Search Results

Search found 15923 results on 637 pages for 'static reflection'.

Page 627/637 | < Previous Page | 623 624 625 626 627 628 629 630 631 632 633 634  | Next Page >

  • OIM 11g : Multi-thread approach for writing custom scheduled job

    - by Saravanan V S
    In this post I have shared my experience of designing and developing an OIM schedule job that uses multi threaded approach for updating data in OIM using APIs.  I have used thread pool (in particular fixed thread pool) pattern in developing the OIM schedule job. The thread pooling pattern has noted advantages compared to thread per task approach. I have listed few of the advantage here ·         Threads are reused ·         Creation and tear-down cost of thread is reduced ·         Task execution latency is reduced ·         Improved performance ·         Controlled and efficient management of memory and resources used by threads More about java thread pool http://docs.oracle.com/javase/tutorial/essential/concurrency/pools.html The following diagram depicts the high-level architectural diagram of the schedule job that process input from a flat file to update OIM process form data using fixed thread pool approach    The custom scheduled job shared in this post is developed to meet following requirement 1)      Need to process a CSV extract that contains identity, account identifying key and list of data to be updated on an existing OIM resource account. 2)      CSV file can contain data for multiple resources configured in OIM 3)      List of attribute to update and mapping between CSV column to OIM fields may vary between resources The following are three Java class developed for this requirement (I have given only prototype of the code that explains how to use thread pools in schedule task) CustomScheduler.java - Implementation of TaskSupport class that reads and passes the parameters configured on the schedule job to Thread Executor class. package com.oracle.oim.scheduler; import java.util.HashMap; import com.oracle.oim.bo.MultiThreadDataRecon; import oracle.iam.scheduler.vo.TaskSupport; public class CustomScheduler extends TaskSupport {      public void execute(HashMap options) throws Exception {             /*  Read Schedule Job Parameters */             String param1 = (String) options.get(“Parameter1”);             .             int noOfThread = (int) options.get(“No of Threads”);             .             String paramn = (int) options.get(“ParamterN”); /* Provide all the required input configured on schedule job to Thread Pool Executor implementation class like 1) Name of the file, 2) Delimiter 3) Header Row Numer 4) Line Escape character 5) Config and resource map lookup 6) No the thread to create */ new MultiThreadDataRecon(all_required_parameters, noOfThreads).reconcile();       }       public HashMap getAttributes() { return null; }       public void setAttributes() {       } } MultiThreadDataRecon.java – Helper class that reads data from input file, initialize the thread executor and builds the task queue. package com.oracle.oim.bo; import <required file IO classes>; import  <required java.util classes>; import  <required OIM API classes>; import <csv reader api>; public class MultiThreadDataRecon {  private int noOfThreads;  private ExecutorService threadExecutor = null;  public MetaDataRecon(<required params>, int noOfThreads)  {       //Store parameters locally       .       .       this.noOfThread = noOfThread;  }        /**        *  Initialize         */  private void init() throws Exception {       try {             // Initialize CSV file reader API objects             // Initialize OIM API objects             /* Initialize Fixed Thread Pool Executor class if no of threads                 configured is more than 1 */             if (noOfThreads > 1) {                   threadExecutor = Executors.newFixedThreadPool(noOfThreads);             } else {                   threadExecutor = Executors.newSingleThreadExecutor();             }             /* Initialize TaskProcess clas s which will be executing task                 from the Queue */                TaskProcessor.initializeConfig(params);       } catch (***Exception e) {                   // TO DO       }  }       /**        *  Method to reconcile data from CSV to OIM        */ public void reconcile() throws Exception {        try {             init();             while(<csv file has line>){                   processRow(line);             }             /* Initiate thread shutdown */             threadExecutor.shutdown();             while (!threadExecutor.isTerminated()) {                 // Wait for all task to complete.             }            } catch (Exception e) {                   // TO DO            } finally {                   try {                         //Close all the file handles                   } catch (IOException e) {                         //TO DO                   }             }       }       /**        * Method to process         */       private void processRow(String row) {             // Create task processor instance with the row data              // Following code push the task to work queue and wait for next                available thread to execute             threadExecutor.execute(new TaskProcessor(rowData));       } } TaskProcessor.java – Implementation of “Runnable” interface that executes the required business logic to update data in OIM. package com.oracle.oim.bo; import <required APIs> class TaskProcessor implements Runnable {       //Initialize required member variables       /**        * Constructor        */       public TaskProcessor(<row data>) {             // Initialize and parse csv row       }       /*       *  Method to initialize required object for task execution       */       public static void initializeConfig(<params>) {             // Process param and initialize the required configs and object       }           /*        * (non-Javadoc)        *         * @see java.lang.Runnable#run()        */            public void run() {             if (<is csv data valid>){                   processData();             }       }  /**   * Process the the received CSV input   */  private void processData() {     try{       //Find the user in OIM using the identity matching key value from CSV       // Find the account to be update from user’s account based on account identifying key on CSV       // Update the account with data from CSV       }catch(***Exception e){           //TO DO       }   } }

    Read the article

  • Help required in adding new methods, properties into existing classes dynamically

    - by Bepenfriends
    Hi All, I am not sure whether it is possible to achieve this kind of implementation in Dot Net. Below are the information Currently we are on an application which is done in COM+, ASP, XSL, XML technologies. It is a multi tier architecture application in which COM+ acts as the BAL. The execution steps for any CRUD operation will be defined using a seperate UI which uses XML to store the information. BAL reads the XML and understands the execution steps which are defined and executes corresponding methods in DLL. Much like EDM we have our custom model (using XML) which determines which property of object is searchable, retrievable etc. Based on this information BAL constructs queries and calls procedures to get the data. In the current application both BAL and DAL are heavily customizable without doing any code change. the results will be transmitted to presentation layer in XML format which constructs the UI based on the data recieved. Now I am creating a migration project which deals with employee information. It is also going to follow the N Tier architecture in which the presentation layer communicates with BAL which connects to DAL to return the Data. Here is the problem, In our existing version we are handling every information as XML in its native form (no converstion of object etc), but in the migration project, Team is really interested in utilizing the OOP model of development where every information which is sent from BAL need to be converted to objects of its respective types (example employeeCollection, Address Collection etc). If we have the static number of data returned from BAL we can have a class which contains those nodes as properties and we can access the same. But in our case the data returned from our BAL need to be customized. How can we handle the customization in presentation layer which is converting the result to an Object. Below is an example of the XML returned <employees> <employee> <firstName>Employee 1 First Name</firstName> <lastName>Employee 1 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>3</addressType> <StreetName>Street name3</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> <employee> <firstName>Employee 2 First Name</firstName> <lastName>Employee 2 Last Name</lastName> <addresses> <address> <addressType>1</addressType> <StreetName>Street name1</StreetName> <RegionName>Region name</RegionName> <address> <address> <addressType>2</addressType> <StreetName>Street name2</StreetName> <RegionName>Region name</RegionName> <address> <addresses> </employee> </employees> If these are the only columns then i can write a class which is like public class Address{ public int AddressType {get;set;}; public string StreetName {get;set;}; public string RegionName {get;set;}; } public class Employee{ public string FirstName {get; set;} public string LastName {get; set;} public string AddressCollection {get; set;} } public class EmployeeCollection : List<Employee>{ public bool Add (Employee Data){ .... } } public class AddressCollection : List<Address>{ public bool Add (Address Data){ .... } } This class will be provided to customers and consultants as DLLs. We will not provide the source code for the same. Now when the consultants or customers does customization(example adding country to address and adding passport information object with employee object) they must be able to access those properties in these classes, but without source code they will not be able to do those modifications.which makes the application useless. Is there is any way to acomplish this in DotNet. I thought of using Anonymous classes but, the problem with Anonymous classes are we can not have methods in it. I am not sure how can i fit the collection objects (which will be inturn an anonymous class) Not sure about datagrid / user control binding etc. I also thought of using CODEDom to create classes runtime but not sure about the meory, performance issues. also the classes must be created only once and must use the same till there is another change. Kindly help me out in this problem. Any kind of help meterial/ cryptic code/ links will be helpful.

    Read the article

  • jqGrid concatinating/building html tag incorrectly

    - by Energetic Pixels
    Please excuse to length of post. But I needed to explain what I am seeing. I have a onSelectRow option that is supposed to build stacked html <li> tags (such as <li>...</li> <li>...</li> <li>...</li> ) up to the number of static xml elements that I am looking at. But my script is concatinating all the image src links together instead of building the whole listobject tag. Everything else in my jqGrid script works with exception of repeated elements inside my xml. onSelectRow: function() { var gsr = $('#searchResults').jqGrid('getGridParam', 'selrow'); if (gsr) { var data = $('#searchResults').jqGrid('getRowData', gsr); $('#thumbs ul').html('<li><a class='thumb' href='' + data.piclocation + '' title='' + data.pictitle + ''><img src='" + data.picthumb + "' alt='" + data.pictitle + "' /></a><div class='caption'><div class='image-title'>" + data.pictitle + "</div></div></li>"); };" my xml file is something like this: <photo> <pic> <asset>weaponLib/stillMedia/slides/A106.jpg</asset> <thumb>weaponLib/stillMedia/thumbs/A106.jpg</thumb> <caption>Side view of DODIC A106</caption> <title>Side view of 22 caliber long rifle ball cartridge</title> </pic> <pic> <asset>weaponLib/stillMedia/slides/A106_A.jpg</asset> <thumb>weaponLib/stillMedia/thumbs/A106_A.jpg</thumb> <caption>Side view of DODIC A106</caption> <title>Side view of 22 caliber long rifle ball cartridge</title> </pic> <pic> <asset>weaponLib/stillMedia/slides/A106_B.jpg</asset> <thumb>weaponLib/stillMedia/thumbs/A106_B.jpg</thumb> <caption>Side view of DODIC A106</caption> <title>Side view of 22 caliber long rifle ball cartridge</title> </pic> <pic> <asset>weaponLib/stillMedia/slides/A106_C.jpg</asset> <thumb>weaponLib/stillMedia/thumbs/A106_C.jpg</thumb> <caption>Side view of DODIC A106</caption> <title>Side view of 22 caliber long rifle ball cartridge</title> </pic> <pic> <asset>weaponLib/stillMedia/slides/A106_D.jpg</asset> <thumb>weaponLib/stillMedia/thumbs/A106_D.jpg</thumb> <caption>Side view of DODIC A106</caption> <title>Side view of 22 caliber long rifle ball cartridge</title> </pic> My script works fine when it only sees one sequence, but when it sees more than one it puts all html inside the tags together then for the caption and title does the same for them. It generates only one <li></li> tag set instead of 5 in the example above like I want. The <li> tags are being used by a slideshow (with thumbnails) utility. Inside firebug, I can see the object that it is built for me: <a title="Side view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridge" href="weaponLib/stillMedia/slides/A106.jpgweaponLib/stillMedia/slides/A106_A.jpgweaponLib/stillMedia/slides/A106_B.jpgweaponLib/stillMedia/slides/A106_C.jpgweaponLib/stillMedia/slides/A106_D.jpg" class="thumb"><img alt="Side view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridgeSide view of 22 caliber long rifle ball cartridge" src="weaponLib/stillMedia/thumbs/A106.jpgweaponLib/stillMedia/thumbs/A106_A.jpgweaponLib/stillMedia/thumbs/A106_B.jpgweaponLib/stillMedia/thumbs/A106_C.jpgweaponLib/stillMedia/thumbs/A106_D.jpg"></a> Within jqGrid, the cell is holding: <td title="weaponLib/stillMedia/slides/A106.jpgweaponLib/stillMedia/slides/A106_A.jpgweaponLib/stillMedia/slides/A106_B.jpgweaponLib/stillMedia/slides/A106_C.jpgweaponLib/stillMedia/slides/A106_D.jpg" style="text-align: center; display: none;" role="gridcell">weaponLib/stillMedia/slides/A106.jpgweaponLib/stillMedia/slides/A106_A.jpgweaponLib/stillMedia/slides/A106_B.jpgweaponLib/stillMedia/slides/A106_C.jpgweaponLib/stillMedia/slides/A106_D.jpg</td> I know that jqGrid is building it wrong. I am double-stumped as to direction to fix it. Any suggestions would be greatly greatly appreciated. tony

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • JSF 2.1 Spring 3.0 Integration

    - by danny.lesnik
    I'm trying to make very simple Spring 3 + JSF2.1 integration according to examples I googled in the web. So here is my code: My HTML submitted to actionController.actionSubmitted() method: <h:form> <h:message for="textPanel" style="color:red;" /> <h:panelGrid columns="3" rows="5" id="textPanel"> //all my bean prperties mapped to HTML code. </h:panelGrid> <h:commandButton value="Submit" action="#{actionController.actionSubmitted}" /> </h:form> now the Action Controller itself: @ManagedBean(name="actionController") @SessionScoped public class ActionController implements Serializable{ @ManagedProperty(value="#{user}") User user; @ManagedProperty(value="#{mailService}") MailService mailService; public void setMailService(MailService mailService) { this.mailService = mailService; } public void setUser(User user) { this.user = user; } private static final long serialVersionUID = 1L; public ActionController() {} public String actionSubmitted(){ System.out.println(user.getEmail()); mailService.sendUserMail(user); return "success"; } } Now my bean Spring: public interface MailService { void sendUserMail(User user); } public class MailServiceImpl implements MailService{ @Override public void sendUserMail(User user) { System.out.println("Mail to "+user.getEmail()+" sent." ); } } This is my web.xml <listener> <listener-class> org.springframework.web.context.ContextLoaderListener </listener-class> </listener> <listener> <listener-class> org.springframework.web.context.request.RequestContextListener </listener-class> </listener> <!-- Welcome page --> <welcome-file-list> <welcome-file>index.xhtml</welcome-file> </welcome-file-list> <!-- JSF mapping --> <servlet> <servlet-name>Faces Servlet</servlet-name> <servlet-class>javax.faces.webapp.FacesServlet</servlet-class> <load-on-startup>1</load-on-startup> </servlet> my applicationContext.xml <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-3.0.xsd"> <bean id="mailService" class="com.vanilla.jsf.services.MailServiceImpl"> </bean> </beans> my faces-config.xml is the following: <application> <el-resolver> org.springframework.web.jsf.el.SpringBeanFacesELResolver </el-resolver> <message-bundle> com.vanilla.jsf.validators.MyMessages </message-bundle> </application> <managed-bean> <managed-bean-name>actionController</managed-bean-name> <managed-bean-class>com.vanilla.jsf.controllers.ActionController</managed-bean-class> <managed-bean-scope>session</managed-bean-scope> <managed-property> <property-name>mailService</property-name> <value>#{mailService}</value> </managed-property> </managed-bean> <navigation-rule> <from-view-id>index.xhtml</from-view-id> <navigation-case> <from-action>#{actionController.actionSubmitted}</from-action> <from-outcome>success</from-outcome> <to-view-id>submitted.xhtml</to-view-id> <redirect /> </navigation-case> </navigation-rule> My Problem is that I'm getting NullPointerExeption because my mailService Spring bean is null. public String actionSubmitted(){ System.out.println(user.getEmail()); //mailService is null Getting NullPointerException mailService.sendUserMail(user); return "success"; }

    Read the article

  • How to implement an EventHandler to update controls

    - by Bill
    May I ask for help with the following? I am attempting to connect and control three pieces of household electronic equipment by computer through a GlobalCache GC-100 and iTach. As you will see in the following code, I created a class-instance of GlobalCacheAdapter that communicates with each piece of equipment. Although the code seems to work well in controlling the equipment, I am having trouble updating controls with the feedback from the equipment. The procedure "ReaderThreadProc" captures the feedback; however I don't know how to update the associated TextBox with the feedback. I believe that I need to create an EventHandler to notify the TextBox of the available update; however I am uncertain as to how an EventHandler like this would be implemented. Any help wold be greatly appreciated. using System; using System.IO; using System.Net; using System.Net.Sockets; using System.Threading; using System.Windows.Forms; namespace WindowsFormsApplication1 { public partial class Form1 : Form { // Create three new instances of GlobalCacheAdaptor and connect. // GC-100 (Elan) 192.168.1.70 4998 // GC-100 (TuneSuite) 192.168.1.70 5000 // GC iTach (Lighting) 192.168.1.71 4999 private GlobalCacheAdaptor elanGlobalCacheAdaptor; private GlobalCacheAdaptor tuneSuiteGlobalCacheAdaptor; private GlobalCacheAdaptor lutronGlobalCacheAdaptor; public Form1() { InitializeComponent(); elanGlobalCacheAdaptor = new GlobalCacheAdaptor(); elanGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.70"), 4998); tuneSuiteGlobalCacheAdaptor = new GlobalCacheAdaptor(); tuneSuiteGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.70"), 5000); lutronGlobalCacheAdaptor = new GlobalCacheAdaptor(); lutronGlobalCacheAdaptor.ConnectToDevice(IPAddress.Parse("192.168.1.71"), 4999); elanTextBox.Text = elanGlobalCacheAdaptor._line; tuneSuiteTextBox.Text = tuneSuiteGlobalCacheAdaptor._line; lutronTextBox.Text = lutronGlobalCacheAdaptor._line; } private void btnZoneOnOff_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,4,1,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,181,21,800" + Environment.NewLine); } private void btnSourceInput1_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,1,1,20,179,20,179,20,179,20,179,20,179,20,179,20,179,20,278,20,179,20,179,20,179,20,780" + Environment.NewLine); } private void btnSystemOff_Click(object sender, EventArgs e) { elanGlobalCacheAdaptor.SendMessage("sendir,4:3,1,40000,1,1,20,184,20,184,20,184,20,184,20,184,20,286,20,286,20,286,20,184,20,184,20,184,20,820" + Environment.NewLine); } private void btnLightOff_Click(object sender, EventArgs e) { lutronGlobalCacheAdaptor.SendMessage("sdl,14,0,0,S2\x0d"); } private void btnLightOn_Click(object sender, EventArgs e) { lutronGlobalCacheAdaptor.SendMessage("sdl,14,100,0,S2\x0d"); } private void btnChannel31_Click(object sender, EventArgs e) { tuneSuiteGlobalCacheAdaptor.SendMessage("\xB8\x4D\xB5\x33\x31\x00\x30\x21\xB8\x0D"); } private void btnChannel30_Click(object sender, EventArgs e) { tuneSuiteGlobalCacheAdaptor.SendMessage("\xB8\x4D\xB5\x33\x30\x00\x30\x21\xB8\x0D"); } } } public class GlobalCacheAdaptor { public Socket _multicastListener; public string _preferredDeviceID; public IPAddress _deviceAddress; public Socket _deviceSocket; public StreamWriter _deviceWriter; public bool _isConnected; public int _port; public IPAddress _address; public string _line; public GlobalCacheAdaptor() { } public static readonly GlobalCacheAdaptor Instance = new GlobalCacheAdaptor(); public bool IsListening { get { return _multicastListener != null; } } public GlobalCacheAdaptor ConnectToDevice(IPAddress address, int port) { if (_deviceSocket != null) _deviceSocket.Close(); try { _port = port; _address = address; _deviceSocket = new Socket(AddressFamily.InterNetwork, SocketType.Stream, ProtocolType.Tcp); _deviceSocket.Connect(new IPEndPoint(address, port)); ; _deviceAddress = address; var stream = new NetworkStream(_deviceSocket); var reader = new StreamReader(stream); var writer = new StreamWriter(stream) { NewLine = "\r", AutoFlush = true }; _deviceWriter = writer; writer.WriteLine("getdevices"); var readerThread = new Thread(ReaderThreadProc) { IsBackground = true }; readerThread.Start(reader); _isConnected = true; return Instance; } catch { DisconnectFromDevice(); MessageBox.Show("ConnectToDevice Error."); throw; } } public void SendMessage(string message) { try { var stream = new NetworkStream(_deviceSocket); var reader = new StreamReader(stream); var writer = new StreamWriter(stream) { NewLine = "\r", AutoFlush = true }; _deviceWriter = writer; writer.WriteLine(message); var readerThread = new Thread(ReaderThreadProc) { IsBackground = true }; readerThread.Start(reader); } catch { MessageBox.Show("SendMessage() Error."); } } public void DisconnectFromDevice() { if (_deviceSocket != null) { try { _deviceSocket.Close(); _isConnected = false; } catch { MessageBox.Show("DisconnectFromDevice Error."); } _deviceSocket = null; } _deviceWriter = null; _deviceAddress = null; } private void ReaderThreadProc(object state) { var reader = (StreamReader)state; try { while (true) { var line = reader.ReadLine(); if (line == null) break; _line = _line + line + Environment.NewLine; } // Need to create EventHandler to notify the TextBoxes to update with _line } catch { MessageBox.Show("ReaderThreadProc Error."); } } }

    Read the article

  • Pixel plot method errors out without error message.

    - by sonny5
    // The following method blows up (big red x on screen) without generating error info. Any // ideas why? // MyPlot.PlotPixel(x, y, Color.BlueViolet, Grf); // runs if commented out // My goal is to draw a pixel on a form. Is there a way to increase the pixel size also? using System; using System.Drawing; using System.Drawing.Drawing2D; using System.Collections; using System.ComponentModel; using System.Windows.Forms; using System.Data; public class Plot : System.Windows.Forms.Form { private Size _ClientArea; //keeps the pixels info private double _Xspan; private double _Yspan; public Plot() { InitializeComponent(); } public Size ClientArea { set { _ClientArea = value; } } private void InitializeComponent() { this.AutoScaleBaseSize = new System.Drawing.Size(5, 13); this.ClientSize = new System.Drawing.Size(400, 300); this.Text="World Plot (world_plot.cs)"; this.Resize += new System.EventHandler(this.Form1_Resize); this.Paint += new System.Windows.Forms.PaintEventHandler(this.doLine); this.Paint += new System.Windows.Forms.PaintEventHandler(this.TransformPoints); // new this.Paint += new System.Windows.Forms.PaintEventHandler(this.DrawRectangleFloat); this.Paint += new System.Windows.Forms.PaintEventHandler(this.DrawWindow_Paint); } private void DrawWindow_Paint(object sender, PaintEventArgs e) { Graphics Grf = e.Graphics; pixPlot(Grf); } static void Main() { Application.Run(new Plot()); } private void doLine(object sender, System.Windows.Forms.PaintEventArgs e) { // no transforms done yet!!! Graphics g = e.Graphics; g.FillRectangle(Brushes.White, this.ClientRectangle); Pen p = new Pen(Color.Black); g.DrawLine(p, 0, 0, 100, 100); // draw DOWN in y, which is positive since no matrix called p.Dispose(); } public void PlotPixel(double X, double Y, Color C, Graphics G) { Bitmap bm = new Bitmap(1, 1); bm.SetPixel(0, 0, C); G.DrawImageUnscaled(bm, TX(X), TY(Y)); } private int TX(double X) //transform real coordinates to pixels for the X-axis { double w; w = _ClientArea.Width / _Xspan * X + _ClientArea.Width / 2; return Convert.ToInt32(w); } private int TY(double Y) //transform real coordinates to pixels for the Y-axis { double w; w = _ClientArea.Height / _Yspan * Y + _ClientArea.Height / 2; return Convert.ToInt32(w); } private void pixPlot(Graphics Grf) { Plot MyPlot = new Plot(); double x = 12.0; double y = 10.0; MyPlot.ClientArea = this.ClientSize; Console.WriteLine("x = {0}", x); Console.WriteLine("y = {0}", y); //MyPlot.PlotPixel(x, y, Color.BlueViolet, Grf); // blows up } private void DrawRectangleFloat(object sender, PaintEventArgs e) { // Create pen. Pen penBlu = new Pen(Color.Blue, 2); // Create location and size of rectangle. float x = 0.0F; float y = 0.0F; float width = 200.0F; float height = 200.0F; // translate DOWN by 200 pixels // Draw rectangle to screen. e.Graphics.DrawRectangle(penBlu, x, y, width, height); } private void TransformPoints(object sender, System.Windows.Forms.PaintEventArgs e) { // after transforms Graphics g = this.CreateGraphics(); Pen penGrn = new Pen(Color.Green, 3); Matrix myMatrix2 = new Matrix(1, 0, 0, -1, 0, 0); // flip Y axis with -1 g.Transform = myMatrix2; g.TranslateTransform(0, 200, MatrixOrder.Append); // translate DOWN the same distance as the rectangle... // ...so this will put it at lower left corner g.DrawLine(penGrn, 0, 0, 100, 90); // notice that y 90 is going UP } private void Form1_Resize(object sender, System.EventArgs e) { Invalidate(); } }

    Read the article

  • login form whith java/sqlite

    - by tuxou
    hi I would like to create a login form for my application with the possibility to add or remove users for an sqlite database, i have created the table users(nam, pass) but i can't unclud it in my login form, it someone could help me this is my login code: import java.awt.*; import java.awt.event.*; import javax.swing.*; public class login extends JFrame { // Variables declaration private JLabel jLabel1; private JLabel jLabel2; private JTextField jTextField1; private JPasswordField jPasswordField1; private JButton jButton1; private JPanel contentPane; // End of variables declaration public login() { super(); create(); this.setVisible(true); } private void create() { jLabel1 = new JLabel(); jLabel2 = new JLabel(); jTextField1 = new JTextField(); jPasswordField1 = new JPasswordField(); jButton1 = new JButton(); contentPane = (JPanel)this.getContentPane(); // // jLabel1 // jLabel1.setHorizontalAlignment(SwingConstants.LEFT); jLabel1.setForeground(new Color(0, 0, 255)); jLabel1.setText("username:"); // // jLabel2 // jLabel2.setHorizontalAlignment(SwingConstants.LEFT); jLabel2.setForeground(new Color(0, 0, 255)); jLabel2.setText("password:"); // // jTextField1 // jTextField1.setForeground(new Color(0, 0, 255)); jTextField1.setSelectedTextColor(new Color(0, 0, 255)); jTextField1.setToolTipText("Enter your username"); jTextField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jTextField1_actionPerformed(e); } }); // // jPasswordField1 // jPasswordField1.setForeground(new Color(0, 0, 255)); jPasswordField1.setToolTipText("Enter your password"); jPasswordField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jPasswordField1_actionPerformed(e); } }); // // jButton1 // jButton1.setBackground(new Color(204, 204, 204)); jButton1.setForeground(new Color(0, 0, 255)); jButton1.setText("Login"); jButton1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jButton1_actionPerformed(e); } }); // // contentPane // contentPane.setLayout(null); contentPane.setBorder(BorderFactory.createEtchedBorder()); contentPane.setBackground(new Color(204, 204, 204)); addComponent(contentPane, jLabel1, 5,10,106,18); addComponent(contentPane, jLabel2, 5,47,97,18); addComponent(contentPane, jTextField1, 110,10,183,22); addComponent(contentPane, jPasswordField1, 110,45,183,22); addComponent(contentPane, jButton1, 150,75,83,28); // // login // this.setTitle("Login To Members Area"); this.setLocation(new Point(76, 182)); this.setSize(new Dimension(335, 141)); this.setDefaultCloseOperation(WindowConstants.EXIT_ON_CLOSE); this.setResizable(false); } /** Add Component Without a Layout Manager (Absolute Positioning) */ private void addComponent(Container container,Component c,int x,int y,int width,int height) { c.setBounds(x,y,width,height); container.add(c); } private void jTextField1_actionPerformed(ActionEvent e) { } private void jPasswordField1_actionPerformed(ActionEvent e) { } private void jButton1_actionPerformed(ActionEvent e) { System.out.println("\njButton1_actionPerformed(ActionEvent e) called."); String username = new String(jTextField1.getText()); String password = new String(jPasswordField1.getText()); if(username.equals("") || password.equals("")) // If password and username is empty Do this { jButton1.setEnabled(false); JLabel errorFields = new JLabel("You must enter a username and password to login."); JOptionPane.showMessageDialog(null,errorFields); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); this.setVisible(true); } else { JLabel optionLabel = new JLabel("You entered "+username+" as your username. Is this correct?"); int confirm =JOptionPane.showConfirmDialog(null,optionLabel); switch(confirm){ // Switch Case case JOptionPane.YES_OPTION: // Attempt to Login user jButton1.setEnabled(false); // Set button enable to false to prevent 2 login attempts break; case JOptionPane.NO_OPTION: // No Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; case JOptionPane.CANCEL_OPTION: // Cancel Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; } // End Switch Case } } public static void main(String[] args) { JFrame.setDefaultLookAndFeelDecorated(true); JDialog.setDefaultLookAndFeelDecorated(true); try { UIManager.setLookAndFeel("com.sun.java.swing.plaf.windows.WindowsLookAndFeel"); } catch (Exception ex) { System.out.println("Failed loading L&F: "); System.out.println(ex); } new login(); }; }

    Read the article

  • How do I prevent my form from freezing when it is loading an image from the web at the click of a button?

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • EXC_BAD_ACCESS at UITableView on IOS

    - by Suprie
    Hi all, When scrolling through table, my application crash and console said it was EXC_BAD_ACCESS. I've look everywhere, and people suggest me to use NSZombieEnabled on my executables environment variables. I've set NSZombieEnabled, NSDebugEnabled, MallocStackLogging and MallocStackLoggingNoCompact to YES on my executables. But apparently i still can't figure out which part of my program that cause EXC_BAD_ACCESS. This is what my console said [Session started at 2010-12-21 21:11:21 +0700.] GNU gdb 6.3.50-20050815 (Apple version gdb-1510) (Wed Sep 22 02:45:02 UTC 2010) Copyright 2004 Free Software Foundation, Inc. GDB is free software, covered by the GNU General Public License, and you are welcome to change it and/or distribute copies of it under certain conditions. Type "show copying" to see the conditions. There is absolutely no warranty for GDB. Type "show warranty" for details. This GDB was configured as "x86_64-apple-darwin".sharedlibrary apply-load-rules all Attaching to process 9335. TwitterSearch(9335) malloc: recording malloc stacks to disk using standard recorder TwitterSearch(9335) malloc: process 9300 no longer exists, stack logs deleted from /tmp/stack-logs.9300.TwitterSearch.suirlR.index TwitterSearch(9335) malloc: stack logs being written into /tmp/stack- logs.9335.TwitterSearch.tQJAXk.index 2010-12-21 21:11:25.446 TwitterSearch[9335:207] View Did Load Program received signal: “EXC_BAD_ACCESS”. And this is when i tried to type backtrace on gdb : Program received signal: “EXC_BAD_ACCESS”. (gdb) backtrace #0 0x00f20a67 in objc_msgSend () #1 0x0565cd80 in ?? () #2 0x0033b7fa in -[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:withIndexPath:] () #3 0x0033177f in -[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:] () #4 0x00346450 in -[UITableView(_UITableViewPrivate) _updateVisibleCellsNow:] () #5 0x0033e538 in -[UITableView layoutSubviews] () #6 0x01ffc451 in -[CALayer layoutSublayers] () #7 0x01ffc17c in CALayerLayoutIfNeeded () #8 0x01ff537c in CA::Context::commit_transaction () #9 0x01ff50d0 in CA::Transaction::commit () #10 0x020257d5 in CA::Transaction::observer_callback () #11 0x00d9ffbb in __CFRUNLOOP_IS_CALLING_OUT_TO_AN_OBSERVER_CALLBACK_FUNCTION__ () #12 0x00d350e7 in __CFRunLoopDoObservers () #13 0x00cfdbd7 in __CFRunLoopRun () #14 0x00cfd240 in CFRunLoopRunSpecific () #15 0x00cfd161 in CFRunLoopRunInMode () #16 0x01a73268 in GSEventRunModal () #17 0x01a7332d in GSEventRun () #18 0x002d642e in UIApplicationMain () #19 0x00001d4e in main (argc=1, argv=0xbfffee34) at /Users/suprie/Documents/Projects/Self/cocoa/TwitterSearch/main.m:14 I really appreciate for any clue to help me debug my application. EDIT this is the Header file of table #import <UIKit/UIKit.h> @interface TwitterTableViewController : UITableViewController { NSMutableArray *twitters; } @property(nonatomic,retain) NSMutableArray *twitters; @end and the implementation file #import "TwitterTableViewController.h" @implementation TwitterTableViewController @synthesize twitters; #pragma mark - #pragma mark Table view data source - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { // Return the number of sections. return 1; } - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { // Return the number of rows in the section. return [twitters count]; } - (CGFloat)tableView:(UITableView *)tableView heightForRowAtIndexPath:(NSIndexPath *)indexPath { return 90.0f; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { const NSInteger TAG_IMAGE_VIEW = 1001; const NSInteger TAG_TWEET_VIEW = 1002; const NSInteger TAG_FROM_VIEW = 1003; static NSString *CellIdentifier = @"Cell"; UIImageView *imageView; UILabel *tweet; UILabel *from; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier] autorelease]; // Image imageView = [[[[UIImageView alloc] initWithFrame:CGRectMake(5.0f, 5.0f, 60.0f, 60.0f)] autorelease] retain]; [cell.contentView addSubview:imageView]; imageView.tag = TAG_IMAGE_VIEW; // Tweet tweet = [[[UILabel alloc] initWithFrame:CGRectMake(105.0f, 5.0f, 200.0f, 50.0f)] autorelease]; [cell.contentView addSubview:tweet]; tweet.tag = TAG_TWEET_VIEW; tweet.numberOfLines = 2; tweet.font = [UIFont fontWithName:@"Helvetica" size:12]; tweet.textColor = [UIColor blackColor]; tweet.backgroundColor = [UIColor clearColor]; // From from = [[[UILabel alloc] initWithFrame:CGRectMake(105.0f, 55.0, 200.0f, 35.0f)] autorelease]; [cell.contentView addSubview:from]; from.tag = TAG_FROM_VIEW; from.numberOfLines = 1; from.font = [UIFont fontWithName:@"Helvetica" size:10]; from.textColor = [UIColor blackColor]; from.backgroundColor = [UIColor clearColor]; } // Configure the cell... NSMutableDictionary *twitter = [twitters objectAtIndex:(NSInteger) indexPath.row]; // cell.text = [twitter objectForKey:@"text"]; tweet.text = (NSString *) [twitter objectForKey:@"text"]; tweet.hidden = NO; from.text = (NSString *) [twitter objectForKey:@"from_user"]; from.hidden = NO; NSString *avatar_url = (NSString *)[twitter objectForKey:@"profile_image_url"]; NSData * imageData = [[NSData alloc] initWithContentsOfURL: [NSURL URLWithString: avatar_url]]; imageView.image = [UIImage imageWithData: imageData]; imageView.hidden = NO; return cell; } #pragma mark - #pragma mark Table view delegate - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { NSMutableDictionary *twitter = [twitters objectAtIndex:(NSInteger)indexPath.row]; NSLog(@"Twit ini kepilih :%@", [twitter objectForKey:@"text"]); } #pragma mark - #pragma mark Memory management - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; } - (void)viewDidUnload { } - (void)dealloc { [super dealloc]; } @end

    Read the article

  • How do implement a breadth first traversal?

    - by not looking for answer
    //This is what I have. I thought pre-order was the same and mixed it up with depth first! import java.util.LinkedList; import java.util.Queue; public class Exercise25_1 { public static void main(String[] args) { BinaryTree tree = new BinaryTree(new Integer[] {10, 5, 15, 12, 4, 8 }); System.out.print("\nInorder: "); tree.inorder(); System.out.print("\nPreorder: "); tree.preorder(); System.out.print("\nPostorder: "); tree.postorder(); //call the breadth method to test it System.out.print("\nBreadthFirst:"); tree.breadth(); } } class BinaryTree { private TreeNode root; /** Create a default binary tree */ public BinaryTree() { } /** Create a binary tree from an array of objects */ public BinaryTree(Object[] objects) { for (int i = 0; i < objects.length; i++) { insert(objects[i]); } } /** Search element o in this binary tree */ public boolean search(Object o) { return search(o, root); } public boolean search(Object o, TreeNode root) { if (root == null) { return false; } if (root.element.equals(o)) { return true; } else { return search(o, root.left) || search(o, root.right); } } /** Return the number of nodes in this binary tree */ public int size() { return size(root); } public int size(TreeNode root) { if (root == null) { return 0; } else { return 1 + size(root.left) + size(root.right); } } /** Return the depth of this binary tree. Depth is the * number of the nodes in the longest path of the tree */ public int depth() { return depth(root); } public int depth(TreeNode root) { if (root == null) { return 0; } else { return 1 + Math.max(depth(root.left), depth(root.right)); } } /** Insert element o into the binary tree * Return true if the element is inserted successfully */ public boolean insert(Object o) { if (root == null) { root = new TreeNode(o); // Create a new root } else { // Locate the parent node TreeNode parent = null; TreeNode current = root; while (current != null) { if (((Comparable)o).compareTo(current.element) < 0) { parent = current; current = current.left; } else if (((Comparable)o).compareTo(current.element) > 0) { parent = current; current = current.right; } else { return false; // Duplicate node not inserted } } // Create the new node and attach it to the parent node if (((Comparable)o).compareTo(parent.element) < 0) { parent.left = new TreeNode(o); } else { parent.right = new TreeNode(o); } } return true; // Element inserted } public void breadth() { breadth(root); } // Implement this method to produce a breadth first // search traversal public void breadth(TreeNode root){ if (root == null) return; System.out.print(root.element + " "); breadth(root.left); breadth(root.right); } /** Inorder traversal */ public void inorder() { inorder(root); } /** Inorder traversal from a subtree */ private void inorder(TreeNode root) { if (root == null) { return; } inorder(root.left); System.out.print(root.element + " "); inorder(root.right); } /** Postorder traversal */ public void postorder() { postorder(root); } /** Postorder traversal from a subtree */ private void postorder(TreeNode root) { if (root == null) { return; } postorder(root.left); postorder(root.right); System.out.print(root.element + " "); } /** Preorder traversal */ public void preorder() { preorder(root); } /** Preorder traversal from a subtree */ private void preorder(TreeNode root) { if (root == null) { return; } System.out.print(root.element + " "); preorder(root.left); preorder(root.right); } /** Inner class tree node */ private class TreeNode { Object element; TreeNode left; TreeNode right; public TreeNode(Object o) { element = o; } } }

    Read the article

  • App crashes when adding array data to table cells

    - by bassmandan
    I am trying to create a table view that loads a number of tweets into the table (one per cell etc). I am using NSXMLParser to get the information and have got as far as creating an array with the selection of tweets that I want. However, when I try to add them to the table cells, the app crashes on the line: cell.textLabel.text = cellValue; An NSLog before this shows in the console that the app is getting the correct data, so I am a bit stumped as to why this isn't working. This is the block of code that appears to be having the problem: - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier]; } // Set up the cell... NSString *cellValue = [statuses objectAtIndex:indexPath.row]; NSLog(@"%@", cellValue); cell.textLabel.text = cellValue; return cell;} If it makes a difference, I am using ARC and the latest version of XCode. I'm still quite new to all this, so if I need to give some extra information, let me know. Thanks in advance. Edit: Backtrace gives the following: * thread #1: tid = 0x2003, 0x918a19c6 libsystem_kernel.dylib`__pthread_kill + 10, stop reason = signal SIGABRT frame #0: 0x918a19c6 libsystem_kernel.dylib`__pthread_kill + 10 frame #1: 0x9968ff78 libsystem_c.dylib`pthread_kill + 106 frame #2: 0x99680bdd libsystem_c.dylib`abort + 167 frame #3: 0x03c93e78 libc++abi.dylib`_Unwind_DeleteException frame #4: 0x03c9189e libc++abi.dylib`_ZL17default_terminatev + 34 frame #5: 0x0154df4b libobjc.A.dylib`_objc_terminate + 94 frame #6: 0x03c918de libc++abi.dylib`_ZL19safe_handler_callerPFvvE + 13 frame #7: 0x03c91946 libc++abi.dylib`std::terminate() + 23 frame #8: 0x03c92ab2 libc++abi.dylib`__cxa_throw + 110 frame #9: 0x0154de15 libobjc.A.dylib`objc_exception_throw + 311 frame #10: 0x013bdced CoreFoundation`-[NSObject doesNotRecognizeSelector:] + 253 frame #11: 0x01322f00 CoreFoundation`___forwarding___ + 432 frame #12: 0x01322ce2 CoreFoundation`_CF_forwarding_prep_0 + 50 frame #13: 0x0015168f UIKit`-[UILabel setText:] + 56 frame #14: 0x00003088 Twitter`-[TwitterViewController tableView:cellForRowAtIndexPath:] + 376 at TwitterViewController.m:131 frame #15: 0x000ace0f UIKit`-[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:withIndexPath:] + 494 frame #16: 0x000ad589 UIKit`-[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:] + 69 frame #17: 0x00098dfd UIKit`-[UITableView(_UITableViewPrivate) _updateVisibleCellsNow:] + 1350 frame #18: 0x000a7851 UIKit`-[UITableView layoutSubviews] + 242 frame #19: 0x00052301 UIKit`-[UIView(CALayerDelegate) layoutSublayersOfLayer:] + 145 frame #20: 0x013bde72 CoreFoundation`-[NSObject performSelector:withObject:] + 66 frame #21: 0x01d6692d QuartzCore`-[CALayer layoutSublayers] + 266 frame #22: 0x01d70827 QuartzCore`CA::Layer::layout_if_needed(CA::Transaction*) + 231 frame #23: 0x01cf6fa7 QuartzCore`CA::Context::commit_transaction(CA::Transaction*) + 377 frame #24: 0x01cf8ea6 QuartzCore`CA::Transaction::commit() + 374 frame #25: 0x01d8430c QuartzCore`+[CATransaction flush] + 52 frame #26: 0x000124c6 UIKit`-[UIApplication _reportAppLaunchFinished] + 39 frame #27: 0x00012bd6 UIKit`-[UIApplication _runWithURL:payload:launchOrientation:statusBarStyle:statusBarHidden:] + 1324 frame #28: 0x00021743 UIKit`-[UIApplication handleEvent:withNewEvent:] + 1027 frame #29: 0x000221f8 UIKit`-[UIApplication sendEvent:] + 68 frame #30: 0x00015aa9 UIKit`_UIApplicationHandleEvent + 8196 frame #31: 0x012a6fa9 GraphicsServices`PurpleEventCallback + 1274 frame #32: 0x013901c5 CoreFoundation`__CFRUNLOOP_IS_CALLING_OUT_TO_A_SOURCE1_PERFORM_FUNCTION__ + 53 frame #33: 0x012f5022 CoreFoundation`__CFRunLoopDoSource1 + 146 frame #34: 0x012f390a CoreFoundation`__CFRunLoopRun + 2218 frame #35: 0x012f2db4 CoreFoundation`CFRunLoopRunSpecific + 212 frame #36: 0x012f2ccb CoreFoundation`CFRunLoopRunInMode + 123 frame #37: 0x000122a7 UIKit`-[UIApplication _run] + 576 frame #38: 0x00013a9b UIKit`UIApplicationMain + 1175 frame #39: 0x0000239d Twitter`main + 141 at main.m:16 frame #40: 0x00002305 Twitter`start + 53 Debugging console shows this: 2012-04-08 10:10:05.084 Twitter[25309:f803] ( { text = "Have you shared the Shakedown yet? http://t.co/WHrIC9w7"; }, { text = "For all you closet rocknrollas pencil in Sat 12th May The Rebirth of Rock n Roll Party. Haywire Saint @ The Good... http://t.co/OXHKlLIV"; }, { text = "4 weeks today: Vocal tracks will be getting recorded at The Premises Studios"; }, { text = "Rehearsal tonight in preparation to some big recording next month!"; }, { text = "haywire saint 'great taste.' Tune. \n\nhttp://t.co/GKmu5Lna http://t.co/0fii55Hw"; }, { text = "Meeting up with an old roadie for The Cure today. oh the stories...... http://t.co/UeUYccme"; }, { text = "Satisfying day of programming today.. Haywire Saint app coming along nicely with the custom music player ready to rock 'n' roll!"; }, { text = "Happy Friday Everyone!"; }, { text = "We had a great time at The Premises Studios yesterday. We'll be back there before long :D x"; }, { text = "I posted a new photo to Facebook http://t.co/73qAnCvk"; } ) 2012-04-08 10:10:05.093 Twitter[25309:f803] { text = "Have you shared the Shakedown yet? http://t.co/WHrIC9w7"; } 2012-04-08 10:10:05.094 Twitter[25309:f803] -[__NSCFDictionary isEqualToString:]: unrecognized selector sent to instance 0x6877a50 2012-04-08 10:10:05.096 Twitter[25309:f803] *** Terminating app due to uncaught exception 'NSInvalidArgumentException', reason: '-[__NSCFDictionary isEqualToString:]: unrecognized selector sent to instance 0x6877a50' *** First throw call stack: (0x13bc052 0x154dd0a 0x13bdced 0x1322f00 0x1322ce2 0x15168f 0x3088 0xace0f 0xad589 0x98dfd 0xa7851 0x52301 0x13bde72 0x1d6692d 0x1d70827 0x1cf6fa7 0x1cf8ea6 0x1d8430c 0x124c6 0x12bd6 0x21743 0x221f8 0x15aa9 0x12a6fa9 0x13901c5 0x12f5022 0x12f390a 0x12f2db4 0x12f2ccb 0x122a7 0x13a9b 0x239d 0x2305) terminate called throwing an exception2012-04-08 10:10:05.924 Twitter[25309:f803] -[__NSCFConstantString count]: unrecognized selector sent to instance 0x5b30

    Read the article

  • Android 2.1 NullPointerException with TabWidgets

    - by ninjasense
    I have an issue I have not been able to figure out and it is only happening on devices running <2.1. It works fine on android 2.2. I have ansynchronous task that displays a loading dialog while it loads all the tabs. Here is the code for the TabActivity: public class OppTabsView extends TabActivity { Dialog dialog; String errorText; boolean save; final int OPP_SAVE = 0; public static boolean edited; public void onCreate(Bundle icicle) { try { super.onCreate(icicle); new DoInBackground().execute(); } catch (Exception e) { Toast.makeText(this, "Error occured. Please try again later.", Toast.LENGTH_SHORT).show(); } } @Override protected void onResume() { super.onResume(); } @Override protected void onStop() { super.onStop(); } @Override protected void onPause() { super.onPause(); } public boolean onCreateOptionsMenu(Menu menu) { menu.add(0, OPP_SAVE, 0, "Test"); return true; } public boolean onOptionsItemSelected(MenuItem item) { switch (item.getItemId()) { case OPP_SAVE: save = true; new DoInBackground().execute(); return true; } return false; } public void LoadOpp() { handler.sendEmptyMessage(0); } public void SaveOpp() { DoStuff(); } public void LoadLayout() { setContentView(R.layout.view_opptabs); /* TabHost will have Tabs */ TabHost tabHost = (TabHost) findViewById(android.R.id.tabhost); /* * TabSpec used to create a new tab. By using TabSpec only we can able * to setContent to the tab. By using TabSpec setIndicator() we can set * name to tab. */ /* tid1 is firstTabSpec Id. Its used to access outside. */ TabSpec firstTabSpec = tabHost.newTabSpec("tid1"); TabSpec secondTabSpec = tabHost.newTabSpec("tid1"); TabSpec thirdTabSpec = tabHost.newTabSpec("tid1"); /* TabSpec setIndicator() is used to set name for the tab. */ /* TabSpec setContent() is used to set content for a particular tab. */ firstTabSpec.setIndicator("General", getResources().getDrawable(R.drawable.tab_moneybag)) .setContent(new Intent(this, OppTabGeneral.class)); secondTabSpec.setIndicator("Details", getResources().getDrawable(R.drawable.tab_papers)).setContent( new Intent(this, OppTabDetails.class)); thirdTabSpec.setIndicator("Contact", getResources().getDrawable(R.drawable.tab_contact)).setContent( new Intent(this, OppTabContact.class)); /* Add tabSpec to the TabHost to display. */ tabHost.addTab(firstTabSpec); tabHost.addTab(secondTabSpec); tabHost.addTab(thirdTabSpec); } private void do_update() { if (save) { SaveOpp(); } else { LoadOpp(); } } Handler handler = new Handler() { public void handleMessage(Message msg) { LoadLayout(); } }; private class DoInBackground extends AsyncTask<Void, Void, Void> implements DialogInterface.OnCancelListener { protected void onPreExecute() { String verb = "Connecting"; if (save) { verb = "Saving"; } dialog = ProgressDialog.show(OppTabsView.this, "", verb + ". Please Wait...", true, true, this); } protected Void doInBackground(Void... v) { do_update(); return null; } protected void onPostExecute(Void v) { dialog.dismiss(); } public void onCancel(DialogInterface dialog) { cancel(true); dialog.dismiss(); finish(); } } } Here is the stack trace from the error: java.lang.NullPointerException at android.widget.TabWidget.dispatchDraw(TabWidget.java:206) at android.view.ViewGroup.drawChild(ViewGroup.java:1529) at android.view.ViewGroup.dispatchDraw(ViewGroup.java:1258) at android.view.ViewGroup.drawChild(ViewGroup.java:1529) at android.view.ViewGroup.dispatchDraw(ViewGroup.java:1258) at android.view.ViewGroup.drawChild(ViewGroup.java:1529) at android.view.ViewGroup.dispatchDraw(ViewGroup.java:1258) at android.view.View.draw(View.java:6538) at android.widget.FrameLayout.draw(FrameLayout.java:352) at android.view.ViewGroup.drawChild(ViewGroup.java:1531) at android.view.ViewGroup.dispatchDraw(ViewGroup.java:1258) at android.view.ViewGroup.drawChild(ViewGroup.java:1529) at android.view.ViewGroup.dispatchDraw(ViewGroup.java:1258) at android.view.View.draw(View.java:6538) at android.widget.FrameLayout.draw(FrameLayout.java:352) at com.android.internal.policy.impl.PhoneWindow$DecorView.draw(PhoneWindow.java:1830) at android.view.ViewRoot.draw(ViewRoot.java:1349) at android.view.ViewRoot.performTraversals(ViewRoot.java:1114) at android.view.ViewRoot.handleMessage(ViewRoot.java:1633) at android.os.Handler.dispatchMessage(Handler.java:99) at android.os.Looper.loop(Looper.java:123) at android.app.ActivityThread.main(ActivityThread.java:4363) at java.lang.reflect.Method.invokeNative(Native Method) at java.lang.reflect.Method.invoke(Method.java:521) at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) at dalvik.system.NativeStart.main(Native Method) I have tried stepping through it but the error seems to come out of no where, not at a specific line. Any help is greatly appreciated.

    Read the article

  • Custom Memory Allocator for STL map

    - by Prasoon Tiwari
    This question is about construction of instances of custom allocator during insertion into a std::map. Here is a custom allocator for std::map<int,int> along with a small program that uses it: #include <stddef.h> #include <stdio.h> #include <map> #include <typeinfo> class MyPool { public: void * GetNext() { return malloc(24); } void Free(void *ptr) { free(ptr); } }; template<typename T> class MyPoolAlloc { public: static MyPool *pMyPool; typedef size_t size_type; typedef ptrdiff_t difference_type; typedef T* pointer; typedef const T* const_pointer; typedef T& reference; typedef const T& const_reference; typedef T value_type; template<typename X> struct rebind { typedef MyPoolAlloc<X> other; }; MyPoolAlloc() throw() { printf("-------Alloc--CONSTRUCTOR--------%08x %32s\n", this, typeid(T).name()); } MyPoolAlloc(const MyPoolAlloc&) throw() { printf(" Copy Constructor ---------------%08x %32s\n", this, typeid(T).name()); } template<typename X> MyPoolAlloc(const MyPoolAlloc<X>&) throw() { printf(" Construct T Alloc from X Alloc--%08x %32s %32s\n", this, typeid(T).name(), typeid(X).name()); } ~MyPoolAlloc() throw() { printf(" Destructor ---------------------%08x %32s\n", this, typeid(T).name()); }; pointer address(reference __x) const { return &__x; } const_pointer address(const_reference __x) const { return &__x; } pointer allocate(size_type __n, const void * hint = 0) { if (__n != 1) perror("MyPoolAlloc::allocate: __n is not 1.\n"); if (NULL == pMyPool) { pMyPool = new MyPool(); printf("======>Creating a new pool object.\n"); } return reinterpret_cast<T*>(pMyPool->GetNext()); } //__p is not permitted to be a null pointer void deallocate(pointer __p, size_type __n) { pMyPool->Free(reinterpret_cast<void *>(__p)); } size_type max_size() const throw() { return size_t(-1) / sizeof(T); } void construct(pointer __p, const T& __val) { printf("+++++++ %08x %s.\n", __p, typeid(T).name()); ::new(__p) T(__val); } void destroy(pointer __p) { printf("-+-+-+- %08x.\n", __p); __p->~T(); } }; template<typename T> inline bool operator==(const MyPoolAlloc<T>&, const MyPoolAlloc<T>&) { return true; } template<typename T> inline bool operator!=(const MyPoolAlloc<T>&, const MyPoolAlloc<T>&) { return false; } template<typename T> MyPool* MyPoolAlloc<T>::pMyPool = NULL; int main(int argc, char *argv[]) { std::map<int, int, std::less<int>, MyPoolAlloc<std::pair<const int,int> > > m; //random insertions in the map m.insert(std::pair<int,int>(1,2)); m[5] = 7; m[8] = 11; printf("======>End of map insertions.\n"); return 0; } Here is the output of this program: -------Alloc--CONSTRUCTOR--------bffcdaa6 St4pairIKiiE Construct T Alloc from X Alloc--bffcda77 St13_Rb_tree_nodeISt4pairIKiiEE St4pairIKiiE Copy Constructor ---------------bffcdad8 St13_Rb_tree_nodeISt4pairIKiiEE Destructor ---------------------bffcda77 St13_Rb_tree_nodeISt4pairIKiiEE Destructor ---------------------bffcdaa6 St4pairIKiiE ======Creating a new pool object. Construct T Alloc from X Alloc--bffcd9df St4pairIKiiE St13_Rb_tree_nodeISt4pairIKiiEE +++++++ 0985d028 St4pairIKiiE. Destructor ---------------------bffcd9df St4pairIKiiE Construct T Alloc from X Alloc--bffcd95f St4pairIKiiE St13_Rb_tree_nodeISt4pairIKiiEE +++++++ 0985d048 St4pairIKiiE. Destructor ---------------------bffcd95f St4pairIKiiE Construct T Alloc from X Alloc--bffcd95f St4pairIKiiE St13_Rb_tree_nodeISt4pairIKiiEE +++++++ 0985d068 St4pairIKiiE. Destructor ---------------------bffcd95f St4pairIKiiE ======End of map insertions. Construct T Alloc from X Alloc--bffcda23 St4pairIKiiE St13_Rb_tree_nodeISt4pairIKiiEE -+-+-+- 0985d068. Destructor ---------------------bffcda23 St4pairIKiiE Construct T Alloc from X Alloc--bffcda43 St4pairIKiiE St13_Rb_tree_nodeISt4pairIKiiEE -+-+-+- 0985d048. Destructor ---------------------bffcda43 St4pairIKiiE Construct T Alloc from X Alloc--bffcda43 St4pairIKiiE St13_Rb_tree_nodeISt4pairIKiiEE -+-+-+- 0985d028. Destructor ---------------------bffcda43 St4pairIKiiE Destructor ---------------------bffcdad8 St13_Rb_tree_nodeISt4pairIKiiEE Last two columns of the output show that an allocator for std::pair<const int, int> is constructed everytime there is a insertion into the map. Why is this necessary? Is there a way to suppress this? Thanks! Edit: This code tested on x86 machine with g++ version 4.1.2. If you wish to run it on a 64-bit machine, you'll have to change at least the line return malloc(24). Changing to return malloc(48) should work.

    Read the article

  • Undefined reference to ...

    - by Patrick LaChance
    I keep getting this error message every time I try to compile, and I cannot find out what the problem is. any help would be greatly appreciated: C:\DOCUME~1\Patrick\LOCALS~1\Temp/ccL92mj9.o:main.cpp:(.txt+0x184): undefined reference to 'List::List()' C:\DOCUME~1\Patrick\LOCALS~1\Temp/ccL92mj9.o:main.cpp:(.txt+0x184): undefined reference to 'List::add(int)' collect2: ld returned 1 exit status code: //List.h #ifndef LIST_H #define LIST_H #include <exception> //brief Definition of linked list class class List { public: /** \brief Exception for operating on empty list */ class Empty : public std::exception { public: virtual const char* what() const throw(); }; /** \brief Exception for invalid operations other than operating on an empty list */ class InvalidOperation : public std::exception { public: virtual const char* what() const throw(); }; /** \brief Node within List */ class Node { public: /** data element stored in this node */ int element; /** next node in list */ Node* next; /** previous node in list */ Node* previous; Node (int element); ~Node(); void print() const; void printDebug() const; }; List(); ~List(); void add(int element); void remove(int element); int first()const; int last()const; int removeFirst(); int removeLast(); bool isEmpty()const; int size()const; void printForward() const; void printReverse() const; void printDebug() const; /** enables extra output for debugging purposes */ static bool traceOn; private: /** head of list */ Node* head; /** tail of list */ Node* tail; /** count of number of nodes */ int count; }; #endif //List.cpp I only included the parts of List.cpp that might be the issue #include "List.h" #include <iostream> #include <iomanip> using namespace std; List::List() { //List::size = NULL; head = NULL; tail = NULL; } List::~List() { Node* current; while(head != NULL) { current = head-> next; delete current->previous; if (current->next!=NULL) { head = current; } else { delete current; } } } void List::add(int element) { Node* newNode; Node* current; newNode->element = element; if(newNode->element > head->element) { current = head->next; } else { head->previous = newNode; newNode->next = head; newNode->previous = NULL; return; } while(newNode->element > current->element) { current = current->next; } if(newNode->element <= current->element) { newNode->previous = current->previous; newNode->next = current; } } //main.cpp #include "List.h" #include <iostream> #include <string> using namespace std; //void add(int element); int main (char** argv, int argc) { List* MyList = new List(); bool quit = false; string value; int element; while(quit==false) { cin>>value; if(value == "add") { cin>>element; MyList->add(element); } if(value=="quit") { quit = true; } } return 0; } I'm doing everything I think I'm suppose to be doing. main.cpp isn't complete yet, just trying to get the add function to work first. Any help will be greatly appreciated.

    Read the article

  • (C++) Linking with namespaces causes duplicate symbol error

    - by user577072
    Hello. For the past few days, I have been trying to figure out how to link the files for a CLI gaming project I have been working on. There are two halves of the project, the Client and the Server code. The client needs two libraries I've made. The first is a general purpose game board. This is split between GameEngine.h and GameEngine.cpp. The header file looks something like this namespace gfdGaming { // struct sqr_size { // Index x; // Index y; // }; typedef struct { Index x, y; } sqr_size; const sqr_size sPos = {1, 1}; sqr_size sqr(Index x, Index y); sqr_size ePos; class board { // Prototypes / declarations for the class } } And the CPP file is just giving everything content #include "GameEngine.h" type gfdGaming::board::functions The client also has game-specific code (in this case, TicTacToe) split into declarations and definitions (TTT.h, Client.cpp). TTT.h is basically #include "GameEngine.h" #define TTTtar "localhost" #define TTTport 2886 using namespace gfdGaming; void* turnHandler(void*); namespace nsTicTacToe { GFDCON gfd; const char X = 'X'; const char O = 'O'; string MPhostname, mySID; board TTTboard; bool PlayerIsX = true, isMyTurn; char Player = X, Player2 = O; int recon(string* datHolder = NULL, bool force = false); void initMP(bool create = false, string hn = TTTtar); void init(); bool isTie(); int turnPlayer(Index loc, char lSym = Player); bool checkWin(char sym = Player); int mainloop(); int mainloopMP(); }; // NS I made the decision to put this in a namespace to group it instead of a class because there are some parts that would not work well in OOP, and it's much easier to implement later on. I have had trouble linking the client in the past, but this setup seems to work. My server is also split into two files, Server.h and Server.cpp. Server.h contains exactly: #include "../TicTacToe/TTT.h" // Server needs a full copy of TicTacToe code class TTTserv; struct TTTachievement_requirement { Index id; Index loc; bool inUse; }; struct TTTachievement_t { Index id; bool achieved; bool AND, inSameGame; bool inUse; bool (*lHandler)(TTTserv*); char mustBeSym; int mustBePlayer; string name, description; TTTachievement_requirement steps[safearray(8*8)]; }; class achievement_core_t : public GfdOogleTech { public: // May be shifted to private TTTachievement_t list[safearray(8*8)]; public: achievement_core_t(); int insert(string name, string d, bool samegame, bool lAnd, int lSteps[8*8], int mbP=0, char mbS=0); }; struct TTTplayer_t { Index id; bool inUse; string ip, sessionID; char sym; int desc; TTTachievement_t Ding[8*8]; }; struct TTTgame_t { TTTplayer_t Player[safearray(2)]; TTTplayer_t Spectator; achievement_core_t achievement_core; Index cTurn, players; port_t roomLoc; bool inGame, Xused, Oused, newEvent; }; class TTTserv : public gSserver { TTTgame_t Game; TTTplayer_t *cPlayer; port_t conPort; public: achievement_core_t *achiev; thread threads[8]; int parseit(string tDat, string tsIP); Index conCount; int parseit(string tDat, int tlUser, TTTplayer_t** retval); private: int parseProto(string dat, string sIP); int parseProto(string dat, int lUser); int cycleTurn(); void setup(port_t lPort = 0, bool complete = false); public: int newEvent; TTTserv(port_t tlPort = TTTport, bool tcomplete = true); TTTplayer_t* userDC(Index id, Index force = false); int sendToPlayers(string dat, bool asMSG = false); int mainLoop(volatile bool *play); }; // Other void* userHandler(void*); void* handleUser(void*); And in the CPP file I include Server.h and provide main() and the contents of all functions previously declared. Now to the problem at hand I am having issues when linking my server. More specifically, I get a duplicate symbol error for every variable in nsTicTacToe (and possibly in gfdGaming as well). Since I need the TicTacToe functions, I link Client.cpp ( without main() ) when building the server ld: duplicate symbol nsTicTacToe::PlayerIsX in Client.o and Server.o collect2: ld returned 1 exit status Command /Developer/usr/bin/g++-4.2 failed with exit code 1 It stops once a problem is encountered, but if PlayerIsX is removed / changed temporarily than another variable causes an error Essentially, I am looking for any advice on how to better organize my code to hopefully fix these errors. Disclaimers: -I apologize in advance if I provided too much or too little information, as it is my first time posting -I have tried using static and extern to fix these problems, but apparently those are not what I need Thank you to anyone who takes the time to read all of this and respond =)

    Read the article

  • CDI @Conversation not propagated with handleNavigation()

    - by Thomas Kernstock
    I have a problem with the propagation of a long runnig conversation when I redirect the view by the handleNavigation() method. Here is my test code: I have a conversationscoped bean and two views: conversationStart.xhtml is called in Browser with URL http://localhost/tests/conversationStart.jsf?paramTestId=ParameterInUrl <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core"> <f:metadata> <f:viewParam name="paramTestId" value="#{conversationTest.fieldTestId}" /> <f:event type="preRenderView" listener="#{conversationTest.preRenderView}" /> </f:metadata> <h:head> <title>Conversation Test</title> </h:head> <h:body> <h:form> <h2>Startpage Test Conversation with Redirect</h2> <h:messages /> <h:outputText value="Testparameter: #{conversationTest.fieldTestId}"/><br /> <h:outputText value="Logged In: #{conversationTest.loggedIn}"/><br /> <h:outputText value="Conversation ID: #{conversationTest.convID}"/><br /> <h:outputText value="Conversation Transient: #{conversationTest.convTransient}"/><br /> <h:commandButton action="#{conversationTest.startLogin}" value="Login ->" rendered="#{conversationTest.loggedIn==false}" /><br /> <h:commandLink action="/tests/conversationLogin.xhtml?faces-redirect=true" value="Login ->" rendered="#{conversationTest.loggedIn==false}" /><br /> </h:form> <h:link outcome="/tests/conversationLogin.xhtml" value="Login Link" rendered="#{conversationTest.loggedIn==false}"> <f:param name="cid" value="#{conversationTest.convID}"></f:param> </h:link> </h:body> </html> The Parameter is written to the beanfield and displayed in the view correctly. There are 3 different possibilites to navigate to the next View. All 3 work fine. The beanfield shows up the next view (conversationLogin.xhtml) too: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core"> <h:head> <title>Conversation Test</title> </h:head> <h:body> <h:form> <h2>Loginpage Test Conversation with Redirect</h2> <h:messages /> <h:outputText value="Testparameter: #{conversationTest.fieldTestId}"/><br /> <h:outputText value="Logged In: #{conversationTest.loggedIn}"/><br /> <h:outputText value="Conversation ID: #{conversationTest.convID}"/><br /> <h:outputText value="Conversation Transient: #{conversationTest.convTransient}"/><br /> <h:commandButton action="#{conversationTest.login}" value="Login And Return" /><br /> </h:form> </h:body> </html> When I return to the Startpage by clicking the button the conversation bean still contains all values. So everything is fine. Here is the bean: package test; import java.io.Serializable; import javax.annotation.PostConstruct; import javax.enterprise.context.Conversation; import javax.enterprise.context.ConversationScoped; import javax.faces.event.ComponentSystemEvent; import javax.inject.Inject; import javax.inject.Named; @Named @ConversationScoped public class ConversationTest implements Serializable{ private static final long serialVersionUID = 1L; final String CONVERSATION_NAME="longRun"; @Inject Conversation conversation; private boolean loggedIn; private String fieldTestId; @PostConstruct public void init(){ if(conversation.isTransient()){ conversation.begin(CONVERSATION_NAME); System.out.println("New Conversation started"); } loggedIn=false; } public String getConvID(){ return conversation.getId(); } public boolean isConvTransient(){ return conversation.isTransient(); } public boolean getLoggedIn(){ return loggedIn; } public String startLogin(){ return "/tests/conversationLogin.xhtml?faces-redirect=true"; } public String login(){ loggedIn=true; return "/tests/conversationStart.xhtml?faces-redirect=true"; } public void preRenderView(ComponentSystemEvent ev) { // if(!loggedIn){ // System.out.println("Will redirect to Login"); // FacesContext ctx = FacesContext.getCurrentInstance(); // ctx.getApplication().getNavigationHandler().handleNavigation(ctx, null, "/tests/conversationLogin.xhtml?faces-redirect=true"); // ctx.renderResponse(); // } } public void setFieldTestId(String fieldTestId) { System.out.println("fieldTestID was set to: "+fieldTestId); this.fieldTestId = fieldTestId; } public String getFieldTestId() { return fieldTestId; } } Now comes the problem !! As soon as I try to redirect the page in the preRenderView method of the bean (just uncomment the code in the method), using handleNavigation() the bean is created again in the next view instead of using the allready created instance. Although the cid parameter is propagated to the next view ! Has anybody an idea what's wrong ? best regards Thomas

    Read the article

  • Simple XNA 2D demo: why is my F# version slower than C# version?

    - by Den
    When running this XNA application it should display a rotated rectangle that moves from top-left corner to bottom-right corner. It looks like my F# version is noticeably much slower. It seems that the Draw method skips a lot of frames. I am using VS 2012 RC, XNA 4.0, .NET 4.5, F# 3.0. I am trying to make it as functional as possible. What could be the reason for poor performance? C#: class Program { static void Main(string[] args) { using (var game = new FlockGame()) { game.Run(); } } } public class FlockGame : Game { private GraphicsDeviceManager graphics; private DrawingManager drawingManager; private Vector2 position = Vector2.Zero; public FlockGame() { graphics = new GraphicsDeviceManager(this); } protected override void Initialize() { drawingManager = new DrawingManager(graphics.GraphicsDevice); this.IsFixedTimeStep = false; } protected override void Update(GameTime gameTime) { position = new Vector2(position.X + 50.1f * (float)gameTime.ElapsedGameTime.TotalSeconds, position.Y + 50.1f * (float)gameTime.ElapsedGameTime.TotalSeconds); base.Update(gameTime); } protected override void Draw(GameTime gameTime) { //this.GraphicsDevice.Clear(Color.Lavender) drawingManager.DrawRectangle(position, new Vector2(100.0f, 100.0f), 0.7845f, Color.Red); base.Draw(gameTime); } } public class DrawingManager { private GraphicsDevice GraphicsDevice; private Effect Effect; public DrawingManager(GraphicsDevice graphicsDevice) { GraphicsDevice = graphicsDevice; this.Effect = new BasicEffect(this.GraphicsDevice) { VertexColorEnabled = true, Projection = Matrix.CreateOrthographicOffCenter(0.0f, this.GraphicsDevice.Viewport.Width, this.GraphicsDevice.Viewport.Height, 0.0f, 0.0f, 1.0f) }; } private VertexPositionColor[] GetRectangleVertices (Vector2 center, Vector2 size, float radians, Color color) { var halfSize = size/2.0f; var topLeft = -halfSize; var bottomRight = halfSize; var topRight = new Vector2(bottomRight.X, topLeft.Y); var bottomLeft = new Vector2(topLeft.X, bottomRight.Y); topLeft = Vector2.Transform(topLeft, Matrix.CreateRotationZ(radians)) + center; topRight = Vector2.Transform(topRight, Matrix.CreateRotationZ(radians)) + center; bottomRight = Vector2.Transform(bottomRight, Matrix.CreateRotationZ(radians)) + center; bottomLeft = Vector2.Transform(bottomLeft, Matrix.CreateRotationZ(radians)) + center; return new VertexPositionColor[] { new VertexPositionColor(new Vector3(topLeft, 0.0f), color), new VertexPositionColor(new Vector3(topRight, 0.0f), color), new VertexPositionColor(new Vector3(topRight, 0.0f), color), new VertexPositionColor(new Vector3(bottomRight, 0.0f), color), new VertexPositionColor(new Vector3(bottomRight, 0.0f), color), new VertexPositionColor(new Vector3(bottomLeft, 0.0f), color), new VertexPositionColor(new Vector3(bottomLeft, 0.0f), color), new VertexPositionColor(new Vector3(topLeft, 0.0f), color) }; } public void DrawRectangle(Vector2 center, Vector2 size, float radians, Color color) { var vertices = GetRectangleVertices(center, size, radians, color); foreach (var pass in this.Effect.CurrentTechnique.Passes) { pass.Apply(); this.GraphicsDevice.DrawUserPrimitives(PrimitiveType.LineList, vertices, 0, vertices.Length/2); } } } F#: namespace Flocking module FlockingProgram = open System open Flocking [<STAThread>] [<EntryPoint>] let Main _ = use g = new FlockGame() g.Run() 0 //------------------------------------------------------------------------------ namespace Flocking open System open System.Diagnostics open Microsoft.Xna.Framework open Microsoft.Xna.Framework.Graphics open Microsoft.Xna.Framework.Input type public FlockGame() as this = inherit Game() let mutable graphics = new GraphicsDeviceManager(this) let mutable drawingManager = null let mutable position = Vector2.Zero override Game.LoadContent() = drawingManager <- new Rendering.DrawingManager(graphics.GraphicsDevice) this.IsFixedTimeStep <- false override Game.Update gameTime = position <- Vector2(position.X + 50.1f * float32 gameTime.ElapsedGameTime.TotalSeconds, position.Y + 50.1f * float32 gameTime.ElapsedGameTime.TotalSeconds) base.Update gameTime override Game.Draw gameTime = //this.GraphicsDevice.Clear(Color.Lavender) Rendering.DrawRectangle(drawingManager, position, Vector2(100.0f, 100.0f), 0.7845f, Color.Red) base.Draw gameTime //------------------------------------------------------------------------------ namespace Flocking open System open System.Collections.Generic open Microsoft.Xna.Framework open Microsoft.Xna.Framework.Graphics open Microsoft.Xna.Framework.Input module Rendering = [<AllowNullLiteral>] type DrawingManager (graphicsDevice : GraphicsDevice) = member this.GraphicsDevice = graphicsDevice member this.Effect = new BasicEffect(this.GraphicsDevice, VertexColorEnabled = true, Projection = Matrix.CreateOrthographicOffCenter(0.0f, float32 this.GraphicsDevice.Viewport.Width, float32 this.GraphicsDevice.Viewport.Height, 0.0f, 0.0f, 1.0f)) let private GetRectangleVertices (center:Vector2, size:Vector2, radians:float32, color:Color) = let halfSize = size / 2.0f let mutable topLeft = -halfSize let mutable bottomRight = halfSize let mutable topRight = new Vector2(bottomRight.X, topLeft.Y) let mutable bottomLeft = new Vector2(topLeft.X, bottomRight.Y) topLeft <- Vector2.Transform(topLeft, Matrix.CreateRotationZ(radians)) + center topRight <- Vector2.Transform(topRight, Matrix.CreateRotationZ(radians)) + center bottomRight <- Vector2.Transform(bottomRight, Matrix.CreateRotationZ(radians)) + center bottomLeft <- Vector2.Transform(bottomLeft, Matrix.CreateRotationZ(radians)) + center [| new VertexPositionColor(new Vector3(topLeft, 0.0f), color) new VertexPositionColor(new Vector3(topRight, 0.0f), color) new VertexPositionColor(new Vector3(topRight, 0.0f), color) new VertexPositionColor(new Vector3(bottomRight, 0.0f), color) new VertexPositionColor(new Vector3(bottomRight, 0.0f), color) new VertexPositionColor(new Vector3(bottomLeft, 0.0f), color) new VertexPositionColor(new Vector3(bottomLeft, 0.0f), color) new VertexPositionColor(new Vector3(topLeft, 0.0f), color) |] let DrawRectangle (drawingManager:DrawingManager, center:Vector2, size:Vector2, radians:float32, color:Color) = let vertices = GetRectangleVertices(center, size, radians, color) for pass in drawingManager.Effect.CurrentTechnique.Passes do pass.Apply() drawingManager.GraphicsDevice.DrawUserPrimitives(PrimitiveType.LineList, vertices, 0, vertices.Length/2)

    Read the article

  • Https in java ends up with strange results

    - by Senne
    I'm trying to illustrate to students how https is used in java. But i have the feeling my example is not really the best out there... The code works well on my windows 7: I start the server, go to https://localhost:8080/somefile.txt and i get asked to trust the certificate, and all goes well. When I try over http (before or after accepting the certificate) I just get a blank page, which is ok for me. BUT when I try the exact same thing on my windows XP: Same thing, all goes well. But then (after accepting the certificate first), I'm also able to get all the the files through http! (if I first try http before https followed by accepting the certificate, I get no answer..) I tried refreshing, hard refreshing a million times but this should not be working, right? Is there something wrong in my code? I'm not sure if I use the right approach to implement https here... package Security; import java.io.*; import java.net.*; import java.util.*; import java.util.concurrent.Executors; import java.security.*; import javax.net.ssl.*; import com.sun.net.httpserver.*; public class HTTPSServer { public static void main(String[] args) throws IOException { InetSocketAddress addr = new InetSocketAddress(8080); HttpsServer server = HttpsServer.create(addr, 0); try { System.out.println("\nInitializing context ...\n"); KeyStore ks = KeyStore.getInstance("JKS"); char[] password = "vwpolo".toCharArray(); ks.load(new FileInputStream("myKeys"), password); KeyManagerFactory kmf = KeyManagerFactory.getInstance("SunX509"); kmf.init(ks, password); SSLContext sslContext = SSLContext.getInstance("TLS"); sslContext.init(kmf.getKeyManagers(), null, null); // a HTTPS server must have a configurator for the SSL connections. server.setHttpsConfigurator (new HttpsConfigurator(sslContext) { // override configure to change default configuration. public void configure (HttpsParameters params) { try { // get SSL context for this configurator SSLContext c = getSSLContext(); // get the default settings for this SSL context SSLParameters sslparams = c.getDefaultSSLParameters(); // set parameters for the HTTPS connection. params.setNeedClientAuth(true); params.setSSLParameters(sslparams); System.out.println("SSL context created ...\n"); } catch(Exception e2) { System.out.println("Invalid parameter ...\n"); e2.printStackTrace(); } } }); } catch(Exception e1) { e1.printStackTrace(); } server.createContext("/", new MyHandler1()); server.setExecutor(Executors.newCachedThreadPool()); server.start(); System.out.println("Server is listening on port 8080 ...\n"); } } class MyHandler implements HttpHandler { public void handle(HttpExchange exchange) throws IOException { String requestMethod = exchange.getRequestMethod(); if (requestMethod.equalsIgnoreCase("GET")) { Headers responseHeaders = exchange.getResponseHeaders(); responseHeaders.set("Content-Type", "text/plain"); exchange.sendResponseHeaders(200, 0); OutputStream responseBody = exchange.getResponseBody(); String response = "HTTP headers included in your request:\n\n"; responseBody.write(response.getBytes()); Headers requestHeaders = exchange.getRequestHeaders(); Set<String> keySet = requestHeaders.keySet(); Iterator<String> iter = keySet.iterator(); while (iter.hasNext()) { String key = iter.next(); List values = requestHeaders.get(key); response = key + " = " + values.toString() + "\n"; responseBody.write(response.getBytes()); System.out.print(response); } response = "\nHTTP request body: "; responseBody.write(response.getBytes()); InputStream requestBody = exchange.getRequestBody(); byte[] buffer = new byte[256]; if(requestBody.read(buffer) > 0) { responseBody.write(buffer); } else { responseBody.write("empty.".getBytes()); } URI requestURI = exchange.getRequestURI(); String file = requestURI.getPath().substring(1); response = "\n\nFile requested = " + file + "\n\n"; responseBody.write(response.getBytes()); responseBody.flush(); System.out.print(response); Scanner source = new Scanner(new File(file)); String text; while (source.hasNext()) { text = source.nextLine() + "\n"; responseBody.write(text.getBytes()); } source.close(); responseBody.close(); exchange.close(); } } }

    Read the article

  • How I can get output from 1st frame textfield input text to 2nd frame textArea

    - by soulgreen
    Here is my 1st frame - I want went I input text in textfield example name then click button report will display output to 2nd frame using textArea... please help me import java.awt.; import java.awt.event.; import javax.swing.; import javax.swing.border.; public class Order extends JFrame implements ActionListener { private JPanel pInfo,pN, pIC, pDate,Blank,pBlank, button, pTotal; private JLabel nameL,icL,DateL; private JTextField nameTF, icTF; private JFormattedTextField DateTF; private JButton calB,clearB,exitB,reportB; public Order() { Container contentPane = getContentPane(); contentPane.setLayout(new BorderLayout()); contentPane.setBackground(Color.gray); pInfo = new JPanel(); pN = new JPanel(); pIC = new JPanel(); pDate = new JPanel(); nameTF = new JTextField(30); icTF = new JTextField(30); DateTF = new JFormattedTextField(java.util.Calendar.getInstance().getTime()); DateTF.setEditable (false); DateTF.addActionListener(this); nameL = new JLabel(" NAME : ",SwingConstants.RIGHT); icL = new JLabel(" IC : ",SwingConstants.RIGHT); DateL = new JLabel(" DATE :",SwingConstants.RIGHT); pInfo.setLayout(new GridLayout(10,2,5,5)); pInfo.setBorder(BorderFactory.createTitledBorder (BorderFactory.createEtchedBorder(),"ORDER")); pN.add(nameL); pN.add(nameTF); pIC.add(icL); pIC.add(icTF); pDate.add(DateL); pDate.add(DateTF); pInfo.add(pN); pInfo.add(pIC); pInfo.add(pDate); pInfo.setBackground(Color.GRAY); pN.setBackground(Color.gray); pIC.setBackground(Color.gray); pDate.setBackground(Color.gray); nameL.setForeground(Color.black); icL.setForeground(Color.black); DateL.setForeground(Color.black); nameTF.setBackground(Color.pink); icTF.setBackground(Color.pink); DateTF.setBackground(Color.pink); contentPane.add(pInfo,BorderLayout.CENTER); Blank = new JPanel(); pBlank = new JPanel(); button = new JPanel(); calB = new JButton("CALCULATE"); calB.setToolTipText("Click to calculate"); clearB = new JButton("RESET"); clearB.setToolTipText("Click to clear"); reportB = new JButton ("REPORT"); reportB.setToolTipText ("Click to print"); exitB = new JButton("EXIT"); exitB.setToolTipText("Click to exit"); Blank.setLayout(new GridLayout(2,2)); Blank.setBorder(BorderFactory.createTitledBorder (BorderFactory.createEtchedBorder(),"")); button.setLayout(new GridLayout(1,4)); button.add(calB,BorderLayout.WEST); button.add(clearB,BorderLayout.CENTER); button.add(reportB,BorderLayout.CENTER); button.add(exitB,BorderLayout.EAST); Blank.add(pBlank); Blank.add(button); contentPane.add(Blank,BorderLayout.SOUTH); Blank.setBackground(Color.gray); pBlank.setBackground(Color.gray); calB.setForeground(Color.black); clearB.setForeground(Color.black); reportB.setForeground(Color.black); exitB.setForeground(Color.black); calB.setBackground(Color.pink); clearB.setBackground(Color.pink); reportB.setBackground(Color.pink); exitB.setBackground(Color.pink); calB.addActionListener(this); clearB.addActionListener(this); reportB.addActionListener(this); exitB.addActionListener(this); } public void actionPerformed(ActionEvent p) { if (p.getSource() == calB) { } else if (p.getSource() == clearB) { } else if (p.getSource () == reportB) { } else if (p.getSource() == exitB) { } } public static void main (String [] args) { Order frame = new Order(); frame.setTitle("Order"); frame.setSize(500,500); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); frame.setResizable(false); frame.setVisible(true); frame.setLocationRelativeTo(null);//center the frame } }

    Read the article

  • Java Box Class: Unsolvable: aligning components to the left or right

    - by user323186
    I have been trying to left align buttons contained in a Box to the left, with no success. They align left alright, but for some reason dont shift all the way left as one would imagine. I attach the code below. Please try compiling it and see for yourself. Seems bizarre to me. Thanks, Eric import java.awt.Dimension; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.io.BufferedReader; import java.io.File; import java.io.FileNotFoundException; import java.io.FileReader; import java.io.IOException; import javax.swing.Box; import javax.swing.BoxLayout; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.JMenu; import javax.swing.JMenuBar; import javax.swing.JMenuItem; import javax.swing.JScrollPane; import javax.swing.JTextArea; public class MainGUI extends Box implements ActionListener{ //Create GUI Components Box centerGUI=new Box(BoxLayout.X_AXIS); Box bottomGUI=new Box(BoxLayout.X_AXIS); //centerGUI subcomponents JTextArea left=new JTextArea(), right=new JTextArea(); JScrollPane leftScrollPane = new JScrollPane(left), rightScrollPane = new JScrollPane(right); //bottomGUI subcomponents JButton encrypt=new JButton("Encrypt"), decrypt=new JButton("Decrypt"), close=new JButton("Close"), info=new JButton("Info"); //Create Menubar components JMenuBar menubar=new JMenuBar(); JMenu fileMenu=new JMenu("File"); JMenuItem open=new JMenuItem("Open"), save=new JMenuItem("Save"), exit=new JMenuItem("Exit"); int returnVal =0; public MainGUI(){ super(BoxLayout.Y_AXIS); initCenterGUI(); initBottomGUI(); initFileMenu(); add(centerGUI); add(bottomGUI); addActionListeners(); } private void addActionListeners() { open.addActionListener(this); save.addActionListener(this); exit.addActionListener(this); encrypt.addActionListener(this); decrypt.addActionListener(this); close.addActionListener(this); info.addActionListener(this); } private void initFileMenu() { fileMenu.add(open); fileMenu.add(save); fileMenu.add(exit); menubar.add(fileMenu); } public void initCenterGUI(){ centerGUI.add(leftScrollPane); centerGUI.add(rightScrollPane); } public void initBottomGUI(){ bottomGUI.setAlignmentX(LEFT_ALIGNMENT); //setBorder(BorderFactory.createLineBorder(Color.BLACK)); bottomGUI.add(encrypt); bottomGUI.add(decrypt); bottomGUI.add(close); bottomGUI.add(info); } @Override public void actionPerformed(ActionEvent arg0) { // find source of the action Object source=arg0.getSource(); //if action is of such a type do the corresponding action if(source==close){ kill(); } else if(source==open){ //CHOOSE FILE File file1 =chooseFile(); String input1=readToString(file1); System.out.println(input1); left.setText(input1); } else if(source==decrypt){ //decrypt everything in Right Panel and output in left panel decrypt(); } else if(source==encrypt){ //encrypt everything in left panel and output in right panel encrypt(); } else if(source==info){ //show contents of info file in right panel doInfo(); } else { System.out.println("Error"); //throw new UnimplementedActionException(); } } private void doInfo() { // TODO Auto-generated method stub } private void encrypt() { // TODO Auto-generated method stub } private void decrypt() { // TODO Auto-generated method stub } private String readToString(File file) { FileReader fr = null; try { fr = new FileReader(file); } catch (FileNotFoundException e1) { e1.printStackTrace(); } BufferedReader br=new BufferedReader(fr); String line = null; try { line = br.readLine(); } catch (IOException e) { e.printStackTrace(); } String input=""; while(line!=null){ input=input+"\n"+line; try { line=br.readLine(); } catch (IOException e) { e.printStackTrace(); } } return input; } private File chooseFile() { //Create a file chooser final JFileChooser fc = new JFileChooser(); returnVal = fc.showOpenDialog(fc); return fc.getSelectedFile(); } private void kill() { System.exit(0); } public static void main(String[] args) { // TODO Auto-generated method stub MainGUI test=new MainGUI(); JFrame f=new JFrame("Tester"); f.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); f.setJMenuBar(test.menubar); f.setPreferredSize(new Dimension(600,400)); //f.setUndecorated(true); f.add(test); f.pack(); f.setVisible(true); } }

    Read the article

  • Issue in configuring JPA with Spring 3 in Jboss 4.2.2 server.

    - by KVMKReddy
    Hi, I am facing issues in configuring JPA with Spring 3 in JBoss 4.2.2 server. Please find the below file of persistence.xml. <?xml version="1.0" encoding="UTF-8"?> <persistence xmlns="http://java.sun.com/xml/ns/persistence" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/persistence http://java.sun.com/xml/ns/persistence/persistence_1_0.xsd" version="1.0"> <persistence-unit name="TestPU"> <provider>org.hibernate.ejb.HibernatePersistence</provider> <jta-data-source>java:/TestDS</jta-data-source> <properties> <property name="hibernate.dialect" value="org.hibernate.dialect.Oracle10gDialect"/> <property name="hibernate.show_sql" value="true"/> </properties> </persistence-unit> </persistence> My spring-beans.xml is as below <bean id="MyAdvise" class=".......Aspect"> <property name="persister"> <bean id="dbPersister" class="..............DataBasePersister"> </bean> </property> </bean> <bean id="localContainerEntityManagerFactory" class="org.springframework.orm.jpa.LocalContainerEntityManagerFactoryBean"> <property name="jpaVendorAdapter"> <bean class="org.springframework.orm.jpa.vendor.HibernateJpaVendorAdapter"> <property name="showSql" value="true"/> <property name="database" value="ORACLE"/> </bean> </property> <property name="jpaProperties"> <props> <prop key="hibernate.transaction.manager_lookup_class">org.hibernate.transaction.JBossTransactionManagerLookup</prop> </props> </property> </bean> <bean id="myTxManager" class="org.springframework.orm.jpa.JpaTransactionManager"> <property name="entityManagerFactory" ref="localContainerEntityManagerFactory"/> </bean> <tx:annotation-driven transaction-manager="myTxManager" /> My persister bean is as follows. public class DataBasePersister implements IPersister { private static Logger log = Logger.getLogger(DataBasePersister.class); // The Entity Manager @PersistenceContext protected EntityManager entityManager; @Transactional(readOnly = false) public void persist(Object data) { log.info("IN persist() call. Is the data can castable to MethodStats -->:"+(data instanceof MethodStats)); log.info("Entity Manager instance -->:"+(entityManager)); ---------------------- ---------------------- ---------------------- } } I am getting the following exception when the spring container creating my persister bean org.springframework.transaction.CannotCreateTransactionException: Could not open JPA EntityManager for transaction; nested exception is java.lang.IllegalStateException: JTA EntityManager cannot access a transactions at org.springframework.orm.jpa.JpaTransactionManager.doBegin(JpaTransactionManager.java:382) at org.springframework.transaction.support.AbstractPlatformTransactionManager.getTransaction(AbstractPlatformTransactionManager.java:371) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.springframework.aop.support.AopUtils.invokeJoinpointUsingReflection(AopUtils.java:309) at org.springframework.aop.framework.ReflectiveMethodInvocation.invokeJoinpoint(ReflectiveMethodInvocation.java:183) at org.springframework.aop.framework.ReflectiveMethodInvocation.proceed(ReflectiveMethodInvocation.java:150) at org.springframework.aop.framework.ReflectiveMethodInvocation.proceed(ReflectiveMethodInvocation.java:166) at org.springframework.aop.interceptor.ExposeInvocationInterceptor.invoke(ExposeInvocationInterceptor.java:89) at org.springframework.aop.framework.ReflectiveMethodInvocation.proceed(ReflectiveMethodInvocation.java:172) at org.springframework.aop.framework.JdkDynamicAopProxy.invoke(JdkDynamicAopProxy.java:202) at $Proxy147.getTransaction(Unknown Source) at org.springframework.transaction.interceptor.TransactionAspectSupport.createTransactionIfNecessary(TransactionAspectSupport.java:335) at org.springframework.transaction.interceptor.TransactionInterceptor.invoke(TransactionInterceptor.java:105) at org.springframework.aop.framework.ReflectiveMethodInvocation.proceed(ReflectiveMethodInvocation.java:172) at org.springframework.aop.interceptor.ExposeInvocationInterceptor.invoke(ExposeInvocationInterceptor.java:89) at org.springframework.aop.framework.ReflectiveMethodInvocation.proceed(ReflectiveMethodInvocation.java:172) at org.springframework.aop.framework.JdkDynamicAopProxy.invoke(JdkDynamicAopProxy.java:202) at $Proxy141.persist(Unknown Source) at com.adp.sbs.aop.aspectj.SBSMethodStatsCollectorAspect.doAround(SBSMethodStatsCollectorAspect.java:63) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:585) at org.springframework.aop.aspectj.AbstractAspectJAdvice.invokeAdviceMethodWithGivenArgs(AbstractAspectJAdvice.java:621) at org.springframework.aop.aspectj.AbstractAspectJAdvice.invokeAdviceMethod(AbstractAspectJAdvice.java:610) at org.springframework.aop.aspectj.AspectJAroundAdvice.invoke(AspectJAroundAdvice.java:65) at org.springframework.aop.framework.ReflectiveMethodInvocation.proceed(ReflectiveMethodInvocation.java:161) at org.springframework.aop.interceptor.ExposeInvocationInterceptor.invoke(ExposeInvocationInterceptor.java:89) at org.springframework.aop.framework.ReflectiveMethodInvocation.proceed(ReflectiveMethodInvocation.java:172) at org.springframework.aop.framework.Cglib2AopProxy$DynamicAdvisedInterceptor.intercept(Cglib2AopProxy.java:621) at com.adp.sbs.aop.test.TestMethodLevelAnnotationStats$$EnhancerByCGLIB$$efbc78a8.MethodWithOneParamsAndReturnTypeAsString(<generated>) at com.adp.sbs.aop.test.SimpleTestServlet.testMethodAnnotations(SimpleTestServlet.java:46) at com.adp.sbs.aop.test.SimpleTestServlet.doPost(SimpleTestServlet.java:40) at com.adp.sbs.aop.test.SimpleTestServlet.doGet(SimpleTestServlet.java:33) at javax.servlet.http.HttpServlet.service(HttpServlet.java:690) at javax.servlet.http.HttpServlet.service(HttpServlet.java:803) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:290) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.jboss.web.tomcat.filters.ReplyHeaderFilter.doFilter(ReplyHeaderFilter.java:96) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:235) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.java:230) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.java:175) at org.jboss.web.tomcat.security.SecurityAssociationValve.invoke(SecurityAssociationValve.java:179) at org.jboss.web.tomcat.security.JaccContextValve.invoke(JaccContextValve.java:84) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:127) at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:102) at org.jboss.web.tomcat.service.jca.CachedConnectionValve.invoke(CachedConnectionValve.java:157) at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java:109) at org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:262) at org.apache.coyote.http11.Http11Processor.process(Http11Processor.java:844) at org.apache.coyote.http11.Http11Protocol$Http11ConnectionHandler.process(Http11Protocol.java:583) at org.apache.tomcat.util.net.JIoEndpoint$Worker.run(JIoEndpoint.java:446) at java.lang.Thread.run(Thread.java:595) Caused by: java.lang.IllegalStateException: JTA EntityManager cannot access a transactions at org.hibernate.ejb.AbstractEntityManagerImpl.getTransaction(AbstractEntityManagerImpl.java:316) at org.springframework.orm.jpa.DefaultJpaDialect.beginTransaction(DefaultJpaDialect.java:70) at org.springframework.orm.jpa.vendor.HibernateJpaDialect.beginTransaction(HibernateJpaDialect.java:57) at org.springframework.orm.jpa.JpaTransactionManager.doBegin(JpaTransactionManager.java:332) Can you somebody please suggest me how to resolve this.

    Read the article

  • Java Client-Server problem when sending multiple files

    - by Jim
    Client public void transferImage() { File file = new File(ServerStats.clientFolder); String[] files = file.list(); int numFiles = files.length; boolean done = false; BufferedInputStream bis; BufferedOutputStream bos; int num; byte[] byteArray; long count; long len; Socket socket = null ; while (!done){ try{ socket = new Socket(ServerStats.imgServerName,ServerStats.imgServerPort) ; InputStream inStream = socket.getInputStream() ; OutputStream outStream = socket.getOutputStream() ; System.out.println("Connected to : " + ServerStats.imgServerName); BufferedReader inm = new BufferedReader(new InputStreamReader(inStream)); PrintWriter out = new PrintWriter(outStream, true /* autoFlush */); for (int itor = 0; itor < numFiles; itor++) { String fileName = files[itor]; System.out.println("transfer: " + fileName); File sentFile = new File(fileName); len = sentFile.length(); len++; System.out.println(len); out.println(len); out.println(sentFile); //SENDFILE bis = new BufferedInputStream(new FileInputStream(fileName)); bos = new BufferedOutputStream(socket.getOutputStream( )); byteArray = new byte[1000000]; count = 0; while ( count < len ){ num = bis.read(byteArray); bos.write(byteArray,0,num); count++; } bos.close(); bis.close(); System.out.println("file done: " + itor); } done = true; }catch (Exception e) { System.err.println(e) ; } } } Server public static void main(String[] args) { BufferedInputStream bis; BufferedOutputStream bos; int num; File file = new File(ServerStats.serverFolder); if (!(file.exists())){ file.mkdir(); } try { int i = 1; ServerSocket socket = new ServerSocket(ServerStats.imgServerPort); Socket incoming = socket.accept(); System.out.println("Spawning " + i); try { try{ if (!(file.exists())){ file.mkdir(); } InputStream inStream = incoming.getInputStream(); OutputStream outStream = incoming.getOutputStream(); BufferedReader inm = new BufferedReader(new InputStreamReader(inStream)); PrintWriter out = new PrintWriter(outStream, true /* autoFlush */); String length2 = inm.readLine(); System.out.println(length2); String filename = inm.readLine(); System.out.println("Filename = " + filename); out.println("ACK: Filename received = " + filename); //RECIEVE and WRITE FILE byte[] receivedData = new byte[1000000]; bis = new BufferedInputStream(incoming.getInputStream()); bos = new BufferedOutputStream(new FileOutputStream(ServerStats.serverFolder + "/" + filename)); long length = (long)Integer.parseInt(length2); length++; long counter = 0; while (counter < length){ num = bis.read(receivedData); bos.write(receivedData,0,num); counter ++; } System.out.println(counter); bos.close(); bis.close(); File receivedFile = new File(filename); long receivedLen = receivedFile.length(); out.println("ACK: Length of received file = " + receivedLen); } finally { incoming.close(); } } catch (IOException e){ e.printStackTrace(); } } catch (IOException e1){ e1.printStackTrace(); } } The code is some I found, and I have slightly modified it, but I am having problems transferring multiple images over the server. Output on Client: run ServerQueue.Client Connected to : localhost transfer: Picture 012.jpg 1312743 java.lang.ArrayIndexOutOfBoundsException Connected to : localhost transfer: Picture 012.jpg 1312743 Cant seem to get it to transfer multiple images. But bothsides I think crash or something because the file never finishes transfering

    Read the article

  • what is the wrong in this code(openAl in vc++)

    - by maiajam
    hi how are you all? i need your help i have this code #include <conio.h> #include <stdlib.h> #include <stdio.h> #include <al.h> #include <alc.h> #include <alut.h> #pragma comment(lib, "openal32.lib") #pragma comment(lib, "alut.lib") /* * These are OpenAL "names" (or "objects"). They store and id of a buffer * or a source object. Generally you would expect to see the implementation * use values that scale up from '1', but don't count on it. The spec does * not make this mandatory (as it is OpenGL). The id's can easily be memory * pointers as well. It will depend on the implementation. */ // Buffers to hold sound data. ALuint Buffer; // Sources are points of emitting sound. ALuint Source; /* * These are 3D cartesian vector coordinates. A structure or class would be * a more flexible of handling these, but for the sake of simplicity we will * just leave it as is. */ // Position of the source sound. ALfloat SourcePos[] = { 0.0, 0.0, 0.0 }; // Velocity of the source sound. ALfloat SourceVel[] = { 0.0, 0.0, 0.0 }; // Position of the Listener. ALfloat ListenerPos[] = { 0.0, 0.0, 0.0 }; // Velocity of the Listener. ALfloat ListenerVel[] = { 0.0, 0.0, 0.0 }; // Orientation of the Listener. (first 3 elements are "at", second 3 are "up") // Also note that these should be units of '1'. ALfloat ListenerOri[] = { 0.0, 0.0, -1.0, 0.0, 1.0, 0.0 }; /* * ALboolean LoadALData() * * This function will load our sample data from the disk using the Alut * utility and send the data into OpenAL as a buffer. A source is then * also created to play that buffer. */ ALboolean LoadALData() { // Variables to load into. ALenum format; ALsizei size; ALvoid* data; ALsizei freq; ALboolean loop; // Load wav data into a buffer. alGenBuffers(1, &Buffer); if(alGetError() != AL_NO_ERROR) return AL_FALSE; alutLoadWAVFile((ALbyte *)"C:\Users\Toshiba\Desktop\Graduation Project\OpenAL\open AL test\wavdata\FancyPants.wav", &format, &data, &size, &freq, &loop); alBufferData(Buffer, format, data, size, freq); alutUnloadWAV(format, data, size, freq); // Bind the buffer with the source. alGenSources(1, &Source); if(alGetError() != AL_NO_ERROR) return AL_FALSE; alSourcei (Source, AL_BUFFER, Buffer ); alSourcef (Source, AL_PITCH, 1.0 ); alSourcef (Source, AL_GAIN, 1.0 ); alSourcefv(Source, AL_POSITION, SourcePos); alSourcefv(Source, AL_VELOCITY, SourceVel); alSourcei (Source, AL_LOOPING, loop ); // Do another error check and return. if(alGetError() == AL_NO_ERROR) return AL_TRUE; return AL_FALSE; } /* * void SetListenerValues() * * We already defined certain values for the Listener, but we need * to tell OpenAL to use that data. This function does just that. */ void SetListenerValues() { alListenerfv(AL_POSITION, ListenerPos); alListenerfv(AL_VELOCITY, ListenerVel); alListenerfv(AL_ORIENTATION, ListenerOri); } /* * void KillALData() * * We have allocated memory for our buffers and sources which needs * to be returned to the system. This function frees that memory. */ void KillALData() { alDeleteBuffers(1, &Buffer); alDeleteSources(1, &Source); alutExit(); } int main(int argc, char *argv[]) { printf("MindCode's OpenAL Lesson 1: Single Static Source\n\n"); printf("Controls:\n"); printf("p) Play\n"); printf("s) Stop\n"); printf("h) Hold (pause)\n"); printf("q) Quit\n\n"); // Initialize OpenAL and clear the error bit. alutInit(NULL, 0); alGetError(); // Load the wav data. if(LoadALData() == AL_FALSE) { printf("Error loading data."); return 0; } SetListenerValues(); // Setup an exit procedure. atexit(KillALData); // Loop. ALubyte c = ' '; while(c != 'q') { c = getche(); switch(c) { // Pressing 'p' will begin playing the sample. case 'p': alSourcePlay(Source); break; // Pressing 's' will stop the sample from playing. case 's': alSourceStop(Source); break; // Pressing 'h' will pause the sample. case 'h': alSourcePause(Source); break; }; } return 0; } and it is run willbut i cant here any thing also i am new in programong and wont to program a virtual reality sound in my graduation project and start to learn opeal and vc++ but i dont how to start and from where i must begin and i want to ask if i need to learn about API win ?? and if i need how i can learn that thank you alote and i am sorry coz of my english

    Read the article

< Previous Page | 623 624 625 626 627 628 629 630 631 632 633 634  | Next Page >