Search Results

Search found 34840 results on 1394 pages for 'sublime text'.

Page 66/1394 | < Previous Page | 62 63 64 65 66 67 68 69 70 71 72 73  | Next Page >

  • Twitter Bootstrap styling conflicts with plug-ins like jqGrid and other third part libraries

    - by Renso
    Issues:The concern is that the Twitter Bootstrap framework is that some of their css selectors are simply too generic and have incompatibility issues and conflicts with most third party plug-ins and css libraries, like jQuery-UI and jqGrid.My most pressing concern is only with the generic selector for the styling of "INPUT" controls.Some concerns:So basically anyone using BS (Bootstrap) will have to override styling 100% of the time on all input controls on all their web pages for all the plug-ins they use that render their own styling for input controls. This seems to chisel away any reason for using Bootstrap. Overriding Bootstrap css in this case seems illogical at best as it implies the BS styling is not correct or as granular as it is supposed to be. It also suggests you realize there is an issue here. Any person who has written a fair amount of css will realize that it is a mammoth task to to take an existing app, converting it to BS and then having to find all non-BS input controls and styling them all. The worst part is that there is no generic styling for this as each input control has a different source/context, some are regular tags and some belong to plug-ins, each with their own flavor of styling. For new web apps the challenge is not that different, each time you add a new plug-in you will have to test all facets of it, and I mean all of it, pop-ups, etc, that contain any kind of input control to make sure it is styled correctly. I am having a hard time seeing the benefits of BS in this context. So until the BS team addresses the issue, or not, you may be wondering what is the easiest solution.Help the community to drive this issue home by creating a new issue on github, see my entry here: https://github.com/twitter/bootstrap/issues/4008. As you can see I got some good and some negative feedback, but we all agree it is an issue. I do believe my solution below should be reverse compatible if the proper class declarations were followed as recommended by Bootstrap.The solution:Add a higher-level qualifier to the input selector, which may not break anything.  Add "control-group" and "controls" classes as higher-level selectors, as they have to be declared inside those classes anyway as far as I understand the design approach of BS. So in my example below can modify the css without possible breaking anything, see the css at the bottom. I tested this briefly and seems to render just as expected. May not be complete as I only spent a few minutes on the css. Your feedback will be greatly appreciated. <div class="control-group">    <label title="" for="Contact_FirstName" class="control-label">First Name</label>    <div class="controls">        <input type="text" value="" name="Contact.FirstName" id="Contact_FirstName" data-val-required="The Reader Contact&amp;#39;s First Name is required" data-val-length-min="2" data-val-length-max="250" data-val-length="The maximum length allowed for the Reader Contact&amp;#39;s First Name is 250 characters and must be two or more characters long" data-val="true" class="input-medium">        <span data-valmsg-replace="true" data-valmsg-for="Contact.FirstName" class="field-validation-valid"></span>    </div></div>Here are the SCSS (SASS) updates. In stead of just including the updates I decided to include the entire bootstrap SCSS file so you can just copy-and-paste it in stead of trying to figure out what selectors have changed./*! * Bootstrap v2.0.4 * Enhacement by Renso Hollhumer * Copyright 2012 Twitter, Inc * Licensed under the Apache License v2.0 * http://www.apache.org/licenses/LICENSE-2.0 * * Designed and built with all the love in the world @twitter by @mdo and @fat. * Enhancement by Renso Hollhumer: To isolate styling of INPUT tags to the Bootstrap context only */.clearfix {  *zoom: 1;}.clearfix:before,.clearfix:after {  display: table;  content: "";}.clearfix:after {  clear: both;}.hide-text {  font: 0/0 a;  color: transparent;  text-shadow: none;  background-color: transparent;  border: 0;}.input-block-level {  display: block;  width: 100%;  min-height: 28px;  -webkit-box-sizing: border-box;  -moz-box-sizing: border-box;  -ms-box-sizing: border-box;  box-sizing: border-box;}article,aside,details,figcaption,figure,footer,header,hgroup,nav,section {  display: block;}audio,canvas,video {  display: inline-block;  *display: inline;  *zoom: 1;}audio:not([controls]) {  display: none;}html {  font-size: 100%;  -webkit-text-size-adjust: 100%;  -ms-text-size-adjust: 100%;}a:focus {  outline: thin dotted #333;  outline: 5px auto -webkit-focus-ring-color;  outline-offset: -2px;}a:hover,a:active {  outline: 0;}sub,sup {  position: relative;  font-size: 75%;  line-height: 0;  vertical-align: baseline;}sup {  top: -0.5em;}sub {  bottom: -0.25em;}img {  max-width: 100%;  vertical-align: middle;  border: 0;  -ms-interpolation-mode: bicubic;}#map_canvas img {  max-width: none;}button,input,select,textarea {  margin: 0;  font-size: 100%;  vertical-align: middle;}button,input {  *overflow: visible;  line-height: normal;}button::-moz-focus-inner,input::-moz-focus-inner {  padding: 0;  border: 0;}button,input[type="button"],input[type="reset"],input[type="submit"] {  cursor: pointer;  -webkit-appearance: button;}input[type="search"] {  -webkit-box-sizing: content-box;  -moz-box-sizing: content-box;  box-sizing: content-box;  -webkit-appearance: textfield;}input[type="search"]::-webkit-search-decoration,input[type="search"]::-webkit-search-cancel-button {  -webkit-appearance: none;}textarea {  overflow: auto;  vertical-align: top;}body {  margin: 0;  font-family: "Helvetica Neue", Helvetica, Arial, sans-serif;  font-size: 13px;  line-height: 18px;  color: #333333;  background-color: #ffffff;}a {  color: #0088cc;  text-decoration: none;}a:hover {  color: #005580;  text-decoration: underline;}.row {  margin-left: -20px;  *zoom: 1;}.row:before,.row:after {  display: table;  content: "";}.row:after {  clear: both;}[class*="span"] {  float: left;  margin-left: 20px;}.container,.navbar-fixed-top .container,.navbar-fixed-bottom .container {  width: 940px;}.span12 {  width: 940px;}.span11 {  width: 860px;}.span10 {  width: 780px;}.span9 {  width: 700px;}.span8 {  width: 620px;}.span7 {  width: 540px;}.span6 {  width: 460px;}.span5 {  width: 380px;}.span4 {  width: 300px;}.span3 {  width: 220px;}.span2 {  width: 140px;}.span1 {  width: 60px;}.offset12 {  margin-left: 980px;}.offset11 {  margin-left: 900px;}.offset10 {  margin-left: 820px;}.offset9 {  margin-left: 740px;}.offset8 {  margin-left: 660px;}.offset7 {  margin-left: 580px;}.offset6 {  margin-left: 500px;}.offset5 {  margin-left: 420px;}.offset4 {  margin-left: 340px;}.offset3 {  margin-left: 260px;}.offset2 {  margin-left: 180px;}.offset1 {  margin-left: 100px;}.row-fluid {  width: 100%;  *zoom: 1;}.row-fluid:before,.row-fluid:after {  display: table;  content: "";}.row-fluid:after {  clear: both;}.row-fluid [class*="span"] {  display: block;  width: 100%;  min-height: 28px;  -webkit-box-sizing: border-box;  -moz-box-sizing: border-box;  -ms-box-sizing: border-box;  box-sizing: border-box;  float: left;  margin-left: 2.127659574%;  *margin-left: 2.0744680846382977%;}.row-fluid [class*="span"]:first-child {  margin-left: 0;}.row-fluid .span12 {  width: 99.99999998999999%;  *width: 99.94680850063828%;}.row-fluid .span11 {  width: 91.489361693%;  *width: 91.4361702036383%;}.row-fluid .span10 {  width: 82.97872339599999%;  *width: 82.92553190663828%;}.row-fluid .span9 {  width: 74.468085099%;  *width: 74.4148936096383%;}.row-fluid .span8 {  width: 65.95744680199999%;  *width: 65.90425531263828%;}.row-fluid .span7 {  width: 57.446808505%;  *width: 57.3936170156383%;}.row-fluid .span6 {  width: 48.93617020799999%;  *width: 48.88297871863829%;}.row-fluid .span5 {  width: 40.425531911%;  *width: 40.3723404216383%;}.row-fluid .span4 {  width: 31.914893614%;  *width: 31.8617021246383%;}.row-fluid .span3 {  width: 23.404255317%;  *width: 23.3510638276383%;}.row-fluid .span2 {  width: 14.89361702%;  *width: 14.8404255306383%;}.row-fluid .span1 {  width: 6.382978723%;  *width: 6.329787233638298%;}.container {  margin-right: auto;  margin-left: auto;  *zoom: 1;}.container:before,.container:after {  display: table;  content: "";}.container:after {  clear: both;}.container-fluid {  padding-right: 20px;  padding-left: 20px;  *zoom: 1;}.container-fluid:before,.container-fluid:after {  display: table;  content: "";}.container-fluid:after {  clear: both;}p {  margin: 0 0 9px;}p small {  font-size: 11px;  color: #999999;}.lead {  margin-bottom: 18px;  font-size: 20px;  font-weight: 200;  line-height: 27px;}h1,h2,h3,h4,h5,h6 {  margin: 0;  font-family: inherit;  font-weight: bold;  color: inherit;  text-rendering: optimizelegibility;}h1 small,h2 small,h3 small,h4 small,h5 small,h6 small {  font-weight: normal;  color: #999999;}h1 {  font-size: 30px;  line-height: 36px;}h1 small {  font-size: 18px;}h2 {  font-size: 24px;  line-height: 36px;}h2 small {  font-size: 18px;}h3 {  font-size: 18px;  line-height: 27px;}h3 small {  font-size: 14px;}h4,h5,h6 {  line-height: 18px;}h4 {  font-size: 14px;}h4 small {  font-size: 12px;}h5 {  font-size: 12px;}h6 {  font-size: 11px;  color: #999999;  text-transform: uppercase;}.page-header {  padding-bottom: 17px;  margin: 18px 0;  border-bottom: 1px solid #eeeeee;}.page-header h1 {  line-height: 1;}ul,ol {  padding: 0;  margin: 0 0 9px 25px;}ul ul,ul ol,ol ol,ol ul {  margin-bottom: 0;}ul {  list-style: disc;}ol {  list-style: decimal;}li {  line-height: 18px;}ul.unstyled,ol.unstyled {  margin-left: 0;  list-style: none;}dl {  margin-bottom: 18px;}dt,dd {  line-height: 18px;}dt {  font-weight: bold;  line-height: 17px;}dd {  margin-left: 9px;}.dl-horizontal dt {  float: left;  width: 120px;  clear: left;  text-align: right;  overflow: hidden;  text-overflow: ellipsis;  white-space: nowrap;}.dl-horizontal dd {  margin-left: 130px;}hr {  margin: 18px 0;  border: 0;  border-top: 1px solid #eeeeee;  border-bottom: 1px solid #ffffff;}strong {  font-weight: bold;}em {  font-style: italic;}.muted {  color: #999999;}abbr[title] {  cursor: help;  border-bottom: 1px dotted #999999;}abbr.initialism {  font-size: 90%;  text-transform: uppercase;}blockquote {  padding: 0 0 0 15px;  margin: 0 0 18px;  border-left: 5px solid #eeeeee;}blockquote p {  margin-bottom: 0;  font-size: 16px;  font-weight: 300;  line-height: 22.5px;}blockquote small {  display: block;  line-height: 18px;  color: #999999;}blockquote small:before {  content: '\2014 \00A0';}blockquote.pull-right {  float: right;  padding-right: 15px;  padding-left: 0;  border-right: 5px solid #eeeeee;  border-left: 0;}blockquote.pull-right p,blockquote.pull-right small {  text-align: right;}q:before,q:after,blockquote:before,blockquote:after {  content: "";}address {  display: block;  margin-bottom: 18px;  font-style: normal;  line-height: 18px;}small {  font-size: 100%;}cite {  font-style: normal;}code,pre {  padding: 0 3px 2px;  font-family: Menlo, Monaco, Consolas, "Courier New", monospace;  font-size: 12px;  color: #333333;  -webkit-border-radius: 3px;  -moz-border-radius: 3px;  border-radius: 3px;}code {  padding: 2px 4px;  color: #d14;  background-color: #f7f7f9;  border: 1px solid #e1e1e8;}pre {  display: block;  padding: 8.5px;  margin: 0 0 9px;  font-size: 12.025px;  line-height: 18px;  word-break: break-all;  word-wrap: break-word;  white-space: pre;  white-space: pre-wrap;  background-color: #f5f5f5;  border: 1px solid #ccc;  border: 1px solid rgba(0, 0, 0, 0.15);  -webkit-border-radius: 4px;  -moz-border-radius: 4px;  border-radius: 4px;}pre.prettyprint {  margin-bottom: 18px;}pre code {  padding: 0;  color: inherit;  background-color: transparent;  border: 0;}.pre-scrollable {  max-height: 340px;  overflow-y: scroll;}.label,.badge {  font-size: 10.998px;  font-weight: bold;  line-height: 14px;  color: #ffffff;  vertical-align: baseline;  white-space: nowrap;  text-shadow: 0 -1px 0 rgba(0, 0, 0, 0.25);  background-color: #999999;}.label {  padding: 1px 4px 2px;  -webkit-border-radius: 3px;  -moz-border-radius: 3px;  border-radius: 3px;}.badge {  padding: 1px 9px 2px;  -webkit-border-radius: 9px;  -moz-border-radius: 9px;  border-radius: 9px;}a.label:hover,a.badge:hover {  color: #ffffff;  text-decoration: none;  cursor: pointer;}.label-important,.badge-important {  background-color: #b94a48;}.label-important[href],.badge-important[href] {  background-color: #953b39;}.label-warning,.badge-warning {  background-color: #f89406;}.label-warning[href],.badge-warning[href] {  background-color: #c67605;}.label-success,.badge-success {  background-color: #468847;}.label-success[href],.badge-success[href] {  background-color: #356635;}.label-info,.badge-info {  background-color: #3a87ad;}.label-info[href],.badge-info[href] {  background-color: #2d6987;}.label-inverse,.badge-inverse {  background-color: #333333;}.label-inverse[href],.badge-inverse[href] {  background-color: #1a1a1a;}table {  max-width: 100%;  background-color: transparent;  border-collapse: collapse;  border-spacing: 0;}.table {  width: 100%;  margin-bottom: 18px;}.table th,.table td {  padding: 8px;  line-height: 18px;  text-align: left;  vertical-align: top;  border-top: 1px solid #dddddd;}.table th {  font-weight: bold;}.table thead th {  vertical-align: bottom;}.table caption + thead tr:first-child th,.table caption + thead tr:first-child td,.table colgroup + thead tr:first-child th,.table colgroup + thead tr:first-child td,.table thead:first-child tr:first-child th,.table thead:first-child tr:first-child td {  border-top: 0;}.table tbody + tbody {  border-top: 2px solid #dddddd;}.table-condensed th,.table-condensed td {  padding: 4px 5px;}.table-bordered {  border: 1px solid #dddddd;  border-collapse: separate;  *border-collapse: collapsed;  border-left: 0;  -webkit-border-radius: 4px;  -moz-border-radius: 4px;  border-radius: 4px;}.table-bordered th,.table-bordered td {  border-left: 1px solid #dddddd;}.table-bordered caption + thead tr:first-child th,.table-bordered caption + tbody tr:first-child th,.table-bordered caption + tbody tr:first-child td,.table-bordered colgroup + thead tr:first-child th,.table-bordered colgroup + tbody tr:first-child th,.table-bordered colgroup + tbody tr:first-child td,.table-bordered thead:first-child tr:first-child th,.table-bordered tbody:first-child tr:first-child th,.table-bordered tbody:first-child tr:first-child td {  border-top: 0;}.table-bordered thead:first-child tr:first-child th:first-child,.table-bordered tbody:first-child tr:first-child td:first-child {  -webkit-border-top-left-radius: 4px;  border-top-left-radius: 4px;  -moz-border-radius-topleft: 4px;}.table-bordered thead:first-child tr:first-child th:last-child,.table-bordered tbody:first-child tr:first-child td:last-child {  -webkit-border-top-right-radius: 4px;  border-top-right-radius: 4px;  -moz-border-radius-topright: 4px;}.table-bordered thead:last-child tr:last-child th:first-child,.table-bordered tbody:last-child tr:last-child td:first-child {  -webkit-border-radius: 0 0 0 4px;  -moz-border-radius: 0 0 0 4px;  border-radius: 0 0 0 4px;  -webkit-border-bottom-left-radius: 4px;  border-bottom-left-radius: 4px;  -moz-border-radius-bottomleft: 4px;}.table-bordered thead:last-child tr:last-child th:last-child,.table-bordered tbody:last-child tr:last-child td:last-child {  -webkit-border-bottom-right-radius: 4px;  border-bottom-right-radius: 4px;  -moz-border-radius-bottomright: 4px;}.table-striped tbody tr:nth-child(odd) td,.table-striped tbody tr:nth-child(odd) th {  background-color: #f9f9f9;}.table tbody tr:hover td,.table tbody tr:hover th {  background-color: #f5f5f5;}table .span1 {  float: none;  width: 44px;  margin-left: 0;}table .span2 {  float: none;  width: 124px;  margin-left: 0;}table .span3 {  float: none;  width: 204px;  margin-left: 0;}table .span4 {  float: none;  width: 284px;  margin-left: 0;}table .span5 {  float: none;  width: 364px;  margin-left: 0;}table .span6 {  float: none;  width: 444px;  margin-left: 0;}table .span7 {  float: none;  width: 524px;  margin-left: 0;}table .span8 {  float: none;  width: 604px;  margin-left: 0;}table .span9 {  float: none;  width: 684px;  margin-left: 0;}table .span10 {  float: none;  width: 764px;  margin-left: 0;}table .span11 {  float: none;  width: 844px;  margin-left: 0;}table .span12 {  float: none;  width: 924px;  margin-left: 0;}table .span13 {  float: none;  width: 1004px;  margin-left: 0;}table .span14 {  float: none;  width: 1084px;  margin-left: 0;}table .span15 {  float: none;  width: 1164px;  margin-left: 0;}table .span16 {  float: none;  width: 1244px;  margin-left: 0;}table .span17 {  float: none;  width: 1324px;  margin-left: 0;}table .span18 {  float: none;  width: 1404px;  margin-left: 0;}table .span19 {  float: none;  width: 1484px;  margin-left: 0;}table .span20 {  float: none;  width: 1564px;  margin-left: 0;}table .span21 {  float: none;  width: 1644px;  margin-left: 0;}table .span22 {  float: none;  width: 1724px;  margin-left: 0;}table .span23 {  float: none;  width: 1804px;  margin-left: 0;}table .span24 {  float: none;  width: 1884px;  margin-left: 0;}form {  margin: 0 0 18px;}fieldset {  padding: 0;  margin: 0;  border: 0;}legend {  display: block;  width: 100%;  padding: 0;  margin-bottom: 27px;  font-size: 19.5px;  line-height: 36px;  color: #333333;  border: 0;  border-bottom: 1px solid #e5e5e5;}legend small {  font-size: 13.5px;  color: #999999;}.control-group .controls {    label,    input,    button,    select,    textarea {      font-size: 13px;      font-weight: normal;      line-height: 18px;    }}.control-group .controls {    input,    button,    select,    textarea {      font-family: "Helvetica Neue", Helvetica, Arial, sans-serif;    }}label {  display: block;  margin-bottom: 5px;}.control-group .controls {    select,    textarea,    input[type="text"],    input[type="password"],    input[type="datetime"],    input[type="datetime-local"],    input[type="date"],    input[type="month"],    input[type="time"],    input[type="week"],    input[type="number"],    input[type="email"],    input[type="url"],    input[type="search"],    input[type="tel"],    input[type="color"],    .uneditable-input {      display: inline-block;      height: 18px;      padding: 4px;      margin-bottom: 9px;      font-size: 13px;      line-height: 18px;      color: #555555;    }}.control-group .controls {    input,    textarea {      width: 210px;    }}.control-group .controls {    textarea {      height: auto;    }}.control-group .controls {    textarea,    input[type="text"],    input[type="password"],    input[type="datetime"],    input[type="datetime-local"],    input[type="date"],    input[type="month"],    input[type="time"],    input[type="week"],    input[type="number"],    input[type="email"],    input[type="url"],    input[type="search"],    input[type="tel"],    input[type="color"],    .uneditable-input {      background-color: #ffffff;      border: 1px solid #cccccc;      -webkit-border-radius: 3px;      -moz-border-radius: 3px;      border-radius: 3px;      -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075);      -moz-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075);      box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075);      -webkit-transition: border linear 0.2s, box-shadow linear 0.2s;      -moz-transition: border linear 0.2s, box-shadow linear 0.2s;      -ms-transition: border linear 0.2s, box-shadow linear 0.2s;      -o-transition: border linear 0.2s, box-shadow linear 0.2s;      transition: border linear 0.2s, box-shadow linear 0.2s;    }}.control-group .controls {    textarea:focus,    input[type="text"]:focus,    input[type="password"]:focus,    input[type="datetime"]:focus,    input[type="datetime-local"]:focus,    input[type="date"]:focus,    input[type="month"]:focus,    input[type="time"]:focus,    input[type="week"]:focus,    input[type="number"]:focus,    input[type="email"]:focus,    input[type="url"]:focus,    input[type="search"]:focus,    input[type="tel"]:focus,    input[type="color"]:focus,    .uneditable-input:focus {      border-color: rgba(82, 168, 236, 0.8);      outline: 0;      outline: thin dotted \9;      /* IE6-9 */      -webkit-box-shadow: inset 0 1px 1px rgba(0,0,0,.075), 0 0 8px rgba(82,168,236,.6);      -moz-box-shadow: inset 0 1px 1px rgba(0,0,0,.075), 0 0 8px rgba(82,168,236,.6);      box-shadow: inset 0 1px 1px rgba(0,0,0,.075), 0 0 8px rgba(82,168,236,.6);    }}.control-group .controls {    input[type="radio"],    input[type="checkbox"] {      margin: 3px 0;      *margin-top: 0;      /* IE7 */      line-height: normal;      cursor: pointer;    }}.control-group .controls {    input[type="submit"],    input[type="reset"],    input[type="button"],    input[type="radio"],    input[type="checkbox"] {      width: auto;    }}.uneditable-textarea {  width: auto;  height: auto;}.control-group .controls {    select,    input[type="file"] {      height: 28px;      /* In IE7, the height of the select element cannot be changed by height, only font-size */      *margin-top: 4px;      /* For IE7, add top margin to align select with labels */      line-height: 28px;    }}.control-group .controls {    select {      width: 220px;      border: 1px solid #bbb;    }}.control-group .controls {    select[multiple],    select[size] {      height: auto;    }}.control-group .controls {    select:focus,    input[type="file"]:focus,    input[type="radio"]:focus,    input[type="checkbox"]:focus {      outline: thin dotted #333;      outline: 5px auto -webkit-focus-ring-color;      outline-offset: -2px;    }}.radio,.checkbox {  min-height: 18px;  padding-left: 18px;}.radio input[type="radio"],.checkbox input[type="checkbox"] {  float: left;  margin-left: -18px;}.controls > .radio:first-child,.controls > .checkbox:first-child {  padding-top: 5px;}.radio.inline,.checkbox.inline {  display: inline-block;  padding-top: 5px;  margin-bottom: 0;  vertical-align: middle;}.radio.inline + .radio.inline,.checkbox.inline + .checkbox.inline {  margin-left: 10px;}.control-group .controls {    .input-mini {      width: 60px;    }}.control-group .controls {    .input-small {      width: 90px;    }}.control-group .controls {    .input-medium {      width: 150px;    }}.control-group .controls {    .input-large {      width: 210px;    }}.input-xlarge {    .input-xlarge {      width: 270px;    }}.input-xxlarge {    .input-xxlarge {      width: 530px;    }}.control-group .controls {    input[class*="span"],    select[class*="span"],    textarea[class*="span"],    .uneditable-input[class*="span"],    .row-fluid input[class*="span"],    .row-fluid select[class*="span"],    .row-fluid textarea[class*="span"],    .row-fluid .uneditable-input[class*="span"] {      float: none;      margin-left: 0;    }}.input-append input[class*="span"],.input-append .uneditable-input[class*="span"],.input-prepend input[class*="span"],.input-prepend .uneditable-input[class*="span"],.row-fluid .input-prepend [class*="span"],.row-fluid .input-append [class*="span"] {  display: inline-block;}.control-group .controls {    input,    textarea,    .uneditable-input {      margin-left: 0;    }}input.span12, textarea.span12, .uneditable-input.span12 {  width: 930px;}input.span11, textarea.span11, .uneditable-input.span11 {  width: 850px;}input.span10, textarea.span10, .uneditable-input.span10 {  width: 770px;}input.span9, textarea.span9, .uneditable-input.span9 {  width: 690px;}input.span8, textarea.span8, .uneditable-input.span8 {  width: 610px;}input.span7, textarea.span7, .uneditable-input.span7 {  width: 530px;}input.span6, textarea.span6, .uneditable-input.span6 {  width: 450px;}input.span5, textarea.span5, .uneditable-input.span5 {  width: 370px;}input.span4, textarea.span4, .uneditable-input.span4 {  width: 290px;}input.span3, textarea.span3, .uneditable-input.span3 {  width: 210px;}input.span2, textarea.span2, .uneditable-input.span2 {  width: 130px;}input.span1, textarea.span1, .uneditable-input.span1 {  width: 50px;}input[disabled],select[disabled],textarea[disabled],input[readonly],select[readonly],textarea[readonly] {  cursor: not-allowed;  background-color: #eeeeee;  border-color: #ddd;}input[type="radio"][disabled],input[type="checkbox"][disabled],input[type="radio"][readonly],input[type="checkbox"][readonly] {  background-color: transparent;}.control-group.warning > label,.control-group.warning .help-block,.control-group.warning .help-inline {  color: #c09853;}.control-group.warning .checkbox,.control-group.warning .radio,.control-group.warning input,.control-group.warning select,.control-group.warning textarea {  color: #c09853;  border-color: #c09853;}.control-group.warning .checkbox:focus,.control-group.warning .radio:focus,.control-group.warning input:focus,.control-group.warning select:focus,.control-group.warning textarea:focus {  border-color: #a47e3c;  -webkit-box-shadow: 0 0 6px #dbc59e;  -moz-box-shadow: 0 0 6px #dbc59e;  box-shadow: 0 0 6px #dbc59e;}.control-group.warning .input-prepend .add-on,.control-group.warning .input-append .add-on {  color: #c09853;  background-color: #fcf8e3;  border-color: #c09853;}.control-group.error > label,.control-group.error .help-block,.control-group.error .help-inline {  color: #b94a48;}.control-group.error .checkbox,.control-group.error .radio,.control-group.error input,.control-group.error select,.control-group.error textarea {  color: #b94a48;  border-color: #b94a48;}.control-group.error .checkbox:focus,.control-group.error .radio:focus,.control-group.error input:focus,.control-group.error select:focus,.control-group.error textarea:focus {  border-color: #953b39;  -webkit-box-shadow: 0 0 6px #d59392;  -moz-box-shadow: 0 0 6px #d59392;  box-shadow: 0 0 6px #d59392;}.control-group.error .input-prepend .add-on,.control-group.error .input-append .add-on {  color: #b94a48;  background-color: #f2dede;  border-color: #b94a48;}.control-group.success > label,.control-group.success .help-block,.control-group.success .help-inline {  color: #468847;}.control-group.success .checkbox,.control-group.success .radio,.control-group.success input,.control-group.success select,.control-group.success textarea {  color: #468847;  border-color: #468847;}.control-group.success .checkbox:focus,.control-group.success .radio:focus,.control-group.success input:focus,.control-group.success select:focus,.control-group.success textarea:focus {  border-color: #356635;  -webkit-box-shadow: 0 0 6px #7aba7b;  -moz-box-shadow: 0 0 6px #7aba7b;  box-shadow: 0 0 6px #7aba7b;}.control-group.success .input-prepend .add-on,.control-group.success .input-append .add-on {  color: #468847;  background-color: #dff0d8;  border-color: #468847;}input:focus:required:invalid,textarea:focus:required:invalid,select:focus:required:invalid {  color: #b94a48;  border-color: #ee5f5b;}input:focus:required:invalid:focus,textarea:focus:required:invalid:focus,select:focus:required:invalid:focus {  border-color: #e9322d;  -webkit-box-shadow: 0 0 6px #f8b9b7;  -moz-box-shadow: 0 0 6px #f8b9b7;  box-shadow: 0 0 6px #f8b9b7;}.form-actions {  padding: 17px 20px 18px;  margin-top: 18px;  margin-bottom: 18px;  background-color: #f5f5f5;  border-top: 1px solid #e5e5e5;  *zoom: 1;}.form-actions:before,.form-actions:after {  display: table;  content: "";}.form-actions:after {  clear: both;}.uneditable-input {  overflow: hidden;  white-space: nowrap;  cursor: not-allowed;  background-color: #ffffff;  border-color: #eee;  -webkit-box-shadow: inset 0 1px 2px rgba(0, 0, 0, 0.025);  -moz-box-shadow: inset 0 1px 2px rgba(0, 0, 0, 0.025);  box-shadow: inset 0 1px 2px rgba(0, 0, 0, 0.025);}:-moz-placeholder {  color: #999999;}:-ms-input-placeholder {  color: #999999;}::-webkit-input-placeholder {  color: #999999;}.help-block,.help-inline {  color: #555555;}.help-block {  display: block;  margin-bottom: 9px;}.help-inline {  display: inline-block;  *display: inline;  /* IE7 inline-block hack */  *zoom: 1;  vertical-align: middle;  padding-left: 5px;}.input-prepend,.input-append {  margin-bottom: 5px;}.input-prepend input,.input-append input,.input-prepend select,.input-append select,.input-prepend .uneditable-input,.input-append .uneditable-input {  position: relative;  margin-bottom: 0;  *margin-left: 0;  vertical-align: middle;  -webkit-border-radius: 0 3px 3px 0;  -moz-border-radius: 0 3px 3px 0;  border-radius: 0 3px 3px 0;}.input-prepend input:focus,.input-append input:focus,.input-prepend select:focus,.input-append select:focus,.input-prepend .uneditable-input:focus,.input-append .uneditable-input:focus {  z-index: 2;}.input-prepend .uneditable-input,.input-append .uneditable-input {  border-left-color: #ccc;}.input-prepend .add-on,.input-append .add-on {  display: inline-block;  width: auto;  height: 18px;  min-width: 16px;  padding: 4px 5px;  font-weight: normal;  line-height: 18px;  text-align: center;  text-shadow: 0 1px 0 #ffffff;  vertical-align: middle;  background-color: #eeeeee;  border: 1px solid #ccc;}.input-prepend .add-on,.input-append .add-on,.input-prepend .btn,.input-append .btn {  margin-left: -1px;  -webkit-border-radius: 0;  -moz-border-radius: 0;  border-radius: 0;}.input-prepend .active,.input-append .active {  background-color: #a9dba9;  border-color: #46a546;}.input-prepend .add-on,.input-prepend .btn {  margin-right: -1px;}.input-prepend .add-on:first-child,.input-prepend .btn:first-child {  -webkit-border-radius: 3px 0 0 3px;  -moz-border-radius: 3px 0 0 3px;  border-radius: 3px 0 0 3px;}.input-append input,.input-append select,.input-append .uneditable-input {  -webkit-border-radius: 3px 0 0 3px;  -moz-border-radius: 3px 0 0 3px;  border-radius: 3px 0 0 3px;}.input-append .uneditable-input {  border-right-color: #ccc;  border-left-color: #eee;}.input-append .add-on:last-child,.input-append .btn:last-child {  -webkit-border-radius: 0 3px 3px 0;  -moz-border-radius: 0 3px 3px 0;  border-radius: 0 3px 3px 0;}.input-prepend.input-append input,.input-prepend.input-append select,.input-prepend.input-append .uneditable-input {  -webkit-border-radius: 0;  -moz-border-radius: 0;  border-radius: 0;}.input-prepend.input-append .add-on:first-child,.input-prepend.input-append .btn:first-child {  margin-right: -1px;  -webkit-border-radius: 3px 0 0 3px;  -moz-border-radius: 3px 0 0 3px;  border-radius: 3px 0 0 3px;}.input-prepend.input-append .add-on:last-child,.input-prepend.input-append .btn:last-child {  margin-left: -1px;  -webkit-border-radius: 0 3px 3px 0;  -moz-border-radius: 0 3px 3px 0;  border-radius: 0 3px 3px 0;}.search-query {  padding-right: 14px;  padding-right: 4px \9;  padding-left: 14px;  padding-left: 4px \9;  /* IE7-8 doesn't have border-radius, so don't indent the padding */  margin-bottom: 0;  -webkit-border-radius: 14px;  -moz-border-radius: 14px;  border-radius: 14px;}.form-search input,.form-inline input,.form-horizontal input,.form-search textarea,.form-inline textarea,.form-horizontal textarea,.form-search select,.form-inline select,.form-horizontal select,.form-search .help-inline,.form-inline .help-inline,.form-horizontal .help-inline,.form-search .uneditable-input,.form-inline .uneditable-input,.form-horizontal .uneditable-input,.form-search .input-prepend,.form-inline .input-prepend,.form-horizontal .input-prepend,.form-search .input-append,.form-inline .input-append,.form-horizontal .input-append {  display: inline-block;  *display: inline;  /* IE7 inline-block hack */  *zoom: 1;  margin-bottom: 0;}.form-search .hide,.form-inline .hide,.form-horizontal .hide {  display: none;}.form-search label,.form-inline label {  display: inline-block;}.form-search .input-append,.form-inline .input-append,.form-search .input-prepend,.form-inline .input-prepend {  margin-bottom: 0;}.form-search .radio,.form-search .checkbox,.form-inline .radio,.form-inline .checkbox {  padding-left: 0;  margin-bottom: 0;  vertical-align: middle;}.form-search .radio input[type="radio"],.form-search .checkbox input[type="checkbox"],.form-inline .radio input[type="radio"],.form-inline .checkbox input[type="checkbox"] {  float: left;  margin-right: 3px;  margin-left: 0;}.control-group {  margin-bottom: 9px;}legend + .control-group {  margin-top: 18px;  -webkit-margin-top-collapse: separate;}.form-horizontal .control-group {  margin-bottom: 18px;  *zoom: 1;}.form-horizontal .control-group:before,.form-horizontal .control-group:after {  display: table;  content: "";}.form-horizontal .control-group:after {  clear: both;}.form-horizontal .control-label {  float: left;  width: 140px;  padding-top: 5px;  text-align: right;}.form-horizontal .controls {  *display: inline-block;  *padding-left: 20px;  margin-left: 160px;  *margin-left: 0;}.form-horizontal .controls:first-child {  *padding-left: 160px;}.form-horizontal .help-block {  margin-top: 9px;  margin-bottom: 0;}.form-horizontal .form-actions {  padding-left: 160px;}.btn {  display: inline-block;  *display: inline;  /* IE7 inline-block hack */  *zoom: 1;  padding: 4px 10px 4px;  margin-bottom: 0;  font-size: 13px;  line-height: 18px;  *line-height: 20px;  color: #333333;  text-align: center;  text-shadow: 0 1px 1px rgba(255, 255, 255, 0.75);  vertical-align: middle;  cursor: pointer;  background-color: #f5f5f5;  background-image: -moz-linear-gradient(top, #ffffff, #e6e6e6);  background-image: -ms-linear-gradient(top, #ffffff, #e6e6e6);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#ffffff), to(#e6e6e6));  background-image: -webkit-linear-gradient(top, #ffffff, #e6e6e6);  background-image: -o-linear-gradient(top, #ffffff, #e6e6e6);  background-image: linear-gradient(top, #ffffff, #e6e6e6);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#ffffff', endColorstr='#e6e6e6', GradientType=0);  border-color: #e6e6e6 #e6e6e6 #bfbfbf;  border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25);  *background-color: #e6e6e6;  /* Darken IE7 buttons by default so they stand out more given they won't have borders */  filter: progid:DXImageTransform.Microsoft.gradient(enabled = false);  border: 1px solid #cccccc;  *border: 0;  border-bottom-color: #b3b3b3;  -webkit-border-radius: 4px;  -moz-border-radius: 4px;  border-radius: 4px;  *margin-left: .3em;  -webkit-box-shadow: inset 0 1px 0 rgba(255,255,255,.2), 0 1px 2px rgba(0,0,0,.05);  -moz-box-shadow: inset 0 1px 0 rgba(255,255,255,.2), 0 1px 2px rgba(0,0,0,.05);  box-shadow: inset 0 1px 0 rgba(255,255,255,.2), 0 1px 2px rgba(0,0,0,.05);}.btn:hover,.btn:active,.btn.active,.btn.disabled,.btn[disabled] {  background-color: #e6e6e6;  *background-color: #d9d9d9;}.btn:active,.btn.active {  background-color: #cccccc \9;}.btn:first-child {  *margin-left: 0;}.btn:hover {  color: #333333;  text-decoration: none;  background-color: #e6e6e6;  *background-color: #d9d9d9;  /* Buttons in IE7 don't get borders, so darken on hover */  background-position: 0 -15px;  -webkit-transition: background-position 0.1s linear;  -moz-transition: background-position 0.1s linear;  -ms-transition: background-position 0.1s linear;  -o-transition: background-position 0.1s linear;  transition: background-position 0.1s linear;}.btn:focus {  outline: thin dotted #333;  outline: 5px auto -webkit-focus-ring-color;  outline-offset: -2px;}.btn.active,.btn:active {  background-color: #e6e6e6;  background-color: #d9d9d9 \9;  background-image: none;  outline: 0;  -webkit-box-shadow: inset 0 2px 4px rgba(0,0,0,.15), 0 1px 2px rgba(0,0,0,.05);  -moz-box-shadow: inset 0 2px 4px rgba(0,0,0,.15), 0 1px 2px rgba(0,0,0,.05);  box-shadow: inset 0 2px 4px rgba(0,0,0,.15), 0 1px 2px rgba(0,0,0,.05);}.btn.disabled,.btn[disabled] {  cursor: default;  background-color: #e6e6e6;  background-image: none;  opacity: 0.65;  filter: alpha(opacity=65);  -webkit-box-shadow: none;  -moz-box-shadow: none;  box-shadow: none;}.btn-large {  padding: 9px 14px;  font-size: 15px;  line-height: normal;  -webkit-border-radius: 5px;  -moz-border-radius: 5px;  border-radius: 5px;}.btn-large [class^="icon-"] {  margin-top: 1px;}.btn-small {  padding: 5px 9px;  font-size: 11px;  line-height: 16px;}.btn-small [class^="icon-"] {  margin-top: -1px;}.btn-mini {  padding: 2px 6px;  font-size: 11px;  line-height: 14px;}.btn-primary,.btn-primary:hover,.btn-warning,.btn-warning:hover,.btn-danger,.btn-danger:hover,.btn-success,.btn-success:hover,.btn-info,.btn-info:hover,.btn-inverse,.btn-inverse:hover {  color: #ffffff;  text-shadow: 0 -1px 0 rgba(0, 0, 0, 0.25);}.btn-primary.active,.btn-warning.active,.btn-danger.active,.btn-success.active,.btn-info.active,.btn-inverse.active {  color: rgba(255, 255, 255, 0.75);}.btn {  border-color: #ccc;  border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25);}.btn-primary {  background-color: #0074cc;  background-image: -moz-linear-gradient(top, #0088cc, #0055cc);  background-image: -ms-linear-gradient(top, #0088cc, #0055cc);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#0088cc), to(#0055cc));  background-image: -webkit-linear-gradient(top, #0088cc, #0055cc);  background-image: -o-linear-gradient(top, #0088cc, #0055cc);  background-image: linear-gradient(top, #0088cc, #0055cc);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#0088cc', endColorstr='#0055cc', GradientType=0);  border-color: #0055cc #0055cc #003580;  border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25);  *background-color: #0055cc;  /* Darken IE7 buttons by default so they stand out more given they won't have borders */  filter: progid:DXImageTransform.Microsoft.gradient(enabled = false);}.btn-primary:hover,.btn-primary:active,.btn-primary.active,.btn-primary.disabled,.btn-primary[disabled] {  background-color: #0055cc;  *background-color: #004ab3;}.btn-primary:active,.btn-primary.active {  background-color: #004099 \9;}.btn-warning {  background-color: #faa732;  background-image: -moz-linear-gradient(top, #fbb450, #f89406);  background-image: -ms-linear-gradient(top, #fbb450, #f89406);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#fbb450), to(#f89406));  background-image: -webkit-linear-gradient(top, #fbb450, #f89406);  background-image: -o-linear-gradient(top, #fbb450, #f89406);  background-image: linear-gradient(top, #fbb450, #f89406);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#fbb450', endColorstr='#f89406', GradientType=0);  border-color: #f89406 #f89406 #ad6704;  border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25);  *background-color: #f89406;  /* Darken IE7 buttons by default so they stand out more given they won't have borders */  filter: progid:DXImageTransform.Microsoft.gradient(enabled = false);}.btn-warning:hover,.btn-warning:active,.btn-warning.active,.btn-warning.disabled,.btn-warning[disabled] {  background-color: #f89406;  *background-color: #df8505;}.btn-warning:active,.btn-warning.active {  background-color: #c67605 \9;}.btn-danger {  background-color: #da4f49;  background-image: -moz-linear-gradient(top, #ee5f5b, #bd362f);  background-image: -ms-linear-gradient(top, #ee5f5b, #bd362f);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#ee5f5b), to(#bd362f));  background-image: -webkit-linear-gradient(top, #ee5f5b, #bd362f);  background-image: -o-linear-gradient(top, #ee5f5b, #bd362f);  background-image: linear-gradient(top, #ee5f5b, #bd362f);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#ee5f5b', endColorstr='#bd362f', GradientType=0);  border-color: #bd362f #bd362f #802420;  border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25);  *background-color: #bd362f;  /* Darken IE7 buttons by default so they stand out more given they won't have borders */  filter: progid:DXImageTransform.Microsoft.gradient(enabled = false);}.btn-danger:hover,.btn-danger:active,.btn-danger.active,.btn-danger.disabled,.btn-danger[disabled] {  background-color: #bd362f;  *background-color: #a9302a;}.btn-danger:active,.btn-danger.active {  background-color: #942a25 \9;}.btn-success {  background-color: #5bb75b;  background-image: -moz-linear-gradient(top, #62c462, #51a351);  background-image: -ms-linear-gradient(top, #62c462, #51a351);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#62c462), to(#51a351));  background-image: -webkit-linear-gradient(top, #62c462, #51a351);  background-image: -o-linear-gradient(top, #62c462, #51a351);  background-image: linear-gradient(top, #62c462, #51a351);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#62c462', endColorstr='#51a351', GradientType=0);  border-color: #51a351 #51a351 #387038;  border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25);  *background-color: #51a351;  /* Darken IE7 buttons by default so they stand out more given they won't have borders */  filter: progid:DXImageTransform.Microsoft.gradient(enabled = false);}.btn-success:hover,.btn-success:active,.btn-success.active,.btn-success.disabled,.btn-success[disabled] {  background-color: #51a351;  *background-color: #499249;}.btn-success:active,.btn-success.active {  background-color: #408140 \9;}.btn-info {  background-color: #49afcd;  background-image: -moz-linear-gradient(top, #5bc0de, #2f96b4);  background-image: -ms-linear-gradient(top, #5bc0de, #2f96b4);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#5bc0de), to(#2f96b4));  background-image: -webkit-linear-gradient(top, #5bc0de, #2f96b4);  background-image: -o-linear-gradient(top, #5bc0de, #2f96b4);  background-image: linear-gradient(top, #5bc0de, #2f96b4);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#5bc0de', endColorstr='#2f96b4', GradientType=0);  border-color: #2f96b4 #2f96b4 #1f6377;  border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25);  *background-color: #2f96b4;  /* Darken IE7 buttons by default so they stand out more given they won't have borders */  filter: progid:DXImageTransform.Microsoft.gradient(enabled = false);}.btn-info:hover,.btn-info:active,.btn-info.active,.btn-info.disabled,.btn-info[disabled] {  background-color: #2f96b4;  *background-color: #2a85a0;}.btn-info:active,.btn-info.active {  background-color: #24748c \9;}.btn-inverse {  background-color: #414141;  background-image: -moz-linear-gradient(top, #555555, #222222);  background-image: -ms-linear-gradient(top, #555555, #222222);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#555555), to(#222222));  background-image: -webkit-linear-gradient(top, #555555, #222222);  background-image: -o-linear-gradient(top, #555555, #222222);  background-image: linear-gradient(top, #555555, #222222);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#555555', endColorstr='#222222', GradientType=0);  border-color: #222222 #222222 #000000;  border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25);  *background-color: #222222;  /* Darken IE7 buttons by default so they stand out more given they won't have borders */  filter: progid:DXImageTransform.Microsoft.gradient(enabled = false);}.btn-inverse:hover,.btn-inverse:active,.btn-inverse.active,.btn-inverse.disabled,.btn-inverse[disabled] {  background-color: #222222;  *background-color: #151515;}.btn-inverse:active,.btn-inverse.active {  background-color: #080808 \9;}button.btn,input[type="submit"].btn {  *padding-top: 2px;  *padding-bottom: 2px;}button.btn::-moz-focus-inner,input[type="submit"].btn::-moz-focus-inner {  padding: 0;  border: 0;}button.btn.btn-large,input[type="submit"].btn.btn-large {  *padding-top: 7px;  *padding-bottom: 7px;}button.btn.btn-small,input[type="submit"].btn.btn-small {  *padding-top: 3px;  *padding-bottom: 3px;}button.btn.btn-mini,input[type="submit"].btn.btn-mini {  *padding-top: 1px;  *padding-bottom: 1px;}.btn-group {  position: relative;  *zoom: 1;  *margin-left: .3em;}.btn-group:before,.btn-group:after {  display: table;  content: "";}.btn-group:after {  clear: both;}.btn-group:first-child {  *margin-left: 0;}.btn-group + .btn-group {  margin-left: 5px;}.btn-toolbar {  margin-top: 9px;  margin-bottom: 9px;}.btn-toolbar .btn-group {  display: inline-block;  *display: inline;  /* IE7 inline-block hack */  *zoom: 1;}.btn-group > .btn {  position: relative;  float: left;  margin-left: -1px;  -webkit-border-radius: 0;  -moz-border-radius: 0;  border-radius: 0;}.btn-group > .btn:first-child {  margin-left: 0;  -webkit-border-top-left-radius: 4px;  -moz-border-radius-topleft: 4px;  border-top-left-radius: 4px;  -webkit-border-bottom-left-radius: 4px;  -moz-border-radius-bottomleft: 4px;  border-bottom-left-radius: 4px;}.btn-group > .btn:last-child,.btn-group > .dropdown-toggle {  -webkit-border-top-right-radius: 4px;  -moz-border-radius-topright: 4px;  border-top-right-radius: 4px;  -webkit-border-bottom-right-radius: 4px;  -moz-border-radius-bottomright: 4px;  border-bottom-right-radius: 4px;}.btn-group > .btn.large:first-child {  margin-left: 0;  -webkit-border-top-left-radius: 6px;  -moz-border-radius-topleft: 6px;  border-top-left-radius: 6px;  -webkit-border-bottom-left-radius: 6px;  -moz-border-radius-bottomleft: 6px;  border-bottom-left-radius: 6px;}.btn-group > .btn.large:last-child,.btn-group > .large.dropdown-toggle {  -webkit-border-top-right-radius: 6px;  -moz-border-radius-topright: 6px;  border-top-right-radius: 6px;  -webkit-border-bottom-right-radius: 6px;  -moz-border-radius-bottomright: 6px;  border-bottom-right-radius: 6px;}.btn-group > .btn:hover,.btn-group > .btn:focus,.btn-group > .btn:active,.btn-group > .btn.active {  z-index: 2;}.btn-group .dropdown-toggle:active,.btn-group.open .dropdown-toggle {  outline: 0;}.btn-group > .dropdown-toggle {  padding-left: 8px;  padding-right: 8px;  -webkit-box-shadow: inset 1px 0 0 rgba(255,255,255,.125), inset 0 1px 0 rgba(255,255,255,.2), 0 1px 2px rgba(0,0,0,.05);  -moz-box-shadow: inset 1px 0 0 rgba(255,255,255,.125), inset 0 1px 0 rgba(255,255,255,.2), 0 1px 2px rgba(0,0,0,.05);  box-shadow: inset 1px 0 0 rgba(255,255,255,.125), inset 0 1px 0 rgba(255,255,255,.2), 0 1px 2px rgba(0,0,0,.05);  *padding-top: 4px;  *padding-bottom: 4px;}.btn-group > .btn-mini.dropdown-toggle {  padding-left: 5px;  padding-right: 5px;}.btn-group > .btn-small.dropdown-toggle {  *padding-top: 4px;  *padding-bottom: 4px;}.btn-group > .btn-large.dropdown-toggle {  padding-left: 12px;  padding-right: 12px;}.btn-group.open .dropdown-toggle {  background-image: none;  -webkit-box-shadow: inset 0 2px 4px rgba(0,0,0,.15), 0 1px 2px rgba(0,0,0,.05);  -moz-box-shadow: inset 0 2px 4px rgba(0,0,0,.15), 0 1px 2px rgba(0,0,0,.05);  box-shadow: inset 0 2px 4px rgba(0,0,0,.15), 0 1px 2px rgba(0,0,0,.05);}.btn-group.open .btn.dropdown-toggle {  background-color: #e6e6e6;}.btn-group.open .btn-primary.dropdown-toggle {  background-color: #0055cc;}.btn-group.open .btn-warning.dropdown-toggle {  background-color: #f89406;}.btn-group.open .btn-danger.dropdown-toggle {  background-color: #bd362f;}.btn-group.open .btn-success.dropdown-toggle {  background-color: #51a351;}.btn-group.open .btn-info.dropdown-toggle {  background-color: #2f96b4;}.btn-group.open .btn-inverse.dropdown-toggle {  background-color: #222222;}.btn .caret {  margin-top: 7px;  margin-left: 0;}.btn:hover .caret,.open.btn-group .caret {  opacity: 1;  filter: alpha(opacity=100);}.btn-mini .caret {  margin-top: 5px;}.btn-small .caret {  margin-top: 6px;}.btn-large .caret {  margin-top: 6px;  border-left-width: 5px;  border-right-width: 5px;  border-top-width: 5px;}.dropup .btn-large .caret {  border-bottom: 5px solid #000000;  border-top: 0;}.btn-primary .caret,.btn-warning .caret,.btn-danger .caret,.btn-info .caret,.btn-success .caret,.btn-inverse .caret {  border-top-color: #ffffff;  border-bottom-color: #ffffff;  opacity: 0.75;  filter: alpha(opacity=75);}.nav {  margin-left: 0;  margin-bottom: 18px;  list-style: none;}.nav > li > a {  display: block;}.nav > li > a:hover {  text-decoration: none;  background-color: #eeeeee;}.nav > .pull-right {  float: right;}.nav .nav-header {  display: block;  padding: 3px 15px;  font-size: 11px;  font-weight: bold;  line-height: 18px;  color: #999999;  text-shadow: 0 1px 0 rgba(255, 255, 255, 0.5);  text-transform: uppercase;}.nav li + .nav-header {  margin-top: 9px;}.nav-list {  padding-left: 15px;  padding-right: 15px;  margin-bottom: 0;}.nav-list > li > a,.nav-list .nav-header {  margin-left: -15px;  margin-right: -15px;  text-shadow: 0 1px 0 rgba(255, 255, 255, 0.5);}.nav-list > li > a {  padding: 3px 15px;}.nav-list > .active > a,.nav-list > .active > a:hover {  color: #ffffff;  text-shadow: 0 -1px 0 rgba(0, 0, 0, 0.2);  background-color: #0088cc;}.nav-list [class^="icon-"] {  margin-right: 2px;}.nav-list .divider {  *width: 100%;  height: 1px;  margin: 8px 1px;  *margin: -5px 0 5px;  overflow: hidden;  background-color: #e5e5e5;  border-bottom: 1px solid #ffffff;}.nav-tabs,.nav-pills {  *zoom: 1;}.nav-tabs:before,.nav-pills:before,.nav-tabs:after,.nav-pills:after {  display: table;  content: "";}.nav-tabs:after,.nav-pills:after {  clear: both;}.nav-tabs > li,.nav-pills > li {  float: left;}.nav-tabs > li > a,.nav-pills > li > a {  padding-right: 12px;  padding-left: 12px;  margin-right: 2px;  line-height: 14px;}.nav-tabs {  border-bottom: 1px solid #ddd;}.nav-tabs > li {  margin-bottom: -1px;}.nav-tabs > li > a {  padding-top: 8px;  padding-bottom: 8px;  line-height: 18px;  border: 1px solid transparent;  -webkit-border-radius: 4px 4px 0 0;  -moz-border-radius: 4px 4px 0 0;  border-radius: 4px 4px 0 0;}.nav-tabs > li > a:hover {  border-color: #eeeeee #eeeeee #dddddd;}.nav-tabs > .active > a,.nav-tabs > .active > a:hover {  color: #555555;  background-color: #ffffff;  border: 1px solid #ddd;  border-bottom-color: transparent;  cursor: default;}.nav-pills > li > a {  padding-top: 8px;  padding-bottom: 8px;  margin-top: 2px;  margin-bottom: 2px;  -webkit-border-radius: 5px;  -moz-border-radius: 5px;  border-radius: 5px;}.nav-pills > .active > a,.nav-pills > .active > a:hover {  color: #ffffff;  background-color: #0088cc;}.nav-stacked > li {  float: none;}.nav-stacked > li > a {  margin-right: 0;}.nav-tabs.nav-stacked {  border-bottom: 0;}.nav-tabs.nav-stacked > li > a {  border: 1px solid #ddd;  -webkit-border-radius: 0;  -moz-border-radius: 0;  border-radius: 0;}.nav-tabs.nav-stacked > li:first-child > a {  -webkit-border-radius: 4px 4px 0 0;  -moz-border-radius: 4px 4px 0 0;  border-radius: 4px 4px 0 0;}.nav-tabs.nav-stacked > li:last-child > a {  -webkit-border-radius: 0 0 4px 4px;  -moz-border-radius: 0 0 4px 4px;  border-radius: 0 0 4px 4px;}.nav-tabs.nav-stacked > li > a:hover {  border-color: #ddd;  z-index: 2;}.nav-pills.nav-stacked > li > a {  margin-bottom: 3px;}.nav-pills.nav-stacked > li:last-child > a {  margin-bottom: 1px;}.nav-tabs .dropdown-menu {  -webkit-border-radius: 0 0 5px 5px;  -moz-border-radius: 0 0 5px 5px;  border-radius: 0 0 5px 5px;}.nav-pills .dropdown-menu {  -webkit-border-radius: 4px;  -moz-border-radius: 4px;  border-radius: 4px;}.nav-tabs .dropdown-toggle .caret,.nav-pills .dropdown-toggle .caret {  border-top-color: #0088cc;  border-bottom-color: #0088cc;  margin-top: 6px;}.nav-tabs .dropdown-toggle:hover .caret,.nav-pills .dropdown-toggle:hover .caret {  border-top-color: #005580;  border-bottom-color: #005580;}.nav-tabs .active .dropdown-toggle .caret,.nav-pills .active .dropdown-toggle .caret {  border-top-color: #333333;  border-bottom-color: #333333;}.nav > .dropdown.active > a:hover {  color: #000000;  cursor: pointer;}.nav-tabs .open .dropdown-toggle,.nav-pills .open .dropdown-toggle,.nav > li.dropdown.open.active > a:hover {  color: #ffffff;  background-color: #999999;  border-color: #999999;}.nav li.dropdown.open .caret,.nav li.dropdown.open.active .caret,.nav li.dropdown.open a:hover .caret {  border-top-color: #ffffff;  border-bottom-color: #ffffff;  opacity: 1;  filter: alpha(opacity=100);}.tabs-stacked .open > a:hover {  border-color: #999999;}.tabbable {  *zoom: 1;}.tabbable:before,.tabbable:after {  display: table;  content: "";}.tabbable:after {  clear: both;}.tab-content {  overflow: auto;}.tabs-below > .nav-tabs,.tabs-right > .nav-tabs,.tabs-left > .nav-tabs {  border-bottom: 0;}.tab-content > .tab-pane,.pill-content > .pill-pane {  display: none;}.tab-content > .active,.pill-content > .active {  display: block;}.tabs-below > .nav-tabs {  border-top: 1px solid #ddd;}.tabs-below > .nav-tabs > li {  margin-top: -1px;  margin-bottom: 0;}.tabs-below > .nav-tabs > li > a {  -webkit-border-radius: 0 0 4px 4px;  -moz-border-radius: 0 0 4px 4px;  border-radius: 0 0 4px 4px;}.tabs-below > .nav-tabs > li > a:hover {  border-bottom-color: transparent;  border-top-color: #ddd;}.tabs-below > .nav-tabs > .active > a,.tabs-below > .nav-tabs > .active > a:hover {  border-color: transparent #ddd #ddd #ddd;}.tabs-left > .nav-tabs > li,.tabs-right > .nav-tabs > li {  float: none;}.tabs-left > .nav-tabs > li > a,.tabs-right > .nav-tabs > li > a {  min-width: 74px;  margin-right: 0;  margin-bottom: 3px;}.tabs-left > .nav-tabs {  float: left;  margin-right: 19px;  border-right: 1px solid #ddd;}.tabs-left > .nav-tabs > li > a {  margin-right: -1px;  -webkit-border-radius: 4px 0 0 4px;  -moz-border-radius: 4px 0 0 4px;  border-radius: 4px 0 0 4px;}.tabs-left > .nav-tabs > li > a:hover {  border-color: #eeeeee #dddddd #eeeeee #eeeeee;}.tabs-left > .nav-tabs .active > a,.tabs-left > .nav-tabs .active > a:hover {  border-color: #ddd transparent #ddd #ddd;  *border-right-color: #ffffff;}.tabs-right > .nav-tabs {  float: right;  margin-left: 19px;  border-left: 1px solid #ddd;}.tabs-right > .nav-tabs > li > a {  margin-left: -1px;  -webkit-border-radius: 0 4px 4px 0;  -moz-border-radius: 0 4px 4px 0;  border-radius: 0 4px 4px 0;}.tabs-right > .nav-tabs > li > a:hover {  border-color: #eeeeee #eeeeee #eeeeee #dddddd;}.tabs-right > .nav-tabs .active > a,.tabs-right > .nav-tabs .active > a:hover {  border-color: #ddd #ddd #ddd transparent;  *border-left-color: #ffffff;}.navbar {  *position: relative;  *z-index: 2;  overflow: visible;  margin-bottom: 18px;}.navbar-inner {  min-height: 40px;  padding-left: 20px;  padding-right: 20px;  background-color: #2c2c2c;  background-image: -moz-linear-gradient(top, #333333, #222222);  background-image: -ms-linear-gradient(top, #333333, #222222);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#333333), to(#222222));  background-image: -webkit-linear-gradient(top, #333333, #222222);  background-image: -o-linear-gradient(top, #333333, #222222);  background-image: linear-gradient(top, #333333, #222222);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#333333', endColorstr='#222222', GradientType=0);  -webkit-border-radius: 4px;  -moz-border-radius: 4px;  border-radius: 4px;  -webkit-box-shadow: 0 1px 3px rgba(0,0,0,.25), inset 0 -1px 0 rgba(0,0,0,.1);  -moz-box-shadow: 0 1px 3px rgba(0,0,0,.25), inset 0 -1px 0 rgba(0,0,0,.1);  box-shadow: 0 1px 3px rgba(0,0,0,.25), inset 0 -1px 0 rgba(0,0,0,.1);}.navbar .container {  width: auto;}.nav-collapse.collapse {  height: auto;}.navbar {  color: #999999;}.navbar .brand:hover {  text-decoration: none;}.navbar .brand {  float: left;  display: block;  padding: 8px 20px 12px;  margin-left: -20px;  font-size: 20px;  font-weight: 200;  line-height: 1;  color: #999999;}.navbar .navbar-text {  margin-bottom: 0;  line-height: 40px;}.navbar .navbar-link {  color: #999999;}.navbar .navbar-link:hover {  color: #ffffff;}.navbar .btn,.navbar .btn-group {  margin-top: 5px;}.navbar .btn-group .btn {  margin: 0;}.navbar-form {  margin-bottom: 0;  *zoom: 1;}.navbar-form:before,.navbar-form:after {  display: table;  content: "";}.navbar-form:after {  clear: both;}.navbar-form input,.navbar-form select,.navbar-form .radio,.navbar-form .checkbox {  margin-top: 5px;}.navbar-form input,.navbar-form select {  display: inline-block;  margin-bottom: 0;}.navbar-form input[type="image"],.navbar-form input[type="checkbox"],.navbar-form input[type="radio"] {  margin-top: 3px;}.navbar-form .input-append,.navbar-form .input-prepend {  margin-top: 6px;  white-space: nowrap;}.navbar-form .input-append input,.navbar-form .input-prepend input {  margin-top: 0;}.navbar-search {  position: relative;  float: left;  margin-top: 6px;  margin-bottom: 0;}.navbar-search .search-query {  padding: 4px 9px;  font-family: "Helvetica Neue", Helvetica, Arial, sans-serif;  font-size: 13px;  font-weight: normal;  line-height: 1;  color: #ffffff;  background-color: #626262;  border: 1px solid #151515;  -webkit-box-shadow: inset 0 1px 2px rgba(0,0,0,.1), 0 1px 0 rgba(255,255,255,.15);  -moz-box-shadow: inset 0 1px 2px rgba(0,0,0,.1), 0 1px 0 rgba(255,255,255,.15);  box-shadow: inset 0 1px 2px rgba(0,0,0,.1), 0 1px 0 rgba(255,255,255,.15);  -webkit-transition: none;  -moz-transition: none;  -ms-transition: none;  -o-transition: none;  transition: none;}.navbar-search .search-query:-moz-placeholder {  color: #cccccc;}.navbar-search .search-query:-ms-input-placeholder {  color: #cccccc;}.navbar-search .search-query::-webkit-input-placeholder {  color: #cccccc;}.navbar-search .search-query:focus,.navbar-search .search-query.focused {  padding: 5px 10px;  color: #333333;  text-shadow: 0 1px 0 #ffffff;  background-color: #ffffff;  border: 0;  -webkit-box-shadow: 0 0 3px rgba(0, 0, 0, 0.15);  -moz-box-shadow: 0 0 3px rgba(0, 0, 0, 0.15);  box-shadow: 0 0 3px rgba(0, 0, 0, 0.15);  outline: 0;}.navbar-fixed-top,.navbar-fixed-bottom {  position: fixed;  right: 0;  left: 0;  z-index: 1030;  margin-bottom: 0;}.navbar-fixed-top .navbar-inner,.navbar-fixed-bottom .navbar-inner {  padding-left: 0;  padding-right: 0;  -webkit-border-radius: 0;  -moz-border-radius: 0;  border-radius: 0;}.navbar-fixed-top .container,.navbar-fixed-bottom .container {  width: 940px;}.navbar-fixed-top {  top: 0;}.navbar-fixed-bottom {  bottom: 0;}.navbar .nav {  position: relative;  left: 0;  display: block;  float: left;  margin: 0 10px 0 0;}.navbar .nav.pull-right {  float: right;}.navbar .nav > li {  display: block;  float: left;}.navbar .nav > li > a {  float: none;  padding: 9px 10px 11px;  line-height: 19px;  color: #999999;  text-decoration: none;  text-shadow: 0 -1px 0 rgba(0, 0, 0, 0.25);}.navbar .btn {  display: inline-block;  padding: 4px 10px 4px;  margin: 5px 5px 6px;  line-height: 18px;}.navbar .btn-group {  margin: 0;  padding: 5px 5px 6px;}.navbar .nav > li > a:hover {  background-color: transparent;  color: #ffffff;  text-decoration: none;}.navbar .nav .active > a,.navbar .nav .active > a:hover {  color: #ffffff;  text-decoration: none;  background-color: #222222;}.navbar .divider-vertical {  height: 40px;  width: 1px;  margin: 0 9px;  overflow: hidden;  background-color: #222222;  border-right: 1px solid #333333;}.navbar .nav.pull-right {  margin-left: 10px;  margin-right: 0;}.navbar .btn-navbar {  display: none;  float: right;  padding: 7px 10px;  margin-left: 5px;  margin-right: 5px;  background-color: #2c2c2c;  background-image: -moz-linear-gradient(top, #333333, #222222);  background-image: -ms-linear-gradient(top, #333333, #222222);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#333333), to(#222222));  background-image: -webkit-linear-gradient(top, #333333, #222222);  background-image: -o-linear-gradient(top, #333333, #222222);  background-image: linear-gradient(top, #333333, #222222);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#333333', endColorstr='#222222', GradientType=0);  border-color: #222222 #222222 #000000;  border-color: rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.1) rgba(0, 0, 0, 0.25);  *background-color: #222222;  /* Darken IE7 buttons by default so they stand out more given they won't have borders */  filter: progid:DXImageTransform.Microsoft.gradient(enabled = false);  -webkit-box-shadow: inset 0 1px 0 rgba(255,255,255,.1), 0 1px 0 rgba(255,255,255,.075);  -moz-box-shadow: inset 0 1px 0 rgba(255,255,255,.1), 0 1px 0 rgba(255,255,255,.075);  box-shadow: inset 0 1px 0 rgba(255,255,255,.1), 0 1px 0 rgba(255,255,255,.075);}.navbar .btn-navbar:hover,.navbar .btn-navbar:active,.navbar .btn-navbar.active,.navbar .btn-navbar.disabled,.navbar .btn-navbar[disabled] {  background-color: #222222;  *background-color: #151515;}.navbar .btn-navbar:active,.navbar .btn-navbar.active {  background-color: #080808 \9;}.navbar .btn-navbar .icon-bar {  display: block;  width: 18px;  height: 2px;  background-color: #f5f5f5;  -webkit-border-radius: 1px;  -moz-border-radius: 1px;  border-radius: 1px;  -webkit-box-shadow: 0 1px 0 rgba(0, 0, 0, 0.25);  -moz-box-shadow: 0 1px 0 rgba(0, 0, 0, 0.25);  box-shadow: 0 1px 0 rgba(0, 0, 0, 0.25);}.btn-navbar .icon-bar + .icon-bar {  margin-top: 3px;}.navbar .dropdown-menu:before {  content: '';  display: inline-block;  border-left: 7px solid transparent;  border-right: 7px solid transparent;  border-bottom: 7px solid #ccc;  border-bottom-color: rgba(0, 0, 0, 0.2);  position: absolute;  top: -7px;  left: 9px;}.navbar .dropdown-menu:after {  content: '';  display: inline-block;  border-left: 6px solid transparent;  border-right: 6px solid transparent;  border-bottom: 6px solid #ffffff;  position: absolute;  top: -6px;  left: 10px;}.navbar-fixed-bottom .dropdown-menu:before {  border-top: 7px solid #ccc;  border-top-color: rgba(0, 0, 0, 0.2);  border-bottom: 0;  bottom: -7px;  top: auto;}.navbar-fixed-bottom .dropdown-menu:after {  border-top: 6px solid #ffffff;  border-bottom: 0;  bottom: -6px;  top: auto;}.navbar .nav li.dropdown .dropdown-toggle .caret,.navbar .nav li.dropdown.open .caret {  border-top-color: #ffffff;  border-bottom-color: #ffffff;}.navbar .nav li.dropdown.active .caret {  opacity: 1;  filter: alpha(opacity=100);}.navbar .nav li.dropdown.open > .dropdown-toggle,.navbar .nav li.dropdown.active > .dropdown-toggle,.navbar .nav li.dropdown.open.active > .dropdown-toggle {  background-color: transparent;}.navbar .nav li.dropdown.active > .dropdown-toggle:hover {  color: #ffffff;}.navbar .pull-right .dropdown-menu,.navbar .dropdown-menu.pull-right {  left: auto;  right: 0;}.navbar .pull-right .dropdown-menu:before,.navbar .dropdown-menu.pull-right:before {  left: auto;  right: 12px;}.navbar .pull-right .dropdown-menu:after,.navbar .dropdown-menu.pull-right:after {  left: auto;  right: 13px;}.breadcrumb {  padding: 7px 14px;  margin: 0 0 18px;  list-style: none;  background-color: #fbfbfb;  background-image: -moz-linear-gradient(top, #ffffff, #f5f5f5);  background-image: -ms-linear-gradient(top, #ffffff, #f5f5f5);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#ffffff), to(#f5f5f5));  background-image: -webkit-linear-gradient(top, #ffffff, #f5f5f5);  background-image: -o-linear-gradient(top, #ffffff, #f5f5f5);  background-image: linear-gradient(top, #ffffff, #f5f5f5);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#ffffff', endColorstr='#f5f5f5', GradientType=0);  border: 1px solid #ddd;  -webkit-border-radius: 3px;  -moz-border-radius: 3px;  border-radius: 3px;  -webkit-box-shadow: inset 0 1px 0 #ffffff;  -moz-box-shadow: inset 0 1px 0 #ffffff;  box-shadow: inset 0 1px 0 #ffffff;}.breadcrumb li {  display: inline-block;  *display: inline;  /* IE7 inline-block hack */  *zoom: 1;  text-shadow: 0 1px 0 #ffffff;}.breadcrumb .divider {  padding: 0 5px;  color: #999999;}.breadcrumb .active a {  color: #333333;}.pagination {  height: 36px;  margin: 18px 0;}.pagination ul {  display: inline-block;  *display: inline;  /* IE7 inline-block hack */  *zoom: 1;  margin-left: 0;  margin-bottom: 0;  -webkit-border-radius: 3px;  -moz-border-radius: 3px;  border-radius: 3px;  -webkit-box-shadow: 0 1px 2px rgba(0, 0, 0, 0.05);  -moz-box-shadow: 0 1px 2px rgba(0, 0, 0, 0.05);  box-shadow: 0 1px 2px rgba(0, 0, 0, 0.05);}.pagination li {  display: inline;}.pagination a {  float: left;  padding: 0 14px;  line-height: 34px;  text-decoration: none;  border: 1px solid #ddd;  border-left-width: 0;}.pagination a:hover,.pagination .active a {  background-color: #f5f5f5;}.pagination .active a {  color: #999999;  cursor: default;}.pagination .disabled span,.pagination .disabled a,.pagination .disabled a:hover {  color: #999999;  background-color: transparent;  cursor: default;}.pagination li:first-child a {  border-left-width: 1px;  -webkit-border-radius: 3px 0 0 3px;  -moz-border-radius: 3px 0 0 3px;  border-radius: 3px 0 0 3px;}.pagination li:last-child a {  -webkit-border-radius: 0 3px 3px 0;  -moz-border-radius: 0 3px 3px 0;  border-radius: 0 3px 3px 0;}.pagination-centered {  text-align: center;}.pagination-right {  text-align: right;}.pager {  margin-left: 0;  margin-bottom: 18px;  list-style: none;  text-align: center;  *zoom: 1;}.pager:before,.pager:after {  display: table;  content: "";}.pager:after {  clear: both;}.pager li {  display: inline;}.pager a {  display: inline-block;  padding: 5px 14px;  background-color: #fff;  border: 1px solid #ddd;  -webkit-border-radius: 15px;  -moz-border-radius: 15px;  border-radius: 15px;}.pager a:hover {  text-decoration: none;  background-color: #f5f5f5;}.pager .next a {  float: right;}.pager .previous a {  float: left;}.pager .disabled a,.pager .disabled a:hover {  color: #999999;  background-color: #fff;  cursor: default;}.thumbnails {  margin-left: -20px;  list-style: none;  *zoom: 1;}.thumbnails:before,.thumbnails:after {  display: table;  content: "";}.thumbnails:after {  clear: both;}.row-fluid .thumbnails {  margin-left: 0;}.thumbnails > li {  float: left;  margin-bottom: 18px;  margin-left: 20px;}.thumbnail {  display: block;  padding: 4px;  line-height: 1;  border: 1px solid #ddd;  -webkit-border-radius: 4px;  -moz-border-radius: 4px;  border-radius: 4px;  -webkit-box-shadow: 0 1px 1px rgba(0, 0, 0, 0.075);  -moz-box-shadow: 0 1px 1px rgba(0, 0, 0, 0.075);  box-shadow: 0 1px 1px rgba(0, 0, 0, 0.075);}a.thumbnail:hover {  border-color: #0088cc;  -webkit-box-shadow: 0 1px 4px rgba(0, 105, 214, 0.25);  -moz-box-shadow: 0 1px 4px rgba(0, 105, 214, 0.25);  box-shadow: 0 1px 4px rgba(0, 105, 214, 0.25);}.thumbnail > img {  display: block;  max-width: 100%;  margin-left: auto;  margin-right: auto;}.thumbnail .caption {  padding: 9px;}.alert {  padding: 8px 35px 8px 14px;  margin-bottom: 18px;  text-shadow: 0 1px 0 rgba(255, 255, 255, 0.5);  background-color: #fcf8e3;  border: 1px solid #fbeed5;  -webkit-border-radius: 4px;  -moz-border-radius: 4px;  border-radius: 4px;  color: #c09853;}.alert-heading {  color: inherit;}.alert .close {  position: relative;  top: -2px;  right: -21px;  line-height: 18px;}.alert-success {  background-color: #dff0d8;  border-color: #d6e9c6;  color: #468847;}.alert-danger,.alert-error {  background-color: #f2dede;  border-color: #eed3d7;  color: #b94a48;}.alert-info {  background-color: #d9edf7;  border-color: #bce8f1;  color: #3a87ad;}.alert-block {  padding-top: 14px;  padding-bottom: 14px;}.alert-block > p,.alert-block > ul {  margin-bottom: 0;}.alert-block p + p {  margin-top: 5px;}@-webkit-keyframes progress-bar-stripes {  from {    background-position: 40px 0;  }  to {    background-position: 0 0;  }}@-moz-keyframes progress-bar-stripes {  from {    background-position: 40px 0;  }  to {    background-position: 0 0;  }}@-ms-keyframes progress-bar-stripes {  from {    background-position: 40px 0;  }  to {    background-position: 0 0;  }}@-o-keyframes progress-bar-stripes {  from {    background-position: 0 0;  }  to {    background-position: 40px 0;  }}@keyframes progress-bar-stripes {  from {    background-position: 40px 0;  }  to {    background-position: 0 0;  }}.progress {  overflow: hidden;  height: 18px;  margin-bottom: 18px;  background-color: #f7f7f7;  background-image: -moz-linear-gradient(top, #f5f5f5, #f9f9f9);  background-image: -ms-linear-gradient(top, #f5f5f5, #f9f9f9);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#f5f5f5), to(#f9f9f9));  background-image: -webkit-linear-gradient(top, #f5f5f5, #f9f9f9);  background-image: -o-linear-gradient(top, #f5f5f5, #f9f9f9);  background-image: linear-gradient(top, #f5f5f5, #f9f9f9);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#f5f5f5', endColorstr='#f9f9f9', GradientType=0);  -webkit-box-shadow: inset 0 1px 2px rgba(0, 0, 0, 0.1);  -moz-box-shadow: inset 0 1px 2px rgba(0, 0, 0, 0.1);  box-shadow: inset 0 1px 2px rgba(0, 0, 0, 0.1);  -webkit-border-radius: 4px;  -moz-border-radius: 4px;  border-radius: 4px;}.progress .bar {  width: 0%;  height: 18px;  color: #ffffff;  font-size: 12px;  text-align: center;  text-shadow: 0 -1px 0 rgba(0, 0, 0, 0.25);  background-color: #0e90d2;  background-image: -moz-linear-gradient(top, #149bdf, #0480be);  background-image: -ms-linear-gradient(top, #149bdf, #0480be);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#149bdf), to(#0480be));  background-image: -webkit-linear-gradient(top, #149bdf, #0480be);  background-image: -o-linear-gradient(top, #149bdf, #0480be);  background-image: linear-gradient(top, #149bdf, #0480be);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#149bdf', endColorstr='#0480be', GradientType=0);  -webkit-box-shadow: inset 0 -1px 0 rgba(0, 0, 0, 0.15);  -moz-box-shadow: inset 0 -1px 0 rgba(0, 0, 0, 0.15);  box-shadow: inset 0 -1px 0 rgba(0, 0, 0, 0.15);  -webkit-box-sizing: border-box;  -moz-box-sizing: border-box;  -ms-box-sizing: border-box;  box-sizing: border-box;  -webkit-transition: width 0.6s ease;  -moz-transition: width 0.6s ease;  -ms-transition: width 0.6s ease;  -o-transition: width 0.6s ease;  transition: width 0.6s ease;}.progress-striped .bar {  background-color: #149bdf;  background-image: -webkit-gradient(linear, 0 100%, 100% 0, color-stop(0.25, rgba(255, 255, 255, 0.15)), color-stop(0.25, transparent), color-stop(0.5, transparent), color-stop(0.5, rgba(255, 255, 255, 0.15)), color-stop(0.75, rgba(255, 255, 255, 0.15)), color-stop(0.75, transparent), to(transparent));  background-image: -webkit-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -moz-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -ms-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -o-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  -webkit-background-size: 40px 40px;  -moz-background-size: 40px 40px;  -o-background-size: 40px 40px;  background-size: 40px 40px;}.progress.active .bar {  -webkit-animation: progress-bar-stripes 2s linear infinite;  -moz-animation: progress-bar-stripes 2s linear infinite;  -ms-animation: progress-bar-stripes 2s linear infinite;  -o-animation: progress-bar-stripes 2s linear infinite;  animation: progress-bar-stripes 2s linear infinite;}.progress-danger .bar {  background-color: #dd514c;  background-image: -moz-linear-gradient(top, #ee5f5b, #c43c35);  background-image: -ms-linear-gradient(top, #ee5f5b, #c43c35);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#ee5f5b), to(#c43c35));  background-image: -webkit-linear-gradient(top, #ee5f5b, #c43c35);  background-image: -o-linear-gradient(top, #ee5f5b, #c43c35);  background-image: linear-gradient(top, #ee5f5b, #c43c35);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#ee5f5b', endColorstr='#c43c35', GradientType=0);}.progress-danger.progress-striped .bar {  background-color: #ee5f5b;  background-image: -webkit-gradient(linear, 0 100%, 100% 0, color-stop(0.25, rgba(255, 255, 255, 0.15)), color-stop(0.25, transparent), color-stop(0.5, transparent), color-stop(0.5, rgba(255, 255, 255, 0.15)), color-stop(0.75, rgba(255, 255, 255, 0.15)), color-stop(0.75, transparent), to(transparent));  background-image: -webkit-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -moz-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -ms-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -o-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);}.progress-success .bar {  background-color: #5eb95e;  background-image: -moz-linear-gradient(top, #62c462, #57a957);  background-image: -ms-linear-gradient(top, #62c462, #57a957);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#62c462), to(#57a957));  background-image: -webkit-linear-gradient(top, #62c462, #57a957);  background-image: -o-linear-gradient(top, #62c462, #57a957);  background-image: linear-gradient(top, #62c462, #57a957);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#62c462', endColorstr='#57a957', GradientType=0);}.progress-success.progress-striped .bar {  background-color: #62c462;  background-image: -webkit-gradient(linear, 0 100%, 100% 0, color-stop(0.25, rgba(255, 255, 255, 0.15)), color-stop(0.25, transparent), color-stop(0.5, transparent), color-stop(0.5, rgba(255, 255, 255, 0.15)), color-stop(0.75, rgba(255, 255, 255, 0.15)), color-stop(0.75, transparent), to(transparent));  background-image: -webkit-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -moz-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -ms-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -o-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);}.progress-info .bar {  background-color: #4bb1cf;  background-image: -moz-linear-gradient(top, #5bc0de, #339bb9);  background-image: -ms-linear-gradient(top, #5bc0de, #339bb9);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#5bc0de), to(#339bb9));  background-image: -webkit-linear-gradient(top, #5bc0de, #339bb9);  background-image: -o-linear-gradient(top, #5bc0de, #339bb9);  background-image: linear-gradient(top, #5bc0de, #339bb9);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#5bc0de', endColorstr='#339bb9', GradientType=0);}.progress-info.progress-striped .bar {  background-color: #5bc0de;  background-image: -webkit-gradient(linear, 0 100%, 100% 0, color-stop(0.25, rgba(255, 255, 255, 0.15)), color-stop(0.25, transparent), color-stop(0.5, transparent), color-stop(0.5, rgba(255, 255, 255, 0.15)), color-stop(0.75, rgba(255, 255, 255, 0.15)), color-stop(0.75, transparent), to(transparent));  background-image: -webkit-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -moz-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -ms-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -o-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);}.progress-warning .bar {  background-color: #faa732;  background-image: -moz-linear-gradient(top, #fbb450, #f89406);  background-image: -ms-linear-gradient(top, #fbb450, #f89406);  background-image: -webkit-gradient(linear, 0 0, 0 100%, from(#fbb450), to(#f89406));  background-image: -webkit-linear-gradient(top, #fbb450, #f89406);  background-image: -o-linear-gradient(top, #fbb450, #f89406);  background-image: linear-gradient(top, #fbb450, #f89406);  background-repeat: repeat-x;  filter: progid:DXImageTransform.Microsoft.gradient(startColorstr='#fbb450', endColorstr='#f89406', GradientType=0);}.progress-warning.progress-striped .bar {  background-color: #fbb450;  background-image: -webkit-gradient(linear, 0 100%, 100% 0, color-stop(0.25, rgba(255, 255, 255, 0.15)), color-stop(0.25, transparent), color-stop(0.5, transparent), color-stop(0.5, rgba(255, 255, 255, 0.15)), color-stop(0.75, rgba(255, 255, 255, 0.15)), color-stop(0.75, transparent), to(transparent));  background-image: -webkit-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -moz-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -ms-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: -o-linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);  background-image: linear-gradient(-45deg, rgba(255, 255, 255, 0.15) 25%, transparent 25%, transparent 50%, rgba(255, 255, 255, 0.15) 50%, rgba(255, 255, 255, 0.15) 75%, transparent 75%, transparent);}.hero-unit {  padding: 60px;  margin-bottom: 30px;  background-color: #eeeeee;  -webkit-border-radius: 6px;  -moz-border-radius: 6px;  border-radius: 6px;}.hero-unit h1 {  margin-bottom: 0;  font-size: 60px;  line-height: 1;  color: inherit;  letter-spacing: -1px;}.hero-unit p {  font-size: 18px;  font-weight: 200;  line-height: 27px;  color: inherit;}.tooltip {  position: absolute;  z-index: 1020;  display: block;  visibility: visible;  padding: 5px;  font-size: 11px;  opacity: 0;  filter: alpha(opacity=0);}.tooltip.in {  opacity: 0.8;  filter: alpha(opacity=80);}.tooltip.top {  margin-top: -2px;}.tooltip.right {  margin-left: 2px;}.tooltip.bottom {  margin-top: 2px;}.tooltip.left {  margin-left: -2px;}.tooltip.top .tooltip-arrow {  bottom: 0;  left: 50%;  margin-left: -5px;  border-left: 5px solid transparent;  border-right: 5px solid transparent;  border-top: 5px solid #000000;}.tooltip.left .tooltip-arrow {  top: 50%;  right: 0;  margin-top: -5px;  border-top: 5px solid transparent;  border-bottom: 5px solid transparent;  border-left: 5px solid #000000;}.tooltip.bottom .tooltip-arrow {  top: 0;  left: 50%;  margin-left: -5px;  border-left: 5px solid transparent;  border-right: 5px solid transparent;  border-bottom: 5px solid #000000;}.tooltip.right .tooltip-arrow {  top: 50%;  left: 0;  margin-top: -5px;  border-top: 5px solid transparent;  border-bottom: 5px solid transparent;  border-right: 5px solid #000000;}.tooltip-inner {  max-width: 200px;  padding: 3px 8px;  color: #ffffff;  text-align: center;  text-decoration: none;  background-color: #000000;  -webkit-border-radius: 4px;  -moz-border-radius: 4px;  border-radius: 4px;}.tooltip-arrow {  position: absolute;  width: 0;  height: 0;}.popover {  position: absolute;  top: 0;  left: 0;  z-index: 1010;  display: none;  padding: 5px;}.popover.top {  margin-top: -5px;}.popover.right {  margin-left: 5px;}.popover.bottom {  margin-top: 5px;}.popover.left {  margin-left: -5px;}.popover.top .arrow {  bottom: 0;  left: 50%;  margin-left: -5px;  border-left: 5px solid transparent;  border-right: 5px solid transparent;  border-top: 5px solid #000000;}.popover.right .arrow {  top: 50%;  left: 0;  margin-top: -5px;  border-top: 5px solid transparent;  border-bottom: 5px solid transparent;  border-right: 5px solid #000000;}.popover.bottom .arrow {  top: 0;  left: 50%;  margin-left: -5px;  border-left: 5px solid transparent;  border-right: 5px solid transparent;  border-bottom: 5px solid #000000;}.popover.left .arrow {  top: 50%;  right: 0;  margin-top: -5px;  border-top: 5px solid transparent;  border-bottom: 5px solid transparent;  border-left: 5px solid #000000;}.popover .arrow {  position: absolute;  width: 0;  height: 0;}.popover-inner {  padding: 3px;  width: 280px;  overflow: hidden;  background: #000000;  background: rgba(0, 0, 0, 0.8);  -webkit-border-radius: 6px;  -moz-border-radius: 6px;  border-radius: 6px;  -webkit-box-shadow: 0 3px 7px rgba(0, 0, 0, 0.3);  -moz-box-shadow: 0 3px 7px rgba(0, 0, 0, 0.3);  box-shadow: 0 3px 7px rgba(0, 0, 0, 0.3);}.popover-title {  padding: 9px 15px;  line-height: 1;  background-color: #f5f5f5;  border-bottom: 1px solid #eee;  -webkit-border-radius: 3px 3px 0 0;  -moz-border-radius: 3px 3px 0 0;  border-radius: 3px 3px 0 0;}.popover-content {  padding: 14px;  background-color: #ffffff;  -webkit-border-radius: 0 0 3px 3px;  -moz-border-radius: 0 0 3px 3px;  border-radius: 0 0 3px 3px;  -webkit-background-clip: padding-box;  -moz-background-clip: padding-box;  background-clip: padding-box;}.popover-content p,.popover-content ul,.popover-content ol {  margin-bottom: 0;}.modal-open .dropdown-menu {  z-index: 2050;}.modal-open .dropdown.open {  *z-index: 2050;}.modal-open .popover {  z-index: 2060;}.modal-open .tooltip {  z-index: 2070;}.modal-backdrop {  position: fixed;  top: 0;  right: 0;  bottom: 0;  left: 0;  z-index: 1040;  background-color: #000000;}.modal-backdrop.fade {  opacity: 0;}.modal-backdrop,.modal-backdrop.fade.in {  opacity: 0.8;  filter: alpha(opacity=80);}.modal {  position: fixed;  top: 50%;  left: 50%;  z-index: 1050;  overflow: auto;  width: 560px;  margin: -250px 0 0 -280px;  background-color: #ffffff;  border: 1px solid #999;  border: 1px solid rgba(0, 0, 0, 0.3);  *border: 1px solid #999;  /* IE6-7 */  -webkit-border-radius: 6px;  -moz-border-radius: 6px;  border-radius: 6px;  -webkit-box-shadow: 0 3px 7px rgba(0, 0, 0, 0.3);  -moz-box-shadow: 0 3px 7px rgba(0, 0, 0, 0.3);  box-shadow: 0 3px 7px rgba(0, 0, 0, 0.3);  -webkit-background-clip: padding-box;  -moz-background-clip: padding-box;  background-clip: padding-box;}.modal.fade {  -webkit-transition: opacity .3s linear, top .3s ease-out;  -moz-transition: opacity .3s linear, top .3s ease-out;  -ms-transition: opacity .3s linear, top .3s ease-out;  -o-transition: opacity .3s linear, top .3s ease-out;  transition: opacity .3s linear, top .3s ease-out;  top: -25%;}.modal.fade.in {  top: 50%;}.modal-header {  padding: 9px 15px;  border-bottom: 1px solid #eee;}.modal-header .close {  margin-top: 2px;}.modal-body {  overflow-y: auto;  max-height: 400px;  padding: 15px;}.modal-form {  margin-bottom: 0;}.modal-footer {  padding: 14px 15px 15px;  margin-bottom: 0;  text-align: right;  background-color: #f5f5f5;  border-top: 1px solid #ddd;  -webkit-border-radius: 0 0 6px 6px;  -moz-border-radius: 0 0 6px 6px;  border-radius: 0 0 6px 6px;  -webkit-box-shadow: inset 0 1px 0 #ffffff;  -moz-box-shadow: inset 0 1px 0 #ffffff;  box-shadow: inset 0 1px 0 #ffffff;  *zoom: 1;}.modal-footer:before,.modal-footer:after {  display: table;  content: "";}.modal-footer:after {  clear: both;}.modal-footer .btn + .btn {  margin-left: 5px;  margin-bottom: 0;}.modal-footer .btn-group .btn + .btn {  margin-left: -1px;}.dropup,.dropdown {  position: relative;}.dropdown-toggle {  *margin-bottom: -3px;}.dropdown-toggle:active,.open .dropdown-toggle {  outline: 0;}.caret {  display: inline-block;  width: 0;  height: 0;  vertical-align: top;  border-top: 4px solid #000000;  border-right: 4px solid transparent;  border-left: 4px solid transparent;  content: "";  opacity: 0.3;  filter: alpha(opacity=30);}.dropdown .caret {  margin-top: 8px;  margin-left: 2px;}.dropdown:hover .caret,.open .caret {  opacity: 1;  filter: alpha(opacity=100);}.dropdown-menu {  position: absolute;  top: 100%;  left: 0;  z-index: 1000;  display: none;  float: left;  min-width: 160px;  padding: 4px 0;  margin: 1px 0 0;  list-style: none;  background-color: #ffffff;  border: 1px solid #ccc;  border: 1px solid rgba(0, 0, 0, 0.2);  *border-right-width: 2px;  *border-bottom-width: 2px;  -webkit-border-radius: 5px;  -moz-border-radius: 5px;  border-radius: 5px;  -webkit-box-shadow: 0 5px 10px rgba(0, 0, 0, 0.2);  -moz-box-shadow: 0 5px 10px rgba(0, 0, 0, 0.2);  box-shadow: 0 5px 10px rgba(0, 0, 0, 0.2);  -webkit-background-clip: padding-box;  -moz-background-clip: padding;  background-clip: padding-box;}.dropdown-menu.pull-right {  right: 0;  left: auto;}.dropdown-menu .divider {  *width: 100%;  height: 1px;  margin: 8px 1px;  *margin: -5px 0 5px;  overflow: hidden;  background-color: #e5e5e5;  border-bottom: 1px solid #ffffff;}.dropdown-menu a {  display: block;  padding: 3px 15px;  clear: both;  font-weight: normal;  line-height: 18px;  color: #333333;  white-space: nowrap;}.dropdown-menu li > a:hover,.dropdown-menu .active > a,.dropdown-menu .active > a:hover {  color: #ffffff;  text-decoration: none;  background-color: #0088cc;}.open {  *z-index: 1000;}.open  > .dropdown-menu {  display: block;}.pull-right > .dropdown-menu {  right: 0;  left: auto;}.dropup .caret,.navbar-fixed-bottom .dropdown .caret {  border-top: 0;  border-bottom: 4px solid #000000;  content: "\2191";}.dropup .dropdown-menu,.navbar-fixed-bottom .dropdown .dropdown-menu {  top: auto;  bottom: 100%;  margin-bottom: 1px;}.typeahead {  margin-top: 2px;  -webkit-border-radius: 4px;  -moz-border-radius: 4px;  border-radius: 4px;}.accordion {  margin-bottom: 18px;}.accordion-group {  margin-bottom: 2px;  border: 1px solid #e5e5e5;  -webkit-border-radius: 4px;  -moz-border-radius: 4px;  border-radius: 4px;}.accordion-heading {  border-bottom: 0;}.accordion-heading .accordion-toggle {  display: block;  padding: 8px 15px;}.accordion-toggle {  cursor: pointer;}.accordion-inner {  padding: 9px 15px;  border-top: 1px solid #e5e5e5;}.carousel {  position: relative;  margin-bottom: 18px;  line-height: 1;}.carousel-inner {  overflow: hidden;  width: 100%;  position: relative;}.carousel .item {  display: none;  position: relative;  -webkit-transition: 0.6s ease-in-out left;  -moz-transition: 0.6s ease-in-out left;  -ms-transition: 0.6s ease-in-out left;  -o-transition: 0.6s ease-in-out left;  transition: 0.6s ease-in-out left;}.carousel .item > img {  display: block;  line-height: 1;}.carousel .active,.carousel .next,.carousel .prev {  display: block;}.carousel .active {  left: 0;}.carousel .next,.carousel .prev {  position: absolute;  top: 0;  width: 100%;}.carousel .next {  left: 100%;}.carousel .prev {  left: -100%;}.carousel .next.left,.carousel .prev.right {  left: 0;}.carousel .active.left {  left: -100%;}.carousel .active.right {  left: 100%;}.carousel-control {  position: absolute;  top: 40%;  left: 15px;  width: 40px;  height: 40px;  margin-top: -20px;  font-size: 60px;  font-weight: 100;  line-height: 30px;  color: #ffffff;  text-align: center;  background: #222222;  border: 3px solid #ffffff;  -webkit-border-radius: 23px;  -moz-border-radius: 23px;  border-radius: 23px;  opacity: 0.5;  filter: alpha(opacity=50);}.carousel-control.right {  left: auto;  right: 15px;}.carousel-control:hover {  color: #ffffff;  text-decoration: none;  opacity: 0.9;  filter: alpha(opacity=90);}.carousel-caption {  position: absolute;  left: 0;  right: 0;  bottom: 0;  padding: 10px 15px 5px;  background: #333333;  background: rgba(0, 0, 0, 0.75);}.carousel-caption h4,.carousel-caption p {  color: #ffffff;}.well {  min-height: 20px;  padding: 19px;  margin-bottom: 20px;  background-color: #f5f5f5;  border: 1px solid #eee;  border: 1px solid rgba(0, 0, 0, 0.05);  -webkit-border-radius: 4px;  -moz-border-radius: 4px;  border-radius: 4px;  -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.05);  -moz-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.05);  box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.05);}.well blockquote {  border-color: #ddd;  border-color: rgba(0, 0, 0, 0.15);}.well-large {  padding: 24px;  -webkit-border-radius: 6px;  -moz-border-radius: 6px;  border-radius: 6px;}.well-small {  padding: 9px;  -webkit-border-radius: 3px;  -moz-border-radius: 3px;  border-radius: 3px;}.close {  float: right;  font-size: 20px;  font-weight: bold;  line-height: 18px;  color: #000000;  text-shadow: 0 1px 0 #ffffff;  opacity: 0.2;  filter: alpha(opacity=20);}.close:hover {  color: #000000;  text-decoration: none;  cursor: pointer;  opacity: 0.4;  filter: alpha(opacity=40);}button.close {  padding: 0;  cursor: pointer;  background: transparent;  border: 0;  -webkit-appearance: none;}.pull-right {  float: right;}.pull-left {  float: left;}.hide {  display: none;}.show {  display: block;}.invisible {  visibility: hidden;}.fade {  opacity: 0;  -webkit-transition: opacity 0.15s linear;  -moz-transition: opacity 0.15s linear;  -ms-transition: opacity 0.15s linear;  -o-transition: opacity 0.15s linear;  transition: opacity 0.15s linear;}.fade.in {  opacity: 1;}.collapse {  position: relative;  height: 0;  overflow: hidden;  -webkit-transition: height 0.35s ease;  -moz-transition: height 0.35s ease;  -ms-transition: height 0.35s ease;  -o-transition: height 0.35s ease;  transition: height 0.35s ease;}.collapse.in {  height: auto;}.hidden {  display: none;  visibility: hidden;}.visible-phone {  display: none !important;}.visible-tablet {  display: none !important;}.hidden-desktop {  display: none !important;}@media (max-width: 767px) {  .visible-phone {    display: inherit !important;  }  .hidden-phone {    display: none !important;  }  .hidden-desktop {    display: inherit !important;  }  .visible-desktop {    display: none !important;  }}@media (min-width: 768px) and (max-width: 979px) {  .visible-tablet {    display: inherit !important;  }  .hidden-tablet {    display: none !important;  }  .hidden-desktop {    display: inherit !important;  }  .visible-desktop {    display: none !important ;  }}@media (max-width: 480px) {  .nav-collapse {    -webkit-transform: translate3d(0, 0, 0);  }  .page-header h1 small {    display: block;    line-height: 18px;  }  input[type="checkbox"],  input[type="radio"] {    border: 1px solid #ccc;  }  .form-horizontal .control-group > label {    float: none;    width: auto;    padding-top: 0;    text-align: left;  }  .form-horizontal .controls {    margin-left: 0;  }  .form-horizontal .control-list {    padding-top: 0;  }  .form-horizontal .form-actions {    padding-left: 10px;    padding-right: 10px;  }  .modal {    position: absolute;    top: 10px;    left: 10px;    right: 10px;    width: auto;    margin: 0;  }  .modal.fade.in {    top: auto;  }  .modal-header .close {    padding: 10px;    margin: -10px;  }  .carousel-caption {    position: static;  }}@media (max-width: 767px) {  body {    padding-left: 20px;    padding-right: 20px;  }  .navbar-fixed-top,  .navbar-fixed-bottom {    margin-left: -20px;    margin-right: -20px;  }  .container-fluid {    padding: 0;  }  .dl-horizontal dt {    float: none;    clear: none;    width: auto;    text-align: left;  }  .dl-horizontal dd {    margin-left: 0;  }  .container {    width: auto;  }  .row-fluid {    width: 100%;  }  .row,  .thumbnails {    margin-left: 0;  }  [class*="span"],  .row-fluid [class*="span"] {    float: none;    display: block;    width: auto;    margin-left: 0;  }  .input-large,  .input-xlarge,  .input-xxlarge,  input[class*="span"],  select[class*="span"],  textarea[class*="span"],  .uneditable-input {    display: block;    width: 100%;    min-height: 28px;    -webkit-box-sizing: border-box;    -moz-box-sizing: border-box;    -ms-box-sizing: border-box;    box-sizing: border-box;  }  .input-prepend input,  .input-append input,  .input-prepend input[class*="span"],  .input-append input[class*="span"] {    display: inline-block;    width: auto;  }}@media (min-width: 768px) and (max-width: 979px) {  .row {    margin-left: -20px;    *zoom: 1;  }  .row:before,  .row:after {    display: table;    content: "";  }  .row:after {    clear: both;  }  [class*="span"] {    float: left;    margin-left: 20px;  }  .container,  .navbar-fixed-top .container,  .navbar-fixed-bottom .container {    width: 724px;  }  .span12 {    width: 724px;  }  .span11 {    width: 662px;  }  .span10 {    width: 600px;  }  .span9 {    width: 538px;  }  .span8 {    width: 476px;  }  .span7 {    width: 414px;  }  .span6 {    width: 352px;  }  .span5 {    width: 290px;  }  .span4 {    width: 228px;  }  .span3 {    width: 166px;  }  .span2 {    width: 104px;  }  .span1 {    width: 42px;  }  .offset12 {    margin-left: 764px;  }  .offset11 {    margin-left: 702px;  }  .offset10 {    margin-left: 640px;  }  .offset9 {    margin-left: 578px;  }  .offset8 {    margin-left: 516px;  }  .offset7 {    margin-left: 454px;  }  .offset6 {    margin-left: 392px;  }  .offset5 {    margin-left: 330px;  }  .offset4 {    margin-left: 268px;  }  .offset3 {    margin-left: 206px;  }  .offset2 {    margin-left: 144px;  }  .offset1 {    margin-left: 82px;  }  .row-fluid {    width: 100%;    *zoom: 1;  }  .row-fluid:before,  .row-fluid:after {    display: table;    content: "";  }  .row-fluid:after {    clear: both;  }  .row-fluid [class*="span"] {    display: block;    width: 100%;    min-height: 28px;    -webkit-box-sizing: border-box;    -moz-box-sizing: border-box;    -ms-box-sizing: border-box;    box-sizing: border-box;    float: left;    margin-left: 2.762430939%;    *margin-left: 2.709239449638298%;  }  .row-fluid [class*="span"]:first-child {    margin-left: 0;  }  .row-fluid .span12 {    width: 99.999999993%;    *width: 99.9468085036383%;  }  .row-fluid .span11 {    width: 91.436464082%;    *width: 91.38327259263829%;  }  .row-fluid .span10 {    width: 82.87292817100001%;    *width: 82.8197366816383%;  }  .row-fluid .span9 {    width: 74.30939226%;    *width: 74.25620077063829%;  }  .row-fluid .span8 {    width: 65.74585634900001%;    *width: 65.6926648596383%;  }  .row-fluid .span7 {    width: 57.182320438000005%;    *width: 57.129128948638304%;  }  .row-fluid .span6 {    width: 48.618784527%;    *width: 48.5655930376383%;  }  .row-fluid .span5 {    width: 40.055248616%;    *width: 40.0020571266383%;  }  .row-fluid .span4 {    width: 31.491712705%;    *width: 31.4385212156383%;  }  .row-fluid .span3 {    width: 22.928176794%;    *width: 22.874985304638297%;  }  .row-fluid .span2 {    width: 14.364640883%;    *width: 14.311449393638298%;  }  .row-fluid .span1 {    width: 5.801104972%;    *width: 5.747913482638298%;  }  input,  textarea,  .uneditable-input {    margin-left: 0;  }  input.span12, textarea.span12, .uneditable-input.span12 {    width: 714px;  }  input.span11, textarea.span11, .uneditable-input.span11 {    width: 652px;  }  input.span10, textarea.span10, .uneditable-input.span10 {    width: 590px;  }  input.span9, textarea.span9, .uneditable-input.span9 {    width: 528px;  }  input.span8, textarea.span8, .uneditable-input.span8 {    width: 466px;  }  input.span7, textarea.span7, .uneditable-input.span7 {    width: 404px;  }  input.span6, textarea.span6, .uneditable-input.span6 {    width: 342px;  }  input.span5, textarea.span5, .uneditable-input.span5 {    width: 280px;  }  input.span4, textarea.span4, .uneditable-input.span4 {    width: 218px;  }  input.span3, textarea.span3, .uneditable-input.span3 {    width: 156px;  }  input.span2, textarea.span2, .uneditable-input.span2 {    width: 94px;  }  input.span1, textarea.span1, .uneditable-input.span1 {    width: 32px;  }}@media (min-width: 1200px) {  .row {    margin-left: -30px;    *zoom: 1;  }  .row:before,  .row:after {    display: table;    content: "";  }  .row:after {    clear: both;  }  [class*="span"] {    float: left;    margin-left: 30px;  }  .container,  .navbar-fixed-top .container,  .navbar-fixed-bottom .container {    width: 1170px;  }  .span12 {    width: 1170px;  }  .span11 {    width: 1070px;  }  .span10 {    width: 970px;  }  .span9 {    width: 870px;  }  .span8 {    width: 770px;  }  .span7 {    width: 670px;  }  .span6 {    width: 570px;  }  .span5 {    width: 470px;  }  .span4 {    width: 370px;  }  .span3 {    width: 270px;  }  .span2 {    width: 170px;  }  .span1 {    width: 70px;  }  .offset12 {    margin-left: 1230px;  }  .offset11 {    margin-left: 1130px;  }  .offset10 {    margin-left: 1030px;  }  .offset9 {    margin-left: 930px;  }  .offset8 {    margin-left: 830px;  }  .offset7 {    margin-left: 730px;  }  .offset6 {    margin-left: 630px;  }  .offset5 {    margin-left: 530px;  }  .offset4 {    margin-left: 430px;  }  .offset3 {    margin-left: 330px;  }  .offset2 {    margin-left: 230px;  }  .offset1 {    margin-left: 130px;  }  .row-fluid {    width: 100%;    *zoom: 1;  }  .row-fluid:before,  .row-fluid:after {    display: table;    content: "";  }  .row-fluid:after {    clear: both;  }  .row-fluid [class*="span"] {    display: block;    width: 100%;    min-height: 28px;    -webkit-box-sizing: border-box;    -moz-box-sizing: border-box;    -ms-box-sizing: border-box;    box-sizing: border-box;    float: left;    margin-left: 2.564102564%;    *margin-left: 2.510911074638298%;  }  .row-fluid [class*="span"]:first-child {    margin-left: 0;  }  .row-fluid .span12 {    width: 100%;    *width: 99.94680851063829%;  }  .row-fluid .span11 {    width: 91.45299145300001%;    *width: 91.3997999636383%;  }  .row-fluid .span10 {    width: 82.905982906%;    *width: 82.8527914166383%;  }  .row-fluid .span9 {    width: 74.358974359%;    *width: 74.30578286963829%;  }  .row-fluid .span8 {    width: 65.81196581200001%;    *width: 65.7587743226383%;  }  .row-fluid .span7 {    width: 57.264957265%;    *width: 57.2117657756383%;  }  .row-fluid .span6 {    width: 48.717948718%;    *width: 48.6647572286383%;  }  .row-fluid .span5 {    width: 40.170940171000005%;    *width: 40.117748681638304%;  }  .row-fluid .span4 {    width: 31.623931624%;    *width: 31.5707401346383%;  }  .row-fluid .span3 {    width: 23.076923077%;    *width: 23.0237315876383%;  }  .row-fluid .span2 {    width: 14.529914530000001%;    *width: 14.4767230406383%;  }  .row-fluid .span1 {    width: 5.982905983%;    *width: 5.929714493638298%;  }  input,  textarea,  .uneditable-input {    margin-left: 0;  }  input.span12, textarea.span12, .uneditable-input.span12 {    width: 1160px;  }  input.span11, textarea.span11, .uneditable-input.span11 {    width: 1060px;  }  input.span10, textarea.span10, .uneditable-input.span10 {    width: 960px;  }  input.span9, textarea.span9, .uneditable-input.span9 {    width: 860px;  }  input.span8, textarea.span8, .uneditable-input.span8 {    width: 760px;  }  input.span7, textarea.span7, .uneditable-input.span7 {    width: 660px;  }  input.span6, textarea.span6, .uneditable-input.span6 {    width: 560px;  }  input.span5, textarea.span5, .uneditable-input.span5 {    width: 460px;  }  input.span4, textarea.span4, .uneditable-input.span4 {    width: 360px;  }  input.span3, textarea.span3, .uneditable-input.span3 {    width: 260px;  }  input.span2, textarea.span2, .uneditable-input.span2 {    width: 160px;  }  input.span1, textarea.span1, .uneditable-input.span1 {    width: 60px;  }  .thumbnails {    margin-left: -30px;  }  .thumbnails > li {    margin-left: 30px;  }  .row-fluid .thumbnails {    margin-left: 0;  }}@media (max-width: 979px) {  body {    padding-top: 0;  }  .navbar-fixed-top,  .navbar-fixed-bottom {    position: static;  }  .navbar-fixed-top {    margin-bottom: 18px;  }  .navbar-fixed-bottom {    margin-top: 18px;  }  .navbar-fixed-top .navbar-inner,  .navbar-fixed-bottom .navbar-inner {    padding: 5px;  }  .navbar .container {    width: auto;    padding: 0;  }  .navbar .brand {    padding-left: 10px;    padding-right: 10px;    margin: 0 0 0 -5px;  }  .nav-collapse {    clear: both;  }  .nav-collapse .nav {    float: none;    margin: 0 0 9px;  }  .nav-collapse .nav > li {    float: none;  }  .nav-collapse .nav > li > a {    margin-bottom: 2px;  }  .nav-collapse .nav > .divider-vertical {    display: none;  }  .nav-collapse .nav .nav-header {    color: #999999;    text-shadow: none;  }  .nav-collapse .nav > li > a,  .nav-collapse .dropdown-menu a {    padding: 6px 15px;    font-weight: bold;    color: #999999;    -webkit-border-radius: 3px;    -moz-border-radius: 3px;    border-radius: 3px;  }  .nav-collapse .btn {    padding: 4px 10px 4px;    font-weight: normal;    -webkit-border-radius: 4px;    -moz-border-radius: 4px;    border-radius: 4px;  }  .nav-collapse .dropdown-menu li + li a {    margin-bottom: 2px;  }  .nav-collapse .nav > li > a:hover,  .nav-collapse .dropdown-menu a:hover {    background-color: #222222;  }  .nav-collapse.in .btn-group {    margin-top: 5px;    padding: 0;  }  .nav-collapse .dropdown-menu {    position: static;    top: auto;    left: auto;    float: none;    display: block;    max-width: none;    margin: 0 15px;    padding: 0;    background-color: transparent;    border: none;    -webkit-border-radius: 0;    -moz-border-radius: 0;    border-radius: 0;    -webkit-box-shadow: none;    -moz-box-shadow: none;    box-shadow: none;  }  .nav-collapse .dropdown-menu:before,  .nav-collapse .dropdown-menu:after {    display: none;  }  .nav-collapse .dropdown-menu .divider {    display: none;  }  .nav-collapse .navbar-form,  .nav-collapse .navbar-search {    float: none;    padding: 9px 15px;    margin: 9px 0;    border-top: 1px solid #222222;    border-bottom: 1px solid #222222;    -webkit-box-shadow: inset 0 1px 0 rgba(255,255,255,.1), 0 1px 0 rgba(255,255,255,.1);    -moz-box-shadow: inset 0 1px 0 rgba(255,255,255,.1), 0 1px 0 rgba(255,255,255,.1);    box-shadow: inset 0 1px 0 rgba(255,255,255,.1), 0 1px 0 rgba(255,255,255,.1);  }  .navbar .nav-collapse .nav.pull-right {    float: none;    margin-left: 0;  }  .nav-collapse,  .nav-collapse.collapse {    overflow: hidden;    height: 0;  }  .navbar .btn-navbar {    display: block;  }  .navbar-static .navbar-inner {    padding-left: 10px;    padding-right: 10px;  }}@media (min-width: 980px) {  .nav-collapse.collapse {    height: auto !important;    overflow: visible !important;  }}

    Read the article

  • Jquery Accordion : set action to a specific element inside header

    - by J.Tay
    by default, if we have something like this as a Header in jQuery Accordion : <h3> <div class="1">TEXT</div> <div class="2">ICON</div> <div class="3">BUTTON</div> </h3> by clicking anywhere on this , accordion works and toggle the next element and ... the question is , how can we set an option and select a specific element ( like: 'div' with class '1' ) to click on it to and toggle the accordion. i mean i don't want the whole Header remain click able. i just want to click on a icon or div o something inside the header and toggle open/close the accordion. thank you Update 1 : HTML : <div id="testAcc"> <h3> <div class="one">Text</div> <div class="two">Icon</div> <div class="three">Button</div> </h3> <div class="accBody"> text text text text text text text text text text </div> <h3> <div class="one">Text</div> <div class="two">Icon</div> <div class="three">Button</div> </h3> <div class="accBody"> text text text text text text text text text text </div> </div> JS : $('#testAcc').accordion({ autoHeight: false, header: 'h3', collapsible: 'ture', }); this codes working fine. but i want to use something like ( header: 'h3.one' ) means i want to set a specific class and element inside the header , then if user click ONLY on that element, the accordion will open or close ...

    Read the article

  • Filter rule for SMS / text messages in exchange active sync (SMS sync)

    - by kynan
    Exchange server 2010 introduces SMS Sync (via exchange active sync), which works fine with my android device and the Samsung email app. However, all text messages are synced to my exchange inbox, which is a pain. I'd like to have them filtered to a specific folder. So far, I haven't figured out a useful filter rule for achieving that, since there seems to be no header indicating it's a text message. Has anyone managed to do that? Note that I'm not using Outlook as an email client, so I'm specifically looking for a server-side rule.

    Read the article

  • Mac OSX: Adobe Flash player 10.1.85.3 text issue

    - by sparkey
    Running Flash Player 10.1.85.3. on OS-X 10.6.4 I've run into a very strange issue with Adobe/Macromedia Flash. Text in dialogs sometimes is not displayed, and the containing boxes are distorted. It occurs in all browsers. This is best demonstrated on YouTube in some of their ads, as well as in Google Analytics overlays on graphs. You can see the issue here: As you can see, where I have moused over the high point, there should be a dialog with some text, but instead it is quite broken. I've tried uninstalling and reinstalling the Flash plugin several times, reinstalling Google Chrome, validating my fonts with FontBook (removed all dupes/ fonts with warnings). Also as a last resort I checked/ repaired perms on my disk. What should I do?

    Read the article

  • Windows apps keep switching to accented text

    - by Josh Kelley
    Somehow I keep hitting a shortcut key (or something similar) that enables the input of accented text. Whenever this accented text mode is enabled, pressing ' doesn't respond immediately; instead, the ' key is remembered, so if I press a vowel after that, I get the vowel with an acute accent mark, and if I press any other key, I immediately get an apostrophe followed by the other key. I don't want this to happen. It's very annoying. How do I disable this mode? I only remember seeing this in Firefox 3.6.3 and Pidgin 2.6.6, so maybe it's a GTK feature. It apparently happens on a per-application basis, and restarting the application fixes it. I checked Windows 7's "Region and Language" control panel and didn't see anything relevant (although I'm not intimately familiar with all of those settings, so I may have overlooked something).

    Read the article

  • Text template or tool for documentation of computer configurations

    - by mjustin
    I regularly write and update technical documentation which will be used to set up a new virtual machine, or to have a lookup for system dependencies in networks with around 20-50 (server-side) computers. At the moment I use OpenOffice Writer with text tables, and create one document per intranet domain. To improve this documentation, I would like to collect some examples to identify areas where my documents can be improved, regarding general structure and content, to make it easy to read and use not only for me but also for technical staff, helpdesk etc. Are there simple text templates (for example for OpenOffice Writer) or tools (maybe database-driven) for structured documentation of a computer configuration? Such a template / tool should provide required and optional configuration sections, like 'operating system', 'installed services', 'mapped network drives', 'scheduled tasks', 'remote servers', 'logon user account', 'firewall settings', 'hard disk size' ... It is not so much low-level hardware docs but more infrastructure / integration information in these documents (no BIOS settings, MAC addresses).

    Read the article

  • How to color highlight text in a black/white document easily

    - by Lateron
    I am editing a 96 chapter book. The text is in normal black letters on a white background. What I want to be able to do is: I want to have any changes or additions automatically shown in another (per-selected) color. Without having to a)high lite a word or phrase to be changed or added and then b)going to the toolbar and clicking on the font color In other words I want the original color of the text to remain as it is and any additions or changes to be visible in another color without having to use the toolbar. Can this be done? I use OpenOffice or Word 2007 in Windows 7.

    Read the article

  • Text on Cisco ASA console is garbled/missing letters

    - by Some Linux Nerd
    I've actually looked up a number of solutions for this problem and none of them work. There's this Cisco ASA 5505 that I'd like to use, that outputs mildly garbled text with missing characters. I did some googling and found that the most likely problem is a bad baud rate, so I tried all the baud rates, 7N1, 8N2... basically every possibility minicom had. Then I figured (since I can type ok, just not read) that if I factory reset it that it would fix whatever is set wrong with the terminal. That didn't work either. This usb-db9 adapter and console cable work fine on the catalyst switch in our office. My serial settings are 9600 8N1 with no flow control. Anyone know how to fix this? I have an example of the text on pastebin: http://pastebin.com/MAJF0mVU - it's just lots of "Dfaut cnfiuraionfil cotais 1enty." instead of "Default configuration blah blah"

    Read the article

  • SQL Server 2008 R2 Writing To Text File

    - by zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz
    I used to write to text files from SQL Server using the code listed below: DECLARE @FS INT --File System Object DECLARE @OLEResult INT --Result message/code DECLARE @FileID INT --Pointer to file --Create file system object (OLE Object) EXECUTE @OLEResult = sp_OACreate 'Scripting.FileSystemObject', @FS OUT IF @OLEResult <> 0 PRINT 'Scripting.FileSystemObject.Failed' -----OPEN FILE----- EXECUTE @OLEResult = sp_OAMethod @FS, 'OpenTextFile', @FileID OUT, @FileName, 8, 1 IF @OLEResult <> 0 PRINT 'OpenTextFile.Failed' It appears this is no longer supported in sql server 2008 r2. How should I export to text files in sql server 2008 r2? Link claiming this is no longer supported: http://social.msdn.microsoft.com/Forums/en/transactsql/thread/f8512bec-915c-44a2-ba9d-e679f98ba313

    Read the article

  • Converting PDF portfolios to plain text (pdftotext?)

    - by Andrea
    I am trying to convert a large number of PDFs (~15000) to plain text using pdftotext. This is working pretty well except for a few of the PDFs (~600) which, I guess, are "PDF portfolios." When I run these PDFs through pdftotext, it just outputs: For the best experience, open this PDF portfolio in Acrobat 9 or Adobe Reader 9, or later. Get Adobe Reader Now! If I do open these PDFs in Adobe Reader, they look like two or more PDFs inside a single file. Has anyone encountered this issue before? Is there any tool I can use to convert these PDFs automatically? (Either directly to text or at least to regular PDFs that pdftotext can then understand.)

    Read the article

  • Replace special text with sed?

    - by user143822
    I'm using CMD on Windows Xp to replace special text with Sed. I'm using this command for replace special characters like $ or * : sed -i "s/\*/123/g;" 1.txt But how command must i use to replace this strings with ciao! in my text files? Is possible? \\ \\\ "" sed.exe -i "s/{\*)(//123/ sed -i "s/\\/123/g;" 1.txt the previous command does not work because i have \, " and other special strings that sed use to make regex.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Create text file named after a cell containing other cell data

    - by user143041
    I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

    Read the article

  • How to put text in same row but different column if a certain text is present in the same row?

    - by melai
    How can I put text in the same row but different column if a certain text is present in the same row? Issue Area Correction Done Process changed bin Process skip lap converted to global Security done global migration Process changed bin How can I code this in a macro? For example: If the correction done is in the cell, the Issue should be Process automatically. If the word global is present the Issue should be Security. I have 500 rows and I want to have the code until row 500.

    Read the article

  • Why does Chrome show overlapping text?

    - by dog44wgm
    In Chrome, news articles at: http://www.theprovince.com with a leading photo and caption show the caption text overlapped with the body text. I have an image but as a new user here I'm not allowed to upload it. It happens at that site almost always, here's an example from today: http://www.theprovince.com/sports/Canucks+Blackhawks+collision+Titanic+proportions/5721421/story.html It rarely happens elsewhere. The same link works fine in Internet Explorer so I'm guessing it's a Chrome issue. It's been like this for many months, I read the site almost everyday. I click on "Print this Article" to get a proper look at it, but it's annoying, hope someone has the answer. Thanks in advance.

    Read the article

  • Format text to 5 chars from a number

    - by Wheelersg
    In Access, I used a query to sum some numbers and appended the answer to another table(table2). Now I need to export the number as a text with 5 positions but can't seem to get it to hard code all 5 positions. I have it formatted as text, field length 5, custom foramt "00000" (also tried @@@@@). Example: 3 + 3 + 1 = 7. THen append the 7 to table2. It always shows as 7. I need it to shows as 00007.

    Read the article

  • ASP.NET Podcast Show #148 - ASP.NET WebForms to build a Mobile Web Application

    - by Wallym
    Check the podcast site for the original url. This is the video and source code for an ASP.NET WebForms app that I wrote that is optimized for the iPhone and mobile environments.  Subscribe to everything. Subscribe to WMV. Subscribe to M4V for iPhone/iPad. Subscribe to MP3. Download WMV. Download M4V for iPhone/iPad. Download MP3. Link to iWebKit. Source Code: <%@ Page Title="MapSplore" Language="C#" MasterPageFile="iPhoneMaster.master" AutoEventWireup="true" CodeFile="Default.aspx.cs" Inherits="AT_iPhone_Default" %> <asp:Content ID="Content1" ContentPlaceHolderID="head" Runat="Server"></asp:Content><asp:Content ID="Content2" ContentPlaceHolderID="Content" Runat="Server" ClientIDMode="Static">    <asp:ScriptManager ID="sm" runat="server"         EnablePartialRendering="true" EnableHistory="false" EnableCdn="true" />    <script type="text/javascript" src="http://maps.google.com/maps/api/js?sensor=true"></script>    <script  language="javascript"  type="text/javascript">    <!--    Sys.WebForms.PageRequestManager.getInstance().add_endRequest(endRequestHandle);    function endRequestHandle(sender, Args) {        setupMapDiv();        setupPlaceIveBeen();    }    function setupPlaceIveBeen() {        var mapPlaceIveBeen = document.getElementById('divPlaceIveBeen');        if (mapPlaceIveBeen != null) {            var PlaceLat = document.getElementById('<%=hdPlaceIveBeenLatitude.ClientID %>').value;            var PlaceLon = document.getElementById('<%=hdPlaceIveBeenLongitude.ClientID %>').value;            var PlaceTitle = document.getElementById('<%=lblPlaceIveBeenName.ClientID %>').innerHTML;            var latlng = new google.maps.LatLng(PlaceLat, PlaceLon);            var myOptions = {                zoom: 14,                center: latlng,                mapTypeId: google.maps.MapTypeId.ROADMAP            };            var map = new google.maps.Map(mapPlaceIveBeen, myOptions);            var marker = new google.maps.Marker({                position: new google.maps.LatLng(PlaceLat, PlaceLon),                map: map,                title: PlaceTitle,                clickable: false            });        }    }    function setupMapDiv() {        var mapdiv = document.getElementById('divImHere');        if (mapdiv != null) {            var PlaceLat = document.getElementById('<%=hdPlaceLat.ClientID %>').value;            var PlaceLon = document.getElementById('<%=hdPlaceLon.ClientID %>').value;            var PlaceTitle = document.getElementById('<%=hdPlaceTitle.ClientID %>').value;            var latlng = new google.maps.LatLng(PlaceLat, PlaceLon);            var myOptions = {                zoom: 14,                center: latlng,                mapTypeId: google.maps.MapTypeId.ROADMAP            };            var map = new google.maps.Map(mapdiv, myOptions);            var marker = new google.maps.Marker({                position: new google.maps.LatLng(PlaceLat, PlaceLon),                map: map,                title: PlaceTitle,                clickable: false            });        }     }    -->    </script>    <asp:HiddenField ID="Latitude" runat="server" />    <asp:HiddenField ID="Longitude" runat="server" />    <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1/jquery.min.js%22%3E%3C/script>    <script language="javascript" type="text/javascript">        $(document).ready(function () {            GetLocation();            setupMapDiv();            setupPlaceIveBeen();        });        function GetLocation() {            if (navigator.geolocation != null) {                navigator.geolocation.getCurrentPosition(getData);            }            else {                var mess = document.getElementById('<%=Message.ClientID %>');                mess.innerHTML = "Sorry, your browser does not support geolocation. " +                    "Try the latest version of Safari on the iPhone, Android browser, or the latest version of FireFox.";            }        }        function UpdateLocation_Click() {            GetLocation();        }        function getData(position) {            var latitude = position.coords.latitude;            var longitude = position.coords.longitude;            var hdLat = document.getElementById('<%=Latitude.ClientID %>');            var hdLon = document.getElementById('<%=Longitude.ClientID %>');            hdLat.value = latitude;            hdLon.value = longitude;        }    </script>    <asp:Label ID="Message" runat="server" />    <asp:UpdatePanel ID="upl" runat="server">        <ContentTemplate>    <asp:Panel ID="pnlStart" runat="server" Visible="true">    <div id="topbar">        <div id="title">MapSplore</div>    </div>    <div id="content">        <ul class="pageitem">            <li class="menu">                <asp:LinkButton ID="lbLocalDeals" runat="server" onclick="lbLocalDeals_Click">                <asp:Image ID="imLocalDeals" runat="server" ImageUrl="~/Images/ArtFavor_Money_Bag_Icon.png" Height="30" />                <span class="name">Local Deals.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbLocalPlaces" runat="server" onclick="lbLocalPlaces_Click">                <asp:Image ID="imLocalPlaces" runat="server" ImageUrl="~/Images/Andy_Houses_on_the_horizon_-_Starburst_remix.png" Height="30" />                <span class="name">Local Places.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbWhereIveBeen" runat="server" onclick="lbWhereIveBeen_Click">                <asp:Image ID="imImHere" runat="server" ImageUrl="~/Images/ryanlerch_flagpole.png" Height="30" />                <span class="name">I've been here.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbMyStats" runat="server">                <asp:Image ID="imMyStats" runat="server" ImageUrl="~/Images/Anonymous_Spreadsheet.png" Height="30" />                <span class="name">My Stats.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbAddAPlace" runat="server" onclick="lbAddAPlace_Click">                <asp:Image ID="imAddAPlace" runat="server" ImageUrl="~/Images/jean_victor_balin_add.png" Height="30" />                <span class="name">Add a Place.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="button">                <input type="button" value="Update Your Current Location" onclick="UpdateLocation_Click()">                </li>        </ul>    </div>    </asp:Panel>    <div>    <asp:Panel ID="pnlCoupons" runat="server" Visible="false">        <div id="topbar">        <div id="title">MapSplore</div>        <div id="leftbutton">            <asp:LinkButton runat="server" Text="Return"                 ID="ReturnFromDeals" OnClick="ReturnFromDeals_Click" /></div></div>    <div class="content">    <asp:ListView ID="lvCoupons" runat="server">        <LayoutTemplate>            <ul class="pageitem" runat="server">                <asp:PlaceHolder ID="itemPlaceholder" runat="server" />            </ul>        </LayoutTemplate>        <ItemTemplate>            <li class="menu">                <asp:LinkButton ID="lbBusiness" runat="server" Text='<%#Eval("Place.Name") %>' OnClick="lbBusiness_Click">                    <span class="comment">                    <asp:Label ID="lblAddress" runat="server" Text='<%#Eval("Place.Address1") %>' />                    <asp:Label ID="lblDis" runat="server" Text='<%# Convert.ToString(Convert.ToInt32(Eval("Place.Distance"))) + " meters" %>' CssClass="smallText" />                    <asp:HiddenField ID="hdPlaceId" runat="server" Value='<%#Eval("PlaceId") %>' />                    <asp:HiddenField ID="hdGeoPromotionId" runat="server" Value='<%#Eval("GeoPromotionId") %>' />                    </span>                    <span class="arrow"></span>                </asp:LinkButton></li></ItemTemplate></asp:ListView><asp:GridView ID="gvCoupons" runat="server" AutoGenerateColumns="false">            <HeaderStyle BackColor="Silver" />            <AlternatingRowStyle BackColor="Wheat" />            <Columns>                <asp:TemplateField AccessibleHeaderText="Business" HeaderText="Business">                    <ItemTemplate>                        <asp:Image ID="imPlaceType" runat="server" Text='<%#Eval("Type") %>' ImageUrl='<%#Eval("Image") %>' />                        <asp:LinkButton ID="lbBusiness" runat="server" Text='<%#Eval("Name") %>' OnClick="lbBusiness_Click" />                        <asp:LinkButton ID="lblAddress" runat="server" Text='<%#Eval("Address1") %>' CssClass="smallText" />                        <asp:Label ID="lblDis" runat="server" Text='<%# Convert.ToString(Convert.ToInt32(Eval("Distance"))) + " meters" %>' CssClass="smallText" />                        <asp:HiddenField ID="hdPlaceId" runat="server" Value='<%#Eval("PlaceId") %>' />                        <asp:HiddenField ID="hdGeoPromotionId" runat="server" Value='<%#Eval("GeoPromotionId") %>' />                        <asp:Label ID="lblInfo" runat="server" Visible="false" />                    </ItemTemplate>                </asp:TemplateField>            </Columns>        </asp:GridView>    </div>    </asp:Panel>    <asp:Panel ID="pnlPlaces" runat="server" Visible="false">    <div id="topbar">        <div id="title">            MapSplore</div><div id="leftbutton">            <asp:LinkButton runat="server" Text="Return"                 ID="ReturnFromPlaces" OnClick="ReturnFromPlaces_Click" /></div></div>        <div id="content">        <asp:ListView ID="lvPlaces" runat="server">            <LayoutTemplate>                <ul id="ulPlaces" class="pageitem" runat="server">                    <asp:PlaceHolder ID="itemPlaceholder" runat="server" />                    <li class="menu">                        <asp:LinkButton ID="lbNotListed" runat="server" CssClass="name"                            OnClick="lbNotListed_Click">                            Place not listed                            <span class="arrow"></span>                            </asp:LinkButton>                    </li>                </ul>            </LayoutTemplate>            <ItemTemplate>            <li class="menu">                <asp:LinkButton ID="lbImHere" runat="server" CssClass="name"                     OnClick="lbImHere_Click">                <%#DisplayName(Eval("Name")) %>&nbsp;                <%# Convert.ToString(Convert.ToInt32(Eval("Distance"))) + " meters" %>                <asp:HiddenField ID="hdPlaceId" runat="server" Value='<%#Eval("PlaceId") %>' />                <span class="arrow"></span>                </asp:LinkButton></li></ItemTemplate></asp:ListView>    </div>    </asp:Panel>    <asp:Panel ID="pnlImHereNow" runat="server" Visible="false">        <div id="topbar">        <div id="title">            MapSplore</div><div id="leftbutton">            <asp:LinkButton runat="server" Text="Places"                 ID="lbImHereNowReturn" OnClick="lbImHereNowReturn_Click" /></div></div>            <div id="rightbutton">            <asp:LinkButton runat="server" Text="Beginning"                ID="lbBackToBeginning" OnClick="lbBackToBeginning_Click" />            </div>        <div id="content">        <ul class="pageitem">        <asp:HiddenField ID="hdPlaceId" runat="server" />        <asp:HiddenField ID="hdPlaceLat" runat="server" />        <asp:HiddenField ID="hdPlaceLon" runat="server" />        <asp:HiddenField ID="hdPlaceTitle" runat="server" />        <asp:Button ID="btnImHereNow" runat="server"             Text="I'm here" OnClick="btnImHereNow_Click" />             <asp:Label ID="lblPlaceTitle" runat="server" /><br />        <asp:TextBox ID="txtWhatsHappening" runat="server" TextMode="MultiLine" Rows="2" style="width:300px" /><br />        <div id="divImHere" style="width:300px; height:300px"></div>        </div>        </ul>    </asp:Panel>    <asp:Panel runat="server" ID="pnlIveBeenHere" Visible="false">        <div id="topbar">        <div id="title">            Where I've been</div><div id="leftbutton">            <asp:LinkButton ID="lbIveBeenHereBack" runat="server" Text="Back" OnClick="lbIveBeenHereBack_Click" /></div></div>        <div id="content">        <asp:ListView ID="lvWhereIveBeen" runat="server">            <LayoutTemplate>                <ul id="ulWhereIveBeen" class="pageitem" runat="server">                    <asp:PlaceHolder ID="itemPlaceholder" runat="server" />                </ul>            </LayoutTemplate>            <ItemTemplate>            <li class="menu" runat="server">                <asp:LinkButton ID="lbPlaceIveBeen" runat="server" OnClick="lbPlaceIveBeen_Click" CssClass="name">                    <asp:Label ID="lblPlace" runat="server" Text='<%#Eval("PlaceName") %>' /> at                    <asp:Label ID="lblTime" runat="server" Text='<%#Eval("ATTime") %>' CssClass="content" />                    <asp:HiddenField ID="hdATID" runat="server" Value='<%#Eval("ATID") %>' />                    <span class="arrow"></span>                </asp:LinkButton>            </li>            </ItemTemplate>        </asp:ListView>        </div>        </asp:Panel>    <asp:Panel runat="server" ID="pnlPlaceIveBeen" Visible="false">        <div id="topbar">        <div id="title">            I've been here        </div>        <div id="leftbutton">            <asp:LinkButton ID="lbPlaceIveBeenBack" runat="server" Text="Back" OnClick="lbPlaceIveBeenBack_Click" />        </div>        <div id="rightbutton">            <asp:LinkButton ID="lbPlaceIveBeenBeginning" runat="server" Text="Beginning" OnClick="lbPlaceIveBeenBeginning_Click" />        </div>        </div>        <div id="content">            <ul class="pageitem">            <li>            <asp:HiddenField ID="hdPlaceIveBeenPlaceId" runat="server" />            <asp:HiddenField ID="hdPlaceIveBeenLatitude" runat="server" />            <asp:HiddenField ID="hdPlaceIveBeenLongitude" runat="server" />            <asp:Label ID="lblPlaceIveBeenName" runat="server" /><br />            <asp:Label ID="lblPlaceIveBeenAddress" runat="server" /><br />            <asp:Label ID="lblPlaceIveBeenCity" runat="server" />,             <asp:Label ID="lblPlaceIveBeenState" runat="server" />            <asp:Label ID="lblPlaceIveBeenZipCode" runat="server" /><br />            <asp:Label ID="lblPlaceIveBeenCountry" runat="server" /><br />            <div id="divPlaceIveBeen" style="width:300px; height:300px"></div>            </li>            </ul>        </div>                </asp:Panel>         <asp:Panel ID="pnlAddPlace" runat="server" Visible="false">                <div id="topbar"><div id="title">MapSplore</div><div id="leftbutton"><asp:LinkButton ID="lbAddPlaceReturn" runat="server" Text="Back" OnClick="lbAddPlaceReturn_Click" /></div><div id="rightnav"></div></div><div id="content">    <ul class="pageitem">        <li id="liPlaceAddMessage" runat="server" visible="false">        <asp:Label ID="PlaceAddMessage" runat="server" />        </li>        <li class="bigfield">        <asp:TextBox ID="txtPlaceName" runat="server" placeholder="Name of Establishment" />        </li>        <li class="bigfield">        <asp:TextBox ID="txtAddress1" runat="server" placeholder="Address 1" />        </li>        <li class="bigfield">        <asp:TextBox ID="txtCity" runat="server" placeholder="City" />        </li>        <li class="select">        <asp:DropDownList ID="ddlProvince" runat="server" placeholder="Select State" />          <span class="arrow"></span>              </li>        <li class="bigfield">        <asp:TextBox ID="txtZipCode" runat="server" placeholder="Zip Code" />        </li>        <li class="select">        <asp:DropDownList ID="ddlCountry" runat="server"             onselectedindexchanged="ddlCountry_SelectedIndexChanged" />        <span class="arrow"></span>        </li>        <li class="bigfield">        <asp:TextBox ID="txtPhoneNumber" runat="server" placeholder="Phone Number" />        </li>        <li class="checkbox">            <span class="name">You Here Now:</span> <asp:CheckBox ID="cbYouHereNow" runat="server" Checked="true" />        </li>        <li class="button">        <asp:Button ID="btnAdd" runat="server" Text="Add Place"             onclick="btnAdd_Click" />        </li>    </ul></div>        </asp:Panel>        <asp:Panel ID="pnlImHere" runat="server" Visible="false">            <asp:TextBox ID="txtImHere" runat="server"                 TextMode="MultiLine" Rows="3" Columns="40" /><br />            <asp:DropDownList ID="ddlPlace" runat="server" /><br />            <asp:Button ID="btnHere" runat="server" Text="Tell Everyone I'm Here"                 onclick="btnHere_Click" /><br />        </asp:Panel>     </div>    </ContentTemplate>    </asp:UpdatePanel> </asp:Content> Code Behind .cs file: using System;using System.Collections.Generic;using System.Linq;using System.Web;using System.Web.Security;using System.Web.UI;using System.Web.UI.HtmlControls;using System.Web.UI.WebControls;using LocationDataModel; public partial class AT_iPhone_Default : ViewStatePage{    private iPhoneDevice ipd;     protected void Page_Load(object sender, EventArgs e)    {        LocationDataEntities lde = new LocationDataEntities();        if (!Page.IsPostBack)        {            var Countries = from c in lde.Countries select c;            foreach (Country co in Countries)            {                ddlCountry.Items.Add(new ListItem(co.Name, co.CountryId.ToString()));            }            ddlCountry_SelectedIndexChanged(ddlCountry, null);            if (AppleIPhone.IsIPad())                ipd = iPhoneDevice.iPad;            if (AppleIPhone.IsIPhone())                ipd = iPhoneDevice.iPhone;            if (AppleIPhone.IsIPodTouch())                ipd = iPhoneDevice.iPodTouch;        }    }    protected void btnPlaces_Click(object sender, EventArgs e)    {    }    protected void btnAdd_Click(object sender, EventArgs e)    {        bool blImHere = cbYouHereNow.Checked;        string Place = txtPlaceName.Text,            Address1 = txtAddress1.Text,            City = txtCity.Text,            ZipCode = txtZipCode.Text,            PhoneNumber = txtPhoneNumber.Text,            ProvinceId = ddlProvince.SelectedItem.Value,            CountryId = ddlCountry.SelectedItem.Value;        int iProvinceId, iCountryId;        double dLatitude, dLongitude;        DataAccess da = new DataAccess();        if ((!String.IsNullOrEmpty(ProvinceId)) &&            (!String.IsNullOrEmpty(CountryId)))        {            iProvinceId = Convert.ToInt32(ProvinceId);            iCountryId = Convert.ToInt32(CountryId);            if (blImHere)            {                dLatitude = Convert.ToDouble(Latitude.Value);                dLongitude = Convert.ToDouble(Longitude.Value);                da.StorePlace(Place, Address1, String.Empty, City,                    iProvinceId, ZipCode, iCountryId, PhoneNumber,                    dLatitude, dLongitude);            }            else            {                da.StorePlace(Place, Address1, String.Empty, City,                    iProvinceId, ZipCode, iCountryId, PhoneNumber);            }            liPlaceAddMessage.Visible = true;            PlaceAddMessage.Text = "Awesome, your place has been added. Add Another!";            txtPlaceName.Text = String.Empty;            txtAddress1.Text = String.Empty;            txtCity.Text = String.Empty;            ddlProvince.SelectedIndex = -1;            txtZipCode.Text = String.Empty;            txtPhoneNumber.Text = String.Empty;        }        else        {            liPlaceAddMessage.Visible = true;            PlaceAddMessage.Text = "Please select a State and a Country.";        }    }    protected void ddlCountry_SelectedIndexChanged(object sender, EventArgs e)    {        string CountryId = ddlCountry.SelectedItem.Value;        if (!String.IsNullOrEmpty(CountryId))        {            int iCountryId = Convert.ToInt32(CountryId);            LocationDataModel.LocationDataEntities lde = new LocationDataModel.LocationDataEntities();            var prov = from p in lde.Provinces where p.CountryId == iCountryId                        orderby p.ProvinceName select p;                        ddlProvince.Items.Add(String.Empty);            foreach (Province pr in prov)            {                ddlProvince.Items.Add(new ListItem(pr.ProvinceName, pr.ProvinceId.ToString()));            }        }        else        {            ddlProvince.Items.Clear();        }    }    protected void btnImHere_Click(object sender, EventArgs e)    {        int i = 0;        DataAccess da = new DataAccess();        double Lat = Convert.ToDouble(Latitude.Value),            Lon = Convert.ToDouble(Longitude.Value);        List<Place> lp = da.NearByLocations(Lat, Lon);        foreach (Place p in lp)        {            ListItem li = new ListItem(p.Name, p.PlaceId.ToString());            if (i == 0)            {                li.Selected = true;            }            ddlPlace.Items.Add(li);            i++;        }        pnlAddPlace.Visible = false;        pnlImHere.Visible = true;    }    protected void lbImHere_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        ListViewItem lvi = (ListViewItem)(((LinkButton)sender).Parent);        HiddenField hd = (HiddenField)lvi.FindControl("hdPlaceId");        long PlaceId = Convert.ToInt64(hd.Value);        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        Place pl = da.GetPlace(PlaceId);        pnlImHereNow.Visible = true;        pnlPlaces.Visible = false;        hdPlaceId.Value = PlaceId.ToString();        hdPlaceLat.Value = pl.Latitude.ToString();        hdPlaceLon.Value = pl.Longitude.ToString();        hdPlaceTitle.Value = pl.Name;        lblPlaceTitle.Text = pl.Name;    }    protected void btnHere_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        string WhatsH = txtImHere.Text;        long PlaceId = Convert.ToInt64(ddlPlace.SelectedValue);        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        da.StoreUserAT(UserName, PlaceId, WhatsH,            dLatitude, dLongitude);    }    protected void btnLocalCoupons_Click(object sender, EventArgs e)    {        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();     }    protected void lbBusiness_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        GridViewRow gvr = (GridViewRow)(((LinkButton)sender).Parent.Parent);        HiddenField hd = (HiddenField)gvr.FindControl("hdPlaceId");        string sPlaceId = hd.Value;        Int64 PlaceId;        if (!String.IsNullOrEmpty(sPlaceId))        {            PlaceId = Convert.ToInt64(sPlaceId);        }    }    protected void lbLocalDeals_Click(object sender, EventArgs e)    {        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        pnlCoupons.Visible = true;        pnlStart.Visible = false;        List<GeoPromotion> lgp = da.NearByDeals(dLatitude, dLongitude);        lvCoupons.DataSource = lgp;        lvCoupons.DataBind();    }    protected void lbLocalPlaces_Click(object sender, EventArgs e)    {        DataAccess da = new DataAccess();        double Lat = Convert.ToDouble(Latitude.Value);        double Lon = Convert.ToDouble(Longitude.Value);        List<LocationDataModel.Place> places = da.NearByLocations(Lat, Lon);        lvPlaces.DataSource = places;        lvPlaces.SelectedIndex = -1;        lvPlaces.DataBind();        pnlPlaces.Visible = true;        pnlStart.Visible = false;    }    protected void ReturnFromPlaces_Click(object sender, EventArgs e)    {        pnlPlaces.Visible = false;        pnlStart.Visible = true;    }    protected void ReturnFromDeals_Click(object sender, EventArgs e)    {        pnlCoupons.Visible = false;        pnlStart.Visible = true;    }    protected void btnImHereNow_Click(object sender, EventArgs e)    {        long PlaceId = Convert.ToInt32(hdPlaceId.Value);        string UserName = Membership.GetUser().UserName;        string WhatsHappening = txtWhatsHappening.Text;        double UserLat = Convert.ToDouble(Latitude.Value);        double UserLon = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        da.StoreUserAT(UserName, PlaceId, WhatsHappening,             UserLat, UserLon);    }    protected void lbImHereNowReturn_Click(object sender, EventArgs e)    {        pnlImHereNow.Visible = false;        pnlPlaces.Visible = true;    }    protected void lbBackToBeginning_Click(object sender, EventArgs e)    {        pnlStart.Visible = true;        pnlImHereNow.Visible = false;    }    protected void lbWhereIveBeen_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        pnlStart.Visible = false;        pnlIveBeenHere.Visible = true;        DataAccess da = new DataAccess();        lvWhereIveBeen.DataSource = da.UserATs(UserName, 0, 15);        lvWhereIveBeen.DataBind();    }    protected void lbIveBeenHereBack_Click(object sender, EventArgs e)    {        pnlIveBeenHere.Visible = false;        pnlStart.Visible = true;    }     protected void lbPlaceIveBeen_Click(object sender, EventArgs e)    {        LinkButton lb = (LinkButton)sender;        ListViewItem lvi = (ListViewItem)lb.Parent.Parent;        HiddenField hdATID = (HiddenField)lvi.FindControl("hdATID");        Int64 ATID = Convert.ToInt64(hdATID.Value);        DataAccess da = new DataAccess();        pnlIveBeenHere.Visible = false;        pnlPlaceIveBeen.Visible = true;        var plac = da.GetPlaceViaATID(ATID);        hdPlaceIveBeenPlaceId.Value = plac.PlaceId.ToString();        hdPlaceIveBeenLatitude.Value = plac.Latitude.ToString();        hdPlaceIveBeenLongitude.Value = plac.Longitude.ToString();        lblPlaceIveBeenName.Text = plac.Name;        lblPlaceIveBeenAddress.Text = plac.Address1;        lblPlaceIveBeenCity.Text = plac.City;        lblPlaceIveBeenState.Text = plac.Province.ProvinceName;        lblPlaceIveBeenZipCode.Text = plac.ZipCode;        lblPlaceIveBeenCountry.Text = plac.Country.Name;    }     protected void lbNotListed_Click(object sender, EventArgs e)    {        SetupAddPoint();        pnlPlaces.Visible = false;    }     protected void lbAddAPlace_Click(object sender, EventArgs e)    {        SetupAddPoint();    }     private void SetupAddPoint()    {        double lat = Convert.ToDouble(Latitude.Value);        double lon = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        var zip = da.WhereAmIAt(lat, lon);        if (zip.Count > 0)        {            var z0 = zip[0];            txtCity.Text = z0.City;            txtZipCode.Text = z0.ZipCode;            ddlProvince.ClearSelection();            if (z0.ProvinceId.HasValue == true)            {                foreach (ListItem li in ddlProvince.Items)                {                    if (li.Value == z0.ProvinceId.Value.ToString())                    {                        li.Selected = true;                        break;                    }                }            }        }        pnlAddPlace.Visible = true;        pnlStart.Visible = false;    }    protected void lbAddPlaceReturn_Click(object sender, EventArgs e)    {        pnlAddPlace.Visible = false;        pnlStart.Visible = true;        liPlaceAddMessage.Visible = false;        PlaceAddMessage.Text = String.Empty;    }    protected void lbPlaceIveBeenBack_Click(object sender, EventArgs e)    {        pnlIveBeenHere.Visible = true;        pnlPlaceIveBeen.Visible = false;            }    protected void lbPlaceIveBeenBeginning_Click(object sender, EventArgs e)    {        pnlPlaceIveBeen.Visible = false;        pnlStart.Visible = true;    }    protected string DisplayName(object val)    {        string strVal = Convert.ToString(val);         if (AppleIPhone.IsIPad())        {            ipd = iPhoneDevice.iPad;        }        if (AppleIPhone.IsIPhone())        {            ipd = iPhoneDevice.iPhone;        }        if (AppleIPhone.IsIPodTouch())        {            ipd = iPhoneDevice.iPodTouch;        }        return (iPhoneHelper.DisplayContentOnMenu(strVal, ipd));    }} iPhoneHelper.cs file: using System;using System.Collections.Generic;using System.Linq;using System.Web; public enum iPhoneDevice{    iPhone, iPodTouch, iPad}/// <summary>/// Summary description for iPhoneHelper/// </summary>/// public class iPhoneHelper{ public iPhoneHelper() {  //  // TODO: Add constructor logic here  // } // This code is stupid in retrospect. Use css to solve this problem      public static string DisplayContentOnMenu(string val, iPhoneDevice ipd)    {        string Return = val;        string Elipsis = "...";        int iPadMaxLength = 30;        int iPhoneMaxLength = 15;        if (ipd == iPhoneDevice.iPad)        {            if (Return.Length > iPadMaxLength)            {                Return = Return.Substring(0, iPadMaxLength - Elipsis.Length) + Elipsis;            }        }        else        {            if (Return.Length > iPhoneMaxLength)            {                Return = Return.Substring(0, iPhoneMaxLength - Elipsis.Length) + Elipsis;            }        }        return (Return);    }}  Source code for the ViewStatePage: using System;using System.Data;using System.Data.SqlClient;using System.Configuration;using System.Web;using System.Web.Security;using System.Web.UI;using System.Web.UI.WebControls;using System.Web.UI.WebControls.WebParts;using System.Web.UI.HtmlControls; /// <summary>/// Summary description for BasePage/// </summary>#region Base class for a page.public class ViewStatePage : System.Web.UI.Page{     PageStatePersisterToDatabase myPageStatePersister;        public ViewStatePage()        : base()    {        myPageStatePersister = new PageStatePersisterToDatabase(this);    }     protected override PageStatePersister PageStatePersister    {        get        {            return myPageStatePersister;        }    } }#endregion #region This class will override the page persistence to store page state in a database.public class PageStatePersisterToDatabase : PageStatePersister{    private string ViewStateKeyField = "__VIEWSTATE_KEY";    private string _exNoConnectionStringFound = "No Database Configuration information is in the web.config.";     public PageStatePersisterToDatabase(Page page)        : base(page)    {    }     public override void Load()    {         // Get the cache key from the web form data        System.Int64 key = Convert.ToInt64(Page.Request.Params[ViewStateKeyField]);         Pair state = this.LoadState(key);         // Abort if cache object is not of type Pair        if (state == null)            throw new ApplicationException("Missing valid " + ViewStateKeyField);         // Set view state and control state        ViewState = state.First;        ControlState = state.Second;    }     public override void Save()    {         // No processing needed if no states available        if (ViewState == null && ControlState != null)            return;         System.Int64 key;        IStateFormatter formatter = this.StateFormatter;        Pair statePair = new Pair(ViewState, ControlState);         // Serialize the statePair object to a string.        string serializedState = formatter.Serialize(statePair);         // Save the ViewState and get a unique identifier back.        key = SaveState(serializedState);         // Register hidden field to store cache key in        // Page.ClientScript does not work properly with Atlas.        //Page.ClientScript.RegisterHiddenField(ViewStateKeyField, key.ToString());        ScriptManager.RegisterHiddenField(this.Page, ViewStateKeyField, key.ToString());    }     private System.Int64 SaveState(string PageState)    {        System.Int64 i64Key = 0;        string strConn = String.Empty,            strProvider = String.Empty;         string strSql = "insert into tblPageState ( SerializedState ) values ( '" + SqlEscape(PageState) + "');select scope_identity();";        SqlConnection sqlCn;        SqlCommand sqlCm;        try        {            GetDBConnectionString(ref strConn, ref strProvider);            sqlCn = new SqlConnection(strConn);            sqlCm = new SqlCommand(strSql, sqlCn);            sqlCn.Open();            i64Key = Convert.ToInt64(sqlCm.ExecuteScalar());            if (sqlCn.State != ConnectionState.Closed)            {                sqlCn.Close();            }            sqlCn.Dispose();            sqlCm.Dispose();        }        finally        {            sqlCn = null;            sqlCm = null;        }        return i64Key;    }     private Pair LoadState(System.Int64 iKey)    {        string strConn = String.Empty,            strProvider = String.Empty,            SerializedState = String.Empty,            strMinutesInPast = GetMinutesInPastToDelete();        Pair PageState;        string strSql = "select SerializedState from tblPageState where tblPageStateID=" + iKey.ToString() + ";" +            "delete from tblPageState where DateUpdated<DateAdd(mi, " + strMinutesInPast + ", getdate());";        SqlConnection sqlCn;        SqlCommand sqlCm;        try        {            GetDBConnectionString(ref strConn, ref strProvider);            sqlCn = new SqlConnection(strConn);            sqlCm = new SqlCommand(strSql, sqlCn);             sqlCn.Open();            SerializedState = Convert.ToString(sqlCm.ExecuteScalar());            IStateFormatter formatter = this.StateFormatter;             if ((null == SerializedState) ||                (String.Empty == SerializedState))            {                throw (new ApplicationException("No ViewState records were returned."));            }             // Deserilize returns the Pair object that is serialized in            // the Save method.            PageState = (Pair)formatter.Deserialize(SerializedState);             if (sqlCn.State != ConnectionState.Closed)            {                sqlCn.Close();            }            sqlCn.Dispose();            sqlCm.Dispose();        }        finally        {            sqlCn = null;            sqlCm = null;        }        return PageState;    }     private string SqlEscape(string Val)    {        string ReturnVal = String.Empty;        if (null != Val)        {            ReturnVal = Val.Replace("'", "''");        }        return (ReturnVal);    }    private void GetDBConnectionString(ref string ConnectionStringValue, ref string ProviderNameValue)    {        if (System.Configuration.ConfigurationManager.ConnectionStrings.Count > 0)        {            ConnectionStringValue = System.Configuration.ConfigurationManager.ConnectionStrings["ApplicationServices"].ConnectionString;            ProviderNameValue = System.Configuration.ConfigurationManager.ConnectionStrings["ApplicationServices"].ProviderName;        }        else        {            throw new ConfigurationErrorsException(_exNoConnectionStringFound);        }    }    private string GetMinutesInPastToDelete()    {        string strReturn = "-60";        if (null != System.Configuration.ConfigurationManager.AppSettings["MinutesInPastToDeletePageState"])        {            strReturn = System.Configuration.ConfigurationManager.AppSettings["MinutesInPastToDeletePageState"].ToString();        }        return (strReturn);    }}#endregion AppleiPhone.cs file: using System;using System.Collections.Generic;using System.Linq;using System.Web; /// <summary>/// Summary description for AppleIPhone/// </summary>public class AppleIPhone{ public AppleIPhone() {  //  // TODO: Add constructor logic here  // }     static public bool IsIPhoneOS()    {        return (IsIPad() || IsIPhone() || IsIPodTouch());    }     static public bool IsIPhone()    {        return IsTest("iPhone");    }     static public bool IsIPodTouch()    {        return IsTest("iPod");    }     static public bool IsIPad()    {        return IsTest("iPad");    }     static private bool IsTest(string Agent)    {        bool bl = false;        string ua = HttpContext.Current.Request.UserAgent.ToLower();        try        {            bl = ua.Contains(Agent.ToLower());        }        catch { }        return (bl);        }} Master page .cs: using System;using System.Collections.Generic;using System.Linq;using System.Web;using System.Web.UI;using System.Web.UI.HtmlControls;using System.Web.UI.WebControls; public partial class MasterPages_iPhoneMaster : System.Web.UI.MasterPage{    protected void Page_Load(object sender, EventArgs e)    {            HtmlHead head = Page.Header;            HtmlMeta meta = new HtmlMeta();            if (AppleIPhone.IsIPad() == true)            {                meta.Content = "width=400,user-scalable=no";                head.Controls.Add(meta);             }            else            {                meta.Content = "width=device-width, user-scalable=no";                meta.Attributes.Add("name", "viewport");            }            meta.Attributes.Add("name", "viewport");            head.Controls.Add(meta);            HtmlLink cssLink = new HtmlLink();            HtmlGenericControl script = new HtmlGenericControl("script");            script.Attributes.Add("type", "text/javascript");            script.Attributes.Add("src", ResolveUrl("~/Scripts/iWebKit/javascript/functions.js"));            head.Controls.Add(script);            cssLink.Attributes.Add("rel", "stylesheet");            cssLink.Attributes.Add("href", ResolveUrl("~/Scripts/iWebKit/css/style.css") );            cssLink.Attributes.Add("type", "text/css");            head.Controls.Add(cssLink);            HtmlGenericControl jsLink = new HtmlGenericControl("script");            //jsLink.Attributes.Add("type", "text/javascript");            //jsLink.Attributes.Add("src", ResolveUrl("~/Scripts/jquery-1.4.1.min.js") );            //head.Controls.Add(jsLink);            HtmlLink appleIcon = new HtmlLink();            appleIcon.Attributes.Add("rel", "apple-touch-icon");            appleIcon.Attributes.Add("href", ResolveUrl("~/apple-touch-icon.png"));            HtmlMeta appleMobileWebAppStatusBarStyle = new HtmlMeta();            appleMobileWebAppStatusBarStyle.Attributes.Add("name", "apple-mobile-web-app-status-bar-style");            appleMobileWebAppStatusBarStyle.Attributes.Add("content", "black");            head.Controls.Add(appleMobileWebAppStatusBarStyle);    }     internal string FindPath(string Location)    {        string Url = Server.MapPath(Location);        return (Url);    }}

    Read the article

  • Convertion of tiff image in Python script - OCR using tesseract

    - by PYTHON TEAM
    I want to convert a tiff image file to text document. My code perfectly as I expected to convert tiff images with usual font but its not working for french script font . My tiff image file contains text. The font of text is in french script format.I here is my code import Image import subprocess import util import errors tesseract_exe_name = 'tesseract' # Name of executable to be called at command line scratch_image_name = "temp.bmp" # This file must be .bmp or other Tesseract-compatible format scratch_text_name_root = "temp" # Leave out the .txt extension cleanup_scratch_flag = True # Temporary files cleaned up after OCR operation def call_tesseract(input_filename, output_filename): """Calls external tesseract.exe on input file (restrictions on types), outputting output_filename+'txt'""" args = [tesseract_exe_name, input_filename, output_filename] proc = subprocess.Popen(args) retcode = proc.wait() if retcode!=0: errors.check_for_errors() def image_to_string(im, cleanup = cleanup_scratch_flag): """Converts im to file, applies tesseract, and fetches resulting text. If cleanup=True, delete scratch files after operation.""" try: util.image_to_scratch(im, scratch_image_name) call_tesseract(scratch_image_name, scratch_text_name_root) text = util.retrieve_text(scratch_text_name_root) finally: if cleanup: util.perform_cleanup(scratch_image_name, scratch_text_name_root) return text def image_file_to_string(filename, cleanup = cleanup_scratch_flag, graceful_errors=True): If cleanup=True, delete scratch files after operation.""" try: try: call_tesseract(filename, scratch_text_name_root) text = util.retrieve_text(scratch_text_name_root) except errors.Tesser_General_Exception: if graceful_errors: im = Image.open(filename) text = image_to_string(im, cleanup) else: raise finally: if cleanup: util.perform_cleanup(scratch_image_name, scratch_text_name_root) return text if __name__=='__main__': im = Image.open("/home/oomsys/phototest.tif") text = image_to_string(im) print text try: text = image_file_to_string('fnord.tif', graceful_errors=False) except errors.Tesser_General_Exception, value: print "fnord.tif is incompatible filetype. Try graceful_errors=True" print value text = image_file_to_string('fnord.tif', graceful_errors=True) print "fnord.tif contents:", text text = image_file_to_string('fonts_test.png', graceful_errors=True) print text

    Read the article

  • wxWidgets in Code::Blocks

    - by Vlad
    Hello all, I'm trying to compile the minimal sample from the "Cross-Platform GUI Programming with wxWidgets" book but the following compile errors: ||=== minimal, Debug ===| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0x918)||undefined reference to `__Unwind_Resume' | C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0x931)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0xa96)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0xada)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0xb1e)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_datacmn.o):datacmn.cpp:(.eh_frame+0x11)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x63a)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x696)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x6f2)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x74a)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x7a2)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0x88f)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0x927)||undefined reference to `__Unwind_Resume' | C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0x9bf)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0xb8b)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0xc87)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xbc0)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xc59)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xcf5)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xda6)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xdce)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x1ff)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x257)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x2af)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x2fc)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x36d)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0x4a8)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0x73a)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0x813)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0xc06)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0xd3e)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0x970)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0xa80)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0xb8c)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0xc78)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0xd4f)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x2ef)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x32b)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x43d)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x586)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x601)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_app.o):app.cpp:(.text+0x1da)||undefined reference to `__Unwind_Resume'| ||More errors follow but not being shown.| ||Edit the max errors limit in compiler options...| ||=== Build finished: 50 errors, 0 warnings ===| Here's the code sample from the book: #include "wx/wx.h" #include "mondrian.xpm" // Declare the application class class MyApp : public wxApp { public: // Called on application startup virtual bool OnInit(); }; // Declare our main frame class class MyFrame : public wxFrame { public: // Constructor MyFrame(const wxString& title); // Event handlers void OnQuit(wxCommandEvent& event); void OnAbout(wxCommandEvent& event); private: // This class handles events DECLARE_EVENT_TABLE() }; // Implements MyApp& GetApp() DECLARE_APP(MyApp) // Give wxWidgets the means to create a MyApp object IMPLEMENT_APP(MyApp) // Initialize the application bool MyApp::OnInit() { // Create the main application window MyFrame *frame = new MyFrame(wxT("Minimal wxWidgets App")); // Show it frame->Show(true); // Start the event loop return true; } // Event table for MyFrame BEGIN_EVENT_TABLE(MyFrame, wxFrame) EVT_MENU(wxID_ABOUT, MyFrame::OnAbout) EVT_MENU(wxID_EXIT, MyFrame::OnQuit) END_EVENT_TABLE() void MyFrame::OnAbout(wxCommandEvent& event) { wxString msg; msg.Printf(wxT("Hello and welcome to %s"), wxVERSION_STRING); wxMessageBox(msg, wxT("About Minimal"), wxOK | wxICON_INFORMATION, this); } void MyFrame::OnQuit(wxCommandEvent& event) { // Destroy the frame Close(); } MyFrame::MyFrame(const wxString& title) : wxFrame(NULL, wxID_ANY, title) { // Set the frame icon SetIcon(wxIcon(mondrian_xpm)); // Create a menu bar wxMenu *fileMenu = new wxMenu; // The “About” item should be in the help menu wxMenu *helpMenu = new wxMenu; helpMenu->Append(wxID_ABOUT, wxT("&About...\tF1"), wxT("Show about dialog")); fileMenu->Append(wxID_EXIT, wxT("E&xit\tAlt-X"), wxT("Quit this program")); // Now append the freshly created menu to the menu bar... wxMenuBar *menuBar = new wxMenuBar(); menuBar->Append(fileMenu, wxT("&File")); menuBar->Append(helpMenu, wxT("&Help")); // ... and attach this menu bar to the frame SetMenuBar(menuBar); // Create a status bar just for fun CreateStatusBar(2); SetStatusText(wxT("Welcome to wxWidgets!")); } So what's happenning? Thanks! P.S.: I installed wxWidgets through wxPack wich afaik comes with everything precomplied and i also added the wxWidgets directory to Global variables-base in Code::Blocks so everything should be correctly set, right?

    Read the article

  • How do i select the preceding nodes of a text node starting from a specific node and not the root no

    - by Rachel
    How do i select the preceding nodes of a text node starting from a specific node whose id i know instead of getting the text nodes from the root node? When i invoke the below piece from a template match of text node, I get all the preceding text nodes from the root. I want to modify the above piece of code to select only the text nodes that appear after the node having a specific id say 123. i.e something like //*[@id='123'] <xsl:template match="text()[. is $text-to-split]"> <xsl:variable name="split-index" as="xsd:integer" select="$index - sum(preceding::text()/string-length(.))"/> <xsl:value-of select="substring(., 1, $split-index - 1)"/> <xsl:copy-of select="$new"/> <xsl:value-of select="substring(., $split-index)"/> </xsl:template> <xsl:variable name="text-to-split" as="text()?" select="descendant::text()[sum((preceding::text(), .)/string-length(.)) ge $index][1]"/> How do i include the condition in places where i use preceding::text inorder to select preceding text nodes relative to the specific node's id which i know?

    Read the article

< Previous Page | 62 63 64 65 66 67 68 69 70 71 72 73  | Next Page >