Search Results

Search found 88829 results on 3554 pages for 'new office'.

Page 668/3554 | < Previous Page | 664 665 666 667 668 669 670 671 672 673 674 675  | Next Page >

• I cannot access my flickr account

  - by AtanuCSE

  I was using Google account to log in to my Flickr. After several days, I entered into the Flickr account and found out that Flickr is moving into only Yahoo login. So I tried the Google login and it shows This account is not connected with any Yahoo account. Sign up for new........ or use existing etc... Can't remember the exact words. So I provided my Yahoo mail credentials. Now every time it is giving me a brand new account, rather taking me to my previous Flickr account. I can view the previous account photos, but After going there, it treated me as a outsider. New account showing me that I've not uploaded any photo. What's wrong? How can I connect with my previous account?

  Read the article

• Do I have a bad SD card?

  - by User1

  I'm trying to copy data from my computer to an SD card. After a few hundred megs, I keep getting the following errors in dmesg: [34542.836192] end_request: I/O error, dev mmcblk0, sector 855936 [34542.836284] FAT: unable to read inode block for updating (i_pos 13694981) [34542.836306] MMC: killing requests for dead queue [34542.836310] end_request: I/O error, dev mmcblk0, sector 9280 [34542.837035] FAT: unable to read inode block for updating (i_pos 148486) [34542.837062] MMC: killing requests for dead queue [34542.837066] end_request: I/O error, dev mmcblk0, sector 1 [34542.837074] FAT: bread failed in fat_clusters_flush [34542.837085] MMC: killing requests for dead queue These were all files I copied from a smaller SD card. I just want to transfer them to my new, larger card for my phone. I tried the same experiment with different files on a different machine and the card failed again. Reading data from the old card went fine. My systems are older and the new SD card is new (16GB Class 4). Could this be that my computers are too old? Is there a definitive test to verify if my SD card is bad?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Moving Domain Controller Guests between Hyper-V Hosts

  - by Jim

  We're moving our domain controller to a new Hyper-V host. I read it on TechNet about not using export on a VM running as DC (although I saw a lot of answers on TechNet suggesting doing so to move DC). What we plan to do is shutdown the VM, move the VHD to the new Hyper-V host, then create a new VM using that VHD. I don't think USN rollback would occur since it's like shutting down the VM and starting it back up. We have another Hyper-V host with a DC guest that will be running during the migration. All the hosts and VMs are running Windows Server 2008 R2. Is it a good way to move virtualize DC b/t hosts? If not, how should I proceed?

  Read the article

• App Pool crashes before loading mscorsvr. How to troubleshoot?

  - by codepoke

  I have an app pool that recycles every 29 hours, per default. It recycles smoothly 9 times out of 10, and I'm pretty sure the recycle itself is good for the app. Once every couple weeks the recycle does not work. The old worker process dies cleanly and the new worker process starts, but will not serve up content. Recycling the app pool again manually works like a charm. The failed worker process stops and dies cleanly and a second new worker process fires up and serves content perfectly. I took a crash dump against the failed worker process prior to recycling it, and DebugDiag found nothing to complain about. I tried to dig a little deeper using WinDBG, but mscorsvr/mscorwks is not loaded yet 15 minutes after the new process started. There are 14 threads running (4 async) and 20 pending client connections, but .NET is not even loaded into the process yet. Any suggestions where to poke and prod to find a root cause on this?

  Read the article

• Applescript won't open applications on my external monitor

  - by jpadvo

  I'm trying to open a new MacVim window with Applescript, and have found partial success with this: do shell script "cd \"~/code/application\"; ~/bin/mvim > /dev/null 2>&1" This works fine, and opens a new MacVim window with it's working directory set to ~/code/application. BUT it always opens on the screen of my laptop, not on the external monitor with the currently active space where I am working. Is there a way to get MacVim to open in the current space? Edit: same problem with opening a finder window: tell application "Finder" to make new Finder window

  Read the article

• Migrate servers without losing any data / time-limited MySQL dump?

  - by inac

  Is there a way to migrate from an old dedicated server to a new one without losing any data in-between - and with no downtime? In the past, I've had to lose MySQL data between the time when the new server goes up (i.e., all files transferred, system up and ready), and when I take the old server down (data still transferred to old until new one takes over). There is also a short period where both are down for DNS, etc., to refresh. Is there a way for MySQL/root to easily transfer all data that was updated/inserted between a certain time frame?

  Read the article

• How do I remotely run a Powershell workflow that uses a custom module?

  - by drawsmcgraw

  I have a custom Powershell module that I wrote for various tasks. Now I want to craft a workflow whose activities will use commands from the module. Here's my test workflow: workflow New-TestWorkflow{ InlineScript { Import-Module custom.ps1 New-CommandFromTheModule } } Then I run the workflow with: New-TestWorkflow -PSComputerName remoteComputer When I do this, the import fails because it can't find the module. I imagine this is because the workflow is executing on the remote machine, where my module does not exist. I can see myself running this across many machines so I'd really rather not have to install this module and maintain it on all of the machines. Is there some way to have my module in a central place and use it in workflows?

  Read the article

• AS2 Server Software Costs

  - by CandyCo

  We're currently using Cleo LexiCom as our server software for receiving EDI transmissions via the AS2 protocol. We have 7 trading partners per year, and this runs us about $800/year for support from Cleo. We need to expand from 7 trading partners to 10 or so, and Cleo charges roughly $600 per new host, plus an expanded yearly support fee. My question(s) are: Does anyone know of a cheaper developer of AS2 server software, and perhaps one that doesn't charge per new host? Does anyone have any clue why we are being charged an upfront fee for new hosts, and if this is a standard practice for AS2 software providers? It seems really odd that we are required to pay upfront costs for this. I could completely understand an increase in the yearly support, however.

  Read the article

• DVI monitor detected only on computer startup

  - by kamil

  I've recently connected a new monitor, LG M2252D-PZ, to a rather outdated computer with Windows XP and Radeon 9600. XP has SP3 installed, video drivers are the latest version back from the times the video card was still supported. My problem is that the monitor works fine only as long as I don't turn it off or switch it to a different input. When I turn it back on, it says "no signal". The key to the problem must be the DVI port, to which the new monitor is connected. The previous monitor was connected to the VGA output, and I've tested that the new one also works fine when connected to the analogue port. Apparently, the computer tests for the presence of a monitor on the DVI port only on startup. The question is, how do I change this?

  Read the article

• Move and clone VirtualBox machines with filesystem commands

  - by mit

  I know of 2 ways to clone a VirtualBox machine on a linux host, one is by using the VirtualBox gui and exporting and re-importing as Appliance (in the file menu of VirtualBox). The other is by cloning only the virtual disk containers: VBoxManage clonevdi source.vdi target.vdi (Taken from http://forums.virtualbox.org/viewtopic.php?p=853#p858 ) I would have to create a new VM afterwards and use the cloned virtual disk. Is there a way I can just copy a virtual disk and the and do the rest by hand? I'd have to manually edit the ~/VirtualBox/VirtualBox.xml and insert a new disk and a new machine: Can I just make up UUIDs or how would this work? I would very much prefer this hardcore method of doing things as it allows me to freely and rapdily backup, restore, move or clone machines. Or ist there a better way to do this?

  Read the article

• A Duplicate name exists on the network

  - by Adam

  Recently we changed out office IT structure from having a dedicated server to be the DC, a dedicated server for the exchange etc... (Each running Windows Server 2003 R2) Now we have a single server running Windows SBS 2008 and created a new domain (with a different domain name) We then changed every PC so it connected to the new domain and renamed every PC with a new naming structure. After I had done this, we were getting several PCs that would get the following message just before the login screen (Alt+Ctrl+Del Screen) A Duplicate name exists on the network I have checked the ADUC and have removed the trouble PCs from the list and renamed each PC and changed the SID before connecting back onto the domain but still getting this message. I have tried everything that i can think of but still getting the problem. Any help would be greatly appreticated.

  Read the article

• Transfer disk image to larger/smaller disk

  - by forthrin

  I need to switch the hard drive on a 2006 iMac to a new SSD. I don't have the original installation CDs. I know I can order CDs from Apple, but this costs money. Someone told me it's possible to rip the image of the old drive and transfer to the new drive. If so, does the size of the new drive have to be exactly the same as the old? If not, my questions are: Is it possible to "stretch" the image from 120 MB disk to a 256 MB disk (numbers are examples)? If so, what is the command line for this? Likewise, is it possible to "shrink" an image from a larger disk (eg. 256 MB) to a smaller disk (eg. 120 MB), provided that the actual space used on the disk does not exceed 120 MB? How do you do this on the command line?

  Read the article

• Enable group policy for everything but the SBS?

  - by Jerry Dodge

  I have created a new group policy to disable IPv6 on all machines. There is only the one default OU, no special configuration. However, this policy shall not apply to the SBS its self (nor the other DC at another location on a different subnet) because those machines do depend on IPv6. All the rest do not. I did see a recommendation to create a new OU and put that machine under it, but many other comments say that is extremely messy and not recommended - makes it high maintenance when it comes to changing other group policies. How can I apply this single group policy to every machine except for the domain controllers? PS - Yes, I understand IPv6 will soon be the new standard, but until then, we have no intention to implement it, and it in fact is causing us many issues when enabled.

  Read the article

• How do I split a large MySql backup file into multiple files?

  - by Brian T Hannan

  I have a 250 MB backup SQL file but the limit on the new hosting is only 100 MB ... Is there a program that let's you split an SQL file into multiple SQL files? It seems like people are answering the wrong question ... so I will clarify more: I ONLY have the 250 MB file and only have the new hosting using phpMyAdmin which currently has no data in the database. I need to take the 250 MB file and upload it to the new host but there is a 100 MB SQL backup file upload size limit. I simply need to take one file that is too large and split it out into multiple files each containing only full valid SQL statements (no statements can be split between two files).

  Read the article

• How can I move authorized applications between google accounts?

  - by zoopp

  I'm looking into creating an email address with a professional name on gmail and due to the fact that I can't change my current one I have to create new google account. Among some things which which need to be patched (eg. forwarding email to the new address until every other account's email contact address is changed etc.) I came across authorized applications. If I am to use exclusively the new email address I have to somehow move my authorized applications as well since if I am to eventually delete my old account I will lose access to my current profiles created by those applications (eg. the stackexchange network, youtube etc). How can this move be accomplished?

  Read the article

• upgrading servers, need to keep domain same as before. what are the best practices?

  - by nLL

  Hi, I am upgrading a domain controller/file server from win2003 standard to win2008 r2 standard. We are planing to have a file server and an AD controller. Our old hardware will be scrapped, we want to copy all AD users/computers to new machine and keep current domain name. I never done this before. What are the best practices? Is it better if we get a contractor to do it for us? I guess best way to start is to build new servers, copy data, take old server down and put new server online. My gut says we would need to re-join all computers. Is that correct? Any input appreciated.

  Read the article

• Apply rewrite rule for all but all the files (recursive) in a subdirectory?

  - by user784637

  I have an .htaccess file in the root of the website that looks like this RewriteRule ^some-blog-post-title/ http://website/read/flowers/a-new-title-for-this-post/ [R=301,L] RewriteRule ^some-blog-post-title2/ http://website/read/flowers/a-new-title-for-this-post2/ [R=301,L] <IfModule mod_rewrite.c> RewriteEngine On ## Redirects for all pages except for files in wp-content to website/read RewriteCond %{REQUEST_FILENAME} !-f RewriteCond %{REQUEST_FILENAME} !-d RewriteCond %{REQUEST_URI} !/wp-content RewriteRule ^(.*)$ http://website/read/$1 [L,QSA] #RewriteRule ^http://website/read [R=301,L] RewriteBase / RewriteRule ^index\.php$ - [L] RewriteCond %{REQUEST_FILENAME} !-f RewriteCond %{REQUEST_FILENAME} !-d RewriteRule . /index.php [L] </IfModule> My intent is to redirect people to the new blog post location if they propose one of those special blog posts. If that's not the case then they should be redirected to http://website.com/read. Nothing from http://website.com/wp-content/* should be redirected. So far conditions 1 and 3 are being met. How can I meet condition 2?

  Read the article

• How to copy data (clone) from one partition to another in Windows XP?

  - by Martin

  I have installed a new hard drive in our PC running Windows XP and I wonder how to transfer the data from the old (small) data partition to the new (large) one. My question concerns only a data partition containing files and folders (not the boot partition with the Operating System files!) Is it ok to just copy the folders in the Windows XP Explorer to the new partition? Could anything be lost this way (hidden folders, metadata, ..)? What is the best way to clone a data partition in Windows XP?

  Read the article

• How Do I Migrate 100 DBs From One MS-SQL 2008 Server To Another? (looking for automation)

  - by jc4rp3nt3r

  Let me start by saying that I am not a DBA, but I am in a position where I am responsible for moving just under 100 MS-SQL 2008 DBs from our current development server, to a new/better/faster development server. As this is just a local dev server, temporary downtime is acceptable, but I am looking for a way to move all of the databases (preferably in bulk). I know that I could take a bak of each, and restore it on the new server, but given the volume of DBs, I am looking for a more efficient way. I am not opposed to learning a new piece of software, writing code or any other requirement, so long as it speeds up the process.

  Read the article

• Access to certain files but not others

  - by ADW

  Hoping someone can help me as I have, thus far, been unable to solve the issue. I am running a media center utilizing Ubuntu 12.04. I was initially successful accessing media files from the desktop running Ubuntu via my Windows 7 laptop and Roku device. I started backing up a new batch of DVD's I had (into MKV files, like everything else in my media folders) and noticed I cannot access the new files from either the Roku or the laptop. I have not changed any settings in the media folder and verified the shared permissions. The parent folder (Media) is shared (with permission flow-down) while the subfolders (Movies, TV Shows, Music) are not. I have changed the permissions on this to include shared when the access problem arose but with no success. I can only access the original files uploaded an not new files added. Any suggestions??? Thanks in advance for any and all help.

  Read the article

• Problem creating sitecollection when database attached has been deleted

  - by pkspt

  Hi, I created one new sitecollection in new contentdatabase but later i changed my mind and decided to create it in the same database as of the webapplication. I deleted the sitecollection I created through newdatabase and bt now when I am creating that site again its getting attached to the new database which got created above not the same one? Any solution for that I tried deleting database which got created after deleting site collection. Now, when I when I am trying to create a site its looking for old database and giving me error as its not able to open it. Any suggestions on this one..?

  Read the article

• Is there a way to edit an existing nautilus (file manager) bookmark?

  - by C.W.Holeman II

  Is there a way to edit an existing nautilus (fie manager) bookmark? Invoke from Linux command line: $ nautilus Activate connection editor: File>Connect To Server...> Complete entries in the pop up: Service Type: [WebDAV (HTTP)] Server: [localhost] Port: [8001] Folder [webdav] Username: [test] [x] Add bookmark Bookmark name: [/dav] <Connect> Then in the left column of the main window the new connection and bookmark exist: Places ------------------- ausername Desktop File System Network WebDAV on localhost Trash -------------------- /dav Right click on "/dav" pop up menu: Open Open in New Tab Open in New Window ------------------ Remove Rename... There is no option for editing.

  Read the article

• What are the pros of switching DNS names with a database server hardware upgrade?

  - by wilbbe01

  When we upgrade to new hardware at work we usually increment a number in the DNS name. For example. We have a server called database-2, that is slated to become database-3 in the coming days. I haven't been able to find a good reason why this is good behavior. To me the work of trying to catch all end user machines, as well as all servers dependent on the database server is far riskier than simply moving the database and ip/name with it to the new hardware. A little over a year ago we spent several months of requests coming in, as infrequent users began using software that needed to be updated to point to a new DNS name. I am struggling to find answers as to why this is a good practice. So the question. Why is using DNS names as a "server hardware version identifier" a good idea? What am I overlooking? Thanks much.

  Read the article

• EF4 CTP5 Conflicting changes detected. This may happen when trying to insert multiple entities with the same key.

  - by user658332

  hi, I am new to EF4 CTP5. I am just hanging at one problem.. I am using CodeFirst without Database, so when i execute application, it generated DB for me. here is my scenario, i have following Class structure... public class KVCalculationWish { public KVCalculationWish() { } public int KVCalculationWishId { get; set; } public string KVCalculationWishName { get; set; } public int KVSingleOfferId { get; set; } public virtual KVSingleOffer SingleOffer { get; set; } public int KVCalculationsForPersonId { get; set; } public virtual KVCalculationsForPerson CaculationsForPerson { get; set; } } public class KVSingleOffer { public KVSingleOffer() { } public int KVSingleOfferId { get; set; } public string KVSingleOfferName { get; set; } public KVCalculationWish CalculationWish { get; set; } } public class KVCalculationsForPerson { public KVCalculationsForPerson() { } public int KVCalculationsForPersonId { get; set; } public string KVCalculationsForPersonName { get; set; } public KVCalculationWish CalculationWish { get; set; } } public class EntiyRelation : DbContext { public EntiyRelation() { } public DbSet<KVCalculationWish> CalculationWish { get; set; } public DbSet<KVSingleOffer> SingleOffer { get; set; } public DbSet<KVCalculationsForPerson> CalculationsForPerson { get; set; } protected override void OnModelCreating(System.Data.Entity.ModelConfiguration.ModelBuilder modelBuilder) { base.OnModelCreating(modelBuilder); modelBuilder.Entity<KVCalculationWish>().HasOptional(m => m.SingleOffer).WithRequired(p => p.CalculationWish); modelBuilder.Entity<KVCalculationWish>().HasOptional(m => m.CaculationsForPerson).WithRequired(p => p.CalculationWish); } } i want to use KVCalcuationWish object in KVCalcuationsForPerson and KVSingleOffer class. So when i am creating object of KVCalcuationForPerson and KVSingleOffer class i initialize both object with New KVCalcuationWish object. like this KVCalculationsForPerson calcPerson = new KVCalculationsForPerson(); KVCalculationWish wish = new KVCalculationWish() { CaculationsForPerson = calcPerson }; calcPerson.KVCalculationsForPersonName = "Person Name"; calcPerson.CalculationWish = wish; KVSingleOffer singleOffer = new KVSingleOffer(); KVCalculationWish wish1 = new KVCalculationWish() { SingleOffer = singleOffer }; singleOffer.KVSingleOfferName = "Offer Name"; singleOffer.CalculationWish = wish1; but my problem is when i save this records using following code try { db.CalculationsForPerson.Add(calcPerson); db.SingleOffer.Add(singleOffer); db.SaveChanges(); } catch (Exception ex) { } i can save successfully in DB, but in Table KVCalcuationWish i am not able to get the ID of SingleOffer and CalcuationsForPerson class object. Following is the data of KVCalcuationWish table. KVCalcuationWishID KVCalcuationWishName KVSingleOfferID KVCalcuationsForPersonID 1 NULL 0 0 Following is the data of KVSingleOFfer Table KVSingleOfferID KVSingleOfferName 1 Offer Name Follwing is the data of KVCalcuationsForPerson Table KVSingleOfferID KVSingleOfferName 1 Person Name I want to have following possible output in KVCalcuationWish table. KVCalcuationWishID KVCalcuationWishName KVSingleOfferID KVCalcuationsForPersonID 1 NULL 1 NULL 2 NULL NULL 1 so what i want to achieve is ...... when i am save KVSingleOffer object i want separate record to be inserted and when i save KVCalcuationsForPerson object another separate record should be save to KVCalcuationwish table. Is that possible? Sorry for long description... but i really hang on this situation... Thanks & Regards, Joyous Suhas

  Read the article

< Previous Page | 664 665 666 667 668 669 670 671 672 673 674 675  | Next Page >