Search Results

Search found 82298 results on 3292 pages for 'mvc you know me'.

Page 638/3292 | < Previous Page | 634 635 636 637 638 639 640 641 642 643 644 645  | Next Page >

• C Language preprocessing doubt

  - by khanna_param

  Hi, There are different kind of macros in C language, nested macro is one of them. Considering a program with the following macro define HYPE(x,y) (SQUR(x)+SQUR(y)) define SQUR(x) (x*x) using this we can successfully complile to get the result. My question:- As we all know the C preprocessor replaces all the occurrence of the identifiers with the replacement-string. Considering the above example i would like to know how many times the C compiler traverses the program to replace the macro with the replacement values. I assume it cannot be done in one go. Thanks.

  Read the article

• PNY ExpressCard SATA II 2-port card - drivers?

  - by stewartwb

  I bought a couple of PNY eSATA cards for notebook computers, model P-NSA2-EC-RF. I mistakenly thought that they would be a bit more plug-and-play, like cards that supply USB or Firewire ports. They did not ship with the Driver CD, and the drivers I found on the PNY web site didn't work. I've emailed their support group, but we all know how likely it is that they will respond before the end of the decade. Does anyone have a driver disc handy for this model card, or know where I might download a driver ISO? (Dell XPS M1330 laptop running Windows 7 x64 and sometimes Windows 7 x86)

  Read the article

• Exchange 2007 automatically adding IP to block list

  - by Tim Anderson

  This puzzled me. We have all mail directed to an ISP's spam filter, then delivered to SBS 2008 Exchange. One of the ISP's IP numbers suddenly appeared in the ES2007 block list, set to expire in 24 hours I think, so emails started bouncing. Quick look through the typically ponderous docs, and I can't see anything that says Exchange will auto-block an IP number, but nobody is admitting to adding it manually and I think it must have done. Anyone know about this or where it is configured? Obviously one could disable block lists completely but I'd like to know exactly why this happened.

  Read the article

• How do I find out when and by whom a particular user was deleted in linux?

  - by executor21

  I've recently ran into a very odd occurrence on one system I'm using. For no apparent reason, my user account was deleted, although the home directory is still there. I have root access, so I can restore the account, but first, I want to know how this happened, and exactly when. Inspecting the root's .bash_history file and the "last" command gave nothing, and I'm (well, was) the only sudoer on the system. How would I know when this deletion happened? The distro is CentOS release 5.4 (Final), if that helps.

  Read the article

• HP Pavillion dv6 laptop - 15 beeps on startup and a black screen?

  - by dunc

  Usual story - girlfriend's step-brother's laptop is broken. I don't know a huge amount about what occurred before it broke, but I do know the following: When you try to turn the laptop on, it beeps 15 times exactly. The screen remains black. The LED on the Caps Lock key flashes continuously. If left on, the laptop never boots - as far as I can see. If left on, on a stable surface with decent ventilation for a relatively short period of time, the laptop (below keyboard, but not where the RAM/HDD are) gets very hot. I've tried doing what most websites appear to recommend for similar problems, which is to disconnect AC and battery then hold the power button down for a minute before reconnecting the AC and trying to turn the laptop on - no difference. EDIT I've also tried re-seating the RAM, to no avail. Any ideas? Thanks in advance,

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Clone drive in Windows

  - by ERJ

  I have two 2 TB external USB hard drives, call them HD1 and HD2. HD1 is USB 2, HD2 is USB 3. Each drive contains exactly one NTFS partition. I want to clone HD1 to HD2, because it's newer and much, much faster. What's the best way to do this? I don't want to do a copy-and-paste, I want to clone the whole partition. The new drive is actually a few bytes larger, so this should be possible? I don't have a second drive that can hold the image, so it would have to clone directly to the other disk (not to a file). How can I accomplish this on Windows 7? I know about Clonezilla but I would prefer not to have to boot from a CD or anything, as I don't have the capability to do that right now. I want to know if there's a way to do this while running Windows.

  Read the article

• Is there a free program that can detect which device on my network is causing lag?

  - by malfy

  I'm on a small business network, and rarely we experience really extreme latency. I have no idea what device might be causing the lag, and wanted to know if there was a piece of software that could detect it. I know about some softwares like wireshark, which maybe do what I'm asking? If so it's too complicated to understand. I run the program and I have no idea what I'm looking at, or what parameters to give it. So something that can monitor traffic, as well as describe it in such a way that even a not so network savvy individual can interpret.

  Read the article

• Redirect channel to another speaker

  - by stex

  Hi, I'm not sure about the title but don't know how to say it in a clearer way. My Soundcard is a Creative X-Fi and I'm using the Creative console starter. Now I'd like to use my speakers not only for my normal screens but also when using a beamer. Due to my room's geometry, the only place for the beamer's projection is a wall which is right to my normal screens (so the projection would be between the front right and the rear right speaker). Now I'm thinking about redirecting the channels to the correct speakers somehow. As far as I remember, in previous version of creative console starter there was an option to do this (e.g. redirect front left to rear right output channel). Does anyone know how to do this with software? Of course I could install a cable switch, but if there's a way without I'd prefer this :) Thanks in advance.

  Read the article

• Tips for locating my stolen computer

  - by user379468

  I'm in a bit of a panic, my new Powerbook laptop was stolen. I had no mobile me, or security software installed on the computer. I have the mac address of the computer as well as the serial number. Is there a hacky way to do this? I was even thinking perhaps of trying to use bluetooth, I know I had it set to discoverable. and I know the "name" of the computer, perhaps there is app that can scan the names of bluetooh computers in the vicinity? If there some third party you can get to scan the internet for your mac address? Any glimmer of hope would really help

  Read the article

• perform command substitution in MS-DOS

  - by wiggin200

  I wonder how you can make in MS-DOS a command substitution Command substitution is a very powerful concept of the UNIX shell. It is used to insert the output of one command into a second command. E.g. with an assignment: $ today=$(date) # starts the "date" command, captures its output $ echo "$today" Mon Jul 26 13:16:02 MEST 2004 This can also be used with other commands besides assignments: $ echo "Today is $(date +%A), it's $(date +%H:%M)" Today is Monday, it's 13:21 This calls the date command two times, the first time to print the week-day, the second time for the current time. I need to know to do that in MS-DOS, (I already know that there is a way to perform something like that using as part of the for command, but this way is much more obfuscated and convoluted

  Read the article

• Dell Vostro 3500 battery life remaining missing from Windows 8?

  - by Misha

  On Windows 7 a Vostro 3500 laptop shows the battery life remaining, while on Windows 8 this information appears to be missing. The percentage is still available, but the life remaining is missing. How is battery life remaining calculated and does this require some level of driver support? Is it a standardized interface? Does anybody know which driver is responsible for handling this feature? I want to force the old Windows 7 driver, but I don't know which driver does battery remaining.

  Read the article

• What does *:* in netstat output stands for?

  - by chello

  While executing the command /usr/sbin/lsof -l -i -P -n under root user, I am getting this output. COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME ... httpd 9164 70 3u IPv4 0x2f70270 0t0 TCP 127.0.0.1:9010 (LISTEN) httpd 9164 70 4u IPv6 0x25af4bc 0t0 TCP *:80 (LISTEN) httpd 9164 70 5u IPv4 0x3149e64 0t0 TCP *:* (CLOSED) httpd 9180 70 3u IPv4 0x2f70270 0t0 TCP 127.0.0.1:9010 (LISTEN) httpd 9180 70 4u IPv6 0x25af4bc 0t0 TCP *:80 (LISTEN) httpd 9180 70 5u IPv4 0x3149e64 0t0 TCP *:* (CLOSED) Please let me know what does *:* stands for? I am interested to know both the ipaddress and port fields. Also what does (CLOSED) mean here?

  Read the article

• Windows File Checksums - Is my system hacked?

  - by rism

  I would like to know if there is a utility to verify the checksums of every windows file on my Win 7 Ultimate system. It seems on the surface such an obvious utility but I dont ever remember seeing one? I had a very weird experience while surfing earlier today and now Im not entirely sure my system is secure. I have a collection of tools in the WSCC suite but these tools no doubt just make system calls to the win32 api and if that has been subverted then the tools are practically useless. How do I know my Win 7 files are actually Win 7 files? I am particularly interested in verifying the integrity of all network TCP/IP files.

  Read the article

• Apache Key: Which is it using?

  - by quindraco

  I'm running an Apache server on Ubuntu. When I restart it, it asks me for a pass phrase; here's what the dialog looks like: Apache/2.2.16 mod_ssl/2.2.16 (Pass Phrase Dialog) Some of your private key files are encrypted for security reasons. In order to read them you have to provide the pass phrases. Server 127.0.0.1:443 (RSA) Enter pass phrase: I've already worked out how to remove the pass phrase from the key file in question, but I can't find any information anywhere on how to determine which key file Apache is complaining about in the above dialog. I have dozens of key files on the server in question, although I don't know which ones are in active use (all I did is 'locate .pem' and ignore the false positives). Does anyone know how to track down which pem file I need to remove the passphrase from?

  Read the article

• Change Windows 7 Explorer's Details Pane limits

  - by Paul

  For some reason, MS decided to completely kill the status bar's functionality in Win7 (and maybe Vista, but I don't know for sure). I have tried all possible options such as Classic Shell and so on. Basically, the one thing I miss most is seeing at a glance the total size of my selected files. I know I can press Alt+Enter or whatever, but that's not the point. The point is that the so-called 'details' pane stops providing details if more than 15 files are selected! WTH? Cannot understand the reason behind such a stupid arbitrary limit, that doesn't seem to be user-configurable at all. Anyway, what I'm looking for is a way to change that limit, either via the registry or otherwise. Is this at all possible?

  Read the article

• Hot swap in Ubuntu Server not working

  - by druciferre

  I am running Ubuntu Server 10.04 (lucid lynx), and I just purchased a hot-swap compatible hdd bay and installed it. When I insert a hot-swappable SATA drive, the drive does not show up after running ls /dev/sd?. If I reboot the server, then after it comes back up the drive appears. I have checked /var/log/messages and nothing shows up when I insert the drive, only after rebooting. I have tried the following: $ sudo echo "0 0 0" > /sys/class/scsi_host/host4/scan $ sudo partprobe` $ sudo udevadm trigger Every answer I've found searching Google was one of the things I listed in "I have tried..." and I don't really know what to do at this point. Does anyone know why this occurring?

  Read the article

• Automate setup of constrained kerberos delegation in AD

  - by Grhm

  I have a web app that uses some backend servers (UNC, HTTP and SQL). To get this working I need to configure ServicePrincipalNames for the account running the IIS AppPool and then allow kerberos delegation to the backend services. I know how to configure this through the "Delegation" tab of the AD Users and Computers tool. However, the application is going to be deployed to a number of Active Directory environments. Configuring delegation manually has proved to be error prone and debugging the issues misconfiguration causes is time consuming. I'd like to create an installation script or program that can do this for me. Does anyone know how to script or programmatically set constrained delegation within AD? Failing that how can I script reading the allowed services for a user to validate that it has been setup correctly?

  Read the article

• Tool to allow Kerberos Authenticated users to modify Firewall settings

  - by Lars Hanke

  I run a firewall on a central router. Recently, several users want to use Skype. Since firewalling Skype virtually means to switch the firewall off, I consider to allow users to temporarily punch holes for their system. Since the users have no accounts on the router, I consider using Kerberos for authentication and authorization. The router is a Debian Squeeze box, with minimal configuration, i.e. no web-server, database or similar gimmicks. Does anyone know an existing solution, which could be used for that purpose? Or does anybody know easy to use and well documented frameworks in say Perl, Python, C, C++, ... making the set-up of a Kerberos authenticated Client and Server application really simple?

  Read the article

• Record Matching Software to Compare two tables and match on % Based

  - by Crazyd

  So I have some table with Name, Address, and Zip with no record data attached; and I have a table which has all the same, but has more information and I need a way to merge the tables when they don't match 100%. How do I match them up if they aren't Identical? I'm a newb @ SQL, but I know they won't match up for the most part and I can't be the only one with this issue. However software which will do this has proven to be difficult. Writing software to do this would even be worse than having to do it in the first place. I know I can do this in excel; kinda, but with the amount of records I have its proving to be difficult over a million.

  Read the article

• Delete Google Chrome's tab history

  - by wizlog

  After browsing the web for a while, I want to delete my history. So I press CTRL and H keys, and click the Edit items on the blue bar at the top of the page. Then I select the checkboxes for the items I want to remove. Then I click remove selected items. When I go into any of my open tabs, their history isn't deleted. Without restarting the tab or the browser, is there any way to clear the history within a tab? I also want to know how to clear just one tab's history, without needing to know all the pages that the tab had visited, then going to the history page...

  Read the article

• Cannot find grldr in all devices

  - by blockhead

  I'm running wubi on XP machine. Started out originally with 8.04, and gradually upgraded to 10.04. Recently, I was creating linux bootable USB drive, and put it in my system to see if it would work. After booting the LiveOS, and rebooting my machine, I know get the error Cannot find grldr in all devices when booting Ubuntu. I don't know what grldr is, but I assume it is the GRUB Loader. Did booting the LiveOS screw with my MBR perhaps? How can I fix this, and if not, is it possible to reinstall wubi, without losing anything of what I have now?

  Read the article

• How to "debug" a keyboard in Linux? Like pressing a key and seeing a code in a terminal.

  - by Somebody still uses you MS-DOS

  I didn't have an answer to my problem about adding additional keyboards in my Ubuntu 10.04. Questions mark is not working in my keyboard, only using Alt Gr key + W. So, I don't know if this is a problem with Ubuntu or Virtualbox itself (I'm running it inside a VM). I would like to debug this problem. The keyboard is plugged in, so when I press a key I believe something is being sent to my operating system, some code, I don't know. I would like to digg this problem, find some damn key code and find some damn *.conf file and manually fix my problem. So, do an application like this exist in Linux?

  Read the article

• Cannot delete folder - Content seems to be nested recursively

  - by RikuXan

  I cannot delete a folder located on my hard disk by any means. I don't quite know how it was created, all I know is, that it is a pretty deep structure of folders (too deep to delete it at once, since Windows restriction path name too long), but the problem in the end is, that I can't "pull out" the inner folders, because they don't seem to be folders anymore (Context menu lacks things like "Properties", "Cut", "Copy", "Delete" etc.) Here a picture of how a right click looks like on one of these "folders": As you can see, the current folder is in very deep, but that is not the problem, rather the one I left-clicked on. Has anyone any advice on how to get rid of these? I tried a chkdsk, said no errors. I also tried deleting those folder via a VMWare Ubuntu, to no success. I also tried a batch file from a volunteer at MS boards, that should automatically de-nest such folders, but I guess mine is a special case, since the tool only created more such folders.

  Read the article

• Mix content warning on ASPX page

  - by Amit

  Hi, We have started receiving the mixed content warning on ASPX pages on our secured site. We do not have any mix content, we load all our JS, Images, CSS and ASPX files using HTTPS. I dont know why we have started receiving these warnings now. The latest thing which we have added is the third party control for Dialog boxes from Essential Object. We are previously using their Menu control but added dialog box recently. Also we have made our application browser compatible. I feel the reason is something between these two points. Can anyone suggest any solution or any workaround if they know any or have used Essential Object controls and faced simililar issue? Essential object is saying it is not their problem. The mix content warning appears any time and not specifically when the Essential Control dialog box popsup, thats why I am bit confused. Any help is highly appriciated. Thanks.

  Read the article

< Previous Page | 634 635 636 637 638 639 640 641 642 643 644 645  | Next Page >