth, and more. Lynn Pettis shows us how to better handle this situation in SQL Server 2000 and SQL Server 2005 The Future of SQL Server Monitoring "Being web-based, SQL Monitor 2.0 enables you to check on your servers from almost any location" Jonathan Allen.Try SQL Monitor now.

    Read the article

  • Starting software projects

    - by shox
    Always , when i try to start new project , with what i think new ideas , first of all i search the web to try to find some thing same, most of the time ( if not all ) , i find that my ideas of new project have been implemented hundred of times , i think every one in software industry , feel this every day , the question is : when should i approve an idea and start building it , although its implemented hundred of times around the world . How i can make my way in trying of build something new

    Read the article

  • Can't install a dependency?

    - by Chibueze Opata
    I've been trying to install 'boot-repair' but it keeps saying: The following packages have unmet dependencies: Depends: boot-sav (= 3.196) but 3.196~ppa3~quantal is to be installed E: Unable to correct problems, you have held broken packages. When I try installing 'boot-sav', everything seems okay, but when I try it again, it just shows the same message over and over again. How can I fix such a problem? Thanks.

    Read the article

  • Netbeans Java SE GUI Builder: private initComponents() problem

    - by maSnun
    When I build a GUI for my Java SE app with Netbeans GUI builder, it puts all the codes in the initComponents() method which is private. I could not change it to public. So, all the components are accessible only to the class containing the UI. I want to access those components from another class so that I can write custom event handlers and everything. Most importantly I want to separate my GUI code and non-GUI from each other. I can copy paste the GUI code and later make them public by hand to achieve what I want. But thats a pain. I have to handcraft a portion whenever I need to re-design the UI. What I tried to do: I used the variable identifier to make the text box public. Now how can I access the text box from the Main class? I think I need the component generated in a public method as well. I am new to Java. Any helps? Here's the sample classes: The UI (uiFrame.java) /* * To change this template, choose Tools | Templates * and open the template in the editor. */ /* * uiFrame.java * * Created on Jun 3, 2010, 9:33:15 PM */ package barcode; import java.util.logging.Level; import java.util.logging.Logger; import javax.swing.JFileChooser; import javax.swing.UIManager; import javax.swing.UnsupportedLookAndFeelException; import net.sourceforge.barbecue.output.OutputException; /** * * @author masnun */ public class uiFrame extends javax.swing.JFrame { /** Creates new form uiFrame */ public uiFrame() { try { try { // Set cross-platform Java L&F (also called "Metal") UIManager.setLookAndFeel(UIManager.getSystemLookAndFeelClassName()); } catch (ClassNotFoundException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (InstantiationException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (IllegalAccessException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (UnsupportedLookAndFeelException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } finally { } initComponents(); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { label1 = new javax.swing.JLabel(); textBox = new javax.swing.JTextField(); saveButton = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); label1.setFont(label1.getFont().deriveFont(label1.getFont().getStyle() | java.awt.Font.BOLD, 13)); label1.setText("Type a text:"); label1.setName("label1"); // NOI18N saveButton.setText("Save"); saveButton.addMouseListener(new java.awt.event.MouseAdapter() { public void mousePressed(java.awt.event.MouseEvent evt) { saveButtonMousePressed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(56, 56, 56) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, 272, javax.swing.GroupLayout.PREFERRED_SIZE) .addContainerGap(72, Short.MAX_VALUE)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(154, Short.MAX_VALUE) .addComponent(saveButton, javax.swing.GroupLayout.PREFERRED_SIZE, 102, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(144, 144, 144)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(140, Short.MAX_VALUE) .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 133, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(127, 127, 127)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 25, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.RELATED) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.UNRELATED) .addComponent(saveButton) .addContainerGap(193, Short.MAX_VALUE)) ); pack(); }// </editor-fold> @SuppressWarnings("static-access") private void saveButtonMousePressed(java.awt.event.MouseEvent evt) { JFileChooser file = new JFileChooser(); file.showSaveDialog(null); String data = file.getSelectedFile().getAbsolutePath(); String text = textBox.getText(); BarcodeGenerator barcodeFactory = new BarcodeGenerator(); try { barcodeFactory.generateBarcode(text, data); } catch (OutputException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } /** * @param args the command line arguments */ // Variables declaration - do not modify private javax.swing.JLabel label1; private javax.swing.JButton saveButton; public javax.swing.JTextField textBox; // End of variables declaration } The Main Class (Main.java) package barcode; import javax.swing.JFrame; public class Main { public static void main(String[] args) { JFrame ui = new uiFrame(); ui.pack(); ui.show(); } }

    Read the article

  • Java RMI cannot connect to host from external client.

    - by Koe
    I've been using RMI in this project for a while. I've gotten the client program to connect (amongst other things) to the server when running it over my LAN, however when running it over the internet I'm running into the following exception: java.rmi.ConnectException: Connection refused to host: (private IP of host machine); nested exception is: java.net.ConnectException: Connection timed out: connect at sun.rmi.transport.tcp.TCPEndpoint.newSocket(Unknown Source) at sun.rmi.transport.tcp.TCPChannel.createConnection(Unknown Source) at sun.rmi.transport.tcp.TCPChannel.newConnection(Unknown Source) at sun.rmi.server.UnicastRef.invoke(Unknown Source) at java.rmi.server.RemoteObjectInvocationHandler.invokeRemoteMethod(Unknown Source) at java.rmi.server.RemoteObjectInvocationHandler.invoke(Unknown Source) at $Proxy1.ping(Unknown Source) at client.Launcher$PingLabel.runPing(Launcher.java:366) at client.Launcher$PingLabel.<init>(Launcher.java:353) at client.Launcher.setupContentPane(Launcher.java:112) at client.Launcher.<init>(Launcher.java:99) at client.Launcher.main(Launcher.java:59) Caused by: java.net.ConnectException: Connection timed out: connect at java.net.PlainSocketImpl.socketConnect(Native Method) at java.net.PlainSocketImpl.doConnect(Unknown Source) at java.net.PlainSocketImpl.connectToAddress(Unknown Source) at java.net.PlainSocketImpl.connect(Unknown Source) at java.net.SocksSocketImpl.connect(Unknown Source) at java.net.Socket.connect(Unknown Source) at java.net.Socket.connect(Unknown Source) at java.net.Socket.<init>(Unknown Source) at java.net.Socket.<init>(Unknown Source) at sun.rmi.transport.proxy.RMIDirectSocketFactory.createSocket(Unknown Source) at sun.rmi.transport.proxy.RMIMasterSocketFactory.createSocket(Unknown Source) ... 12 more This error is remeniscent of my early implementation of RMI and I can obtain the error verbatum if I run the client locally without the server program running as well. To me Connection Timed Out means a problem with the server's response. Here's the client initiation: public static void main(String[] args) { try { String host = "<WAN IP>"; Registry registry = LocateRegistry.getRegistry(host, 1099); Login lstub = (Login) registry.lookup("Login Server"); Information istub = (Information) registry.lookup("Game Server"); new Launcher(istub, lstub); } catch (RemoteException e) { System.err.println("Client exception: " + e.toString()); e.printStackTrace(); } catch (NotBoundException e) { System.err.println("Client exception: " + e.toString()); e.printStackTrace(); } } Interestingly enough no Remote Exception is thrown here. Here's the server initiation: public static void main(String args[]) { try { GameServer gobj = new GameServer(); Information gstub = (Information) UnicastRemoteObject.exportObject( gobj, 1099); Registry registry = LocateRegistry.createRegistry(1099); registry.bind("Game Server", gstub); LoginServer lobj = new LoginServer(gobj); Login lstub = (Login) UnicastRemoteObject.exportObject(lobj, 7099); // Bind the remote object's stub in the registry registry.bind("Login Server", lstub); System.out.println("Server ready"); } catch (Exception e) { System.err.println("Server exception: " + e.toString()); e.printStackTrace(); } } Bad practice with the catch(Exception e) I know but bear with me. Up to this stage I know it works fine over the LAN, here's where the exception occurs over the WAN and is the first place a method in the server is called: private class PingLabel extends JLabel { private static final long serialVersionUID = 1L; public PingLabel() { super(""); runPing(); } public void setText(String text) { super.setText("Ping: " + text + "ms"); } public void runPing() { try { PingThread pt = new PingThread(); gameServer.ping(); pt.setRecieved(true); setText("" + pt.getTime()); } catch (RemoteException e) { e.printStackTrace(); } } } That's a label placed on the launcher as a ping test. the method ping(), in gameserver does nothing, as in is a null method. It's worth noting also that ports 1099 and 7099 are forwarded to the server machine (which should be obvious from the stack trace). Can anyone see anyting I'm missing/doing wrong? If you need any more information just ask. EDIT: I'm practically certain the problem has nothing to do with my router settings. When disabling my port forwarding settings I get a slightly different error: Client exception: java.rmi.ConnectException: Connection refused to host: (-WAN IP NOT LOCAL IP-); but it appears both on the machine locally connected to the server and on the remote machine. In addition, I got it to work seamlessly when connecting the server straight tho the modem (cutting out the router. I can only conclude the problem is in my router's settings but can't see where (I've checked and double checked the port forwarding page). That's the only answer i can come up with.

    Read the article

  • Can't access windows 7 shared files on Ubuntu 11.10

    - by Corey
    I just set up ubuntu 11.10 and Samba. I got it to access shares on a Vista machine, but when I try to access the shares on a windows 7 machine it asks for a Username, Domain, and Password. I have no password set up on the windows 7 machine so I put in the username, and domain try to connect and the password prompt keeps appearing...also tried guest and admin with no luck...I've tried many different fixes(modifying registry entries & advanced securities on the win 7 machine) with no luck. Thanks

    Read the article

  • How can I export emacs documents in 13.04?

    - by Whippy
    When I try to export a document from org-mode in emacs, c-X, c-E now results in 'Can't find library org' whereas in 10.04 it opened the export dialog allowing me to produce html, pdf etc. from the source org file. Searching with Google, I found this bug for redhat which looks closely related. The trouble is I don't know how to get hold of the emacs-el package it talks about in ubuntu in order to try its workaround so I'm currently stuck.

    Read the article

  • Cannot boot from K/Ubuntu install disk on my UEFI system

    - by user93241
    I just got a new system and have been trying to get it set up w/ Win7 & Kubuntu dual-boot, but I've got a major problem. The BIOS of my motherboard (an Asus Crosshair 990FX) is strictly UEFI -- there is no legacy support mode available. I've been reading up on how to get Kubuntu installed in UEFI mode but no matter what I try I cannot seem to even boot into my install CD/USB key properly. I can get as far as the selection screen ("Try Kubuntu", "Install Kubuntu"...) but this screen starts off not appearing correctly. If I try moving the cursor around it sometimes seems to correct itself and show me my choices. But once I select "Try Kubuntu" it starts loading, the screen goes black and then proceeds to flicker -- about once every 5-10 seconds or so. This continues indefinitely. I've tried this with both Kubuntu & Ubuntu installation media, even the AMD64+Mac Ubuntu variety that is supposed to be a lot more flexible w.r.t. UEFI. The only hint I've had that the system might have booted correctly is a little drum sound that plays when booting from the Ubuntu install disk. Well, that and the fact that when I hit my system's power button it seems to shut down correctly, even ejecting the CD at the end. This might be a video driver issue; my system has two nVidia 550's, one of which is attached to my primary monitor. (The secondary isn't hooked up yet.) I'll keep looking over similar questions but any advice would be greatly appreciated. UPDATE: I've tried booting into my 12.04 install CD twice now, each time using two different options supplied by my BIOS. One seemed to offer the ability to boot into my CD under UEFI mode -- this didn't even produce the initial boot menu. The other method offers the ability to boot into my CD NOT under UEFI mode. This DOES produce the boot menu, but after this point it seems I still cannot get to a proper video mode to see what's going on.

    Read the article

< Previous Page | 58 59 60 61 62 63 64 65 66 67 68 69  | Next Page >