Search Results

Search found 31774 results on 1271 pages for 'chris go'.

Page 675/1271 | < Previous Page | 671 672 673 674 675 676 677 678 679 680 681 682  | Next Page >

• 1080p HD TV + what is minimum spec pc required to stream HD movie files to it?

  - by rutherford

  I want to stream hi-def (non flash-based) movies from my future minimum spec pc to my network-ready HDTV. What I want to know is a) when streaming from a computer (local wifi network), is the computer's cpu/video/ram resources used to the same extent as it would be if playing back on the computers local screen? If not what are the differences? b) So with streaming hd content what is the minimum spec processor I should go for, if i) only one TV is acting as client ii) two TVs are simultaneous clients.

  Read the article

• (Windows 7) Dial Up Connection Locks up the Networking Service

  - by Nick

  I connect to the internet by using my cell phone as a dial up modem. (shh, don't tell my service provider) The connection is usually seamless and the speed is good (150kbps) but occasionally, the connection will get terminated by either the phone or the network, I'm not sure which and then Windows7 stubbornly doesn't acknowledge that the connection is dead so I can re-dial. I have tried to manually kill the connection, but then anything related to the network service refuses to open and the connection is still there. No "Network and Sharing Center", "Network Devices" and often the tray menu will refuse to pop open. The only way I have found to clear the problem is a full restart which. Logging off doesn't work and I haven't been able to find the service that is frozen. If anyone knows how to fix this or prevent this from happening or even how to go about troubleshooting I would be very grateful. ps. This problem is non-existant when tethering in linux on the same machine. (Ubunutu 9 and JoliOS)

  Read the article

• C Language preprocessing doubt

  - by khanna_param

  Hi, There are different kind of macros in C language, nested macro is one of them. Considering a program with the following macro define HYPE(x,y) (SQUR(x)+SQUR(y)) define SQUR(x) (x*x) using this we can successfully complile to get the result. My question:- As we all know the C preprocessor replaces all the occurrence of the identifiers with the replacement-string. Considering the above example i would like to know how many times the C compiler traverses the program to replace the macro with the replacement values. I assume it cannot be done in one go. Thanks.

  Read the article

• Creating a webserver from scratch

  - by Val

  I know this is going to sound a humongous task and many of you would think why in the world would you want to do so or why re-invent the wheel. However I just want a project I can work on the side see how it goes and experiment ( I got a thirst for learning something new and this is a great challenge). Question Where would I start creating a server-side scripting like php, asp and (now) node.js I would like to have a few examples, and most importantly a CODEX/documentation where I can learn and find out more how it works. I guess I am asking for directions where to go to read and find out more about this. Many thanks,

  Read the article

• How to recover the data from the crashed (external) hard disk drive (NTFS)?

  - by shveerab

  The 300 GB harddisk has 2 partitions,90 GB and 200 GB! I can see the drives in windows(XP) but unable to access them, the file system is shown as RAW, 0 used space and 0 free space!..chkdsk returns the error "unable to determine volume version and date. chkddsk aborted." Is the MBR corrupt? How do I restore it? TestDisk tool isn't recognizing the partitions and says invalid entry for heads/cylinder, 15 and should be 255 and suggests to change it..Should I go ahead and change it? Please advise!

  Read the article

• Windows Reformatting

  - by Shimz187

  I recently began formatting a hard drive via USB extenal drive when the power went off. When i powered it up again and connected the drive the drives dont show up under my computer. When i go to disk management, i see the drive but now it says unallocated space. The drive was initialy partitioned into 2 drives. I cant see both drives now. Tried running GetDataBack NTFS recovery tool and it only comes up with errors. There seem to be no information on the drive from the data recovery utility. I know the information is there but how do i find it. HELP!!!!

  Read the article

• Resetting default Input Method in Mac OS 10.6

  - by Tim Visher

  I'm a Dvorak guy. I recently installed a new machine at the inlaws who are not Dvorak people. I stupidly selected Dvorak as my Input Method of choice while installing OS X. Now, all of the users I created default to Dvorak and need to go through the manual process of removing Dvorak as their Input Method of choice and instead choosing U.S. I have no idea how far reaching the implications might be. Could be that any time another user is added they will default to Dvorak. Right now, I'd like to set the default back to U.S. How can I do that? Behaviors I'm looking for include that when the Input Menu is not shown at the Login Screen, U.S. is the keyboard layout. Any future users created should default to U.S. with no Input Menu in the menu bar. Any users created already should have their default layout be U.S. Thanks in advance!

  Read the article

• Excel Document Size is at 0KB, can't be opened

  - by Bassam

  After I saved an Excel document, I remembered that I needed to change something in it, so I go back to open it and it said Excel cannot open the file, because the file format or the file extension is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. I know when I saved before, around 2hours ago, it worked just fine. The document size is at 0KB now. How do I recover this document? Its crucial for my business!

  Read the article

• Does a receiving mail server (the ultimate destination) see emails delivered directly to it vs. to an external relay which then forwards them to it?

  - by Matt

  Let's say my users have accounts on some mail server mail.example.com. I currently have my mx record set to mail.example.com and all is good. Now let's say I want to have mails initially delivered to an external service (e.g. Postini. Note that this is not a postini-specific question though). In the normal situation where my mx is set directly to my mail server mail.example.com, sending MTAs will of course look up my MX and send to mail.example.com. In my new situation I'd have my mx set to mx.othermailservice.com and emails would be received there. OtherEmailService.com will then relay the emails (while keeping the return-path header the same) to mail.example.com. Do the emails that are received at mail.example.com after be relayed from the other service "look" any different than emails that go directly to it as would be the case where the mx was set to mail.example.com?

  Read the article

• Can Visual Studio track the "size" or "severity" of my changes in TFS?

  - by anaximander

  I'm working on a sizeable project using VS2012 and TFS (also 2012, I think - I didn't set up the server). A lot of my recent tasks have required making very small changes to a lot of files, so I'm quite used to seeing a lot of items in my Pending Changes list. Is there a way to have VS and/or TFS track how much has been changed and let me know when the differences are becoming significant? Similarly, is there a way to quickly highlight where the major changes are when you get the latest version from TFS? It'd really help with tracking down where certain changes have been made without having to go through and compare every file - the difference highlighting tool might be nice, but when you have to use it on a dozen files to find the block you're looking for, you start to wonder if there's a faster way...

  Read the article

• Updating Applications in a Corporate Environment

  - by user145133

  I am very new to this subject and was hoping someone could shed some light on it. I am working on creating a corporate network that will obviously have multiple servers and multiple workstations. Let's say a new version of Adobe Flash comes out. I would think that you would want to test this update in a test environment before "pushing it out" to the servers and workstations. How do you guys go about controlling, testing and then pushing the application updates out? (i am not talking about windows updates). Do you use a 3rd party sysadmin tool? Home grown software? Any info will greatly be appreciated :)

  Read the article

• Should we install the OS on an SSD or not when running virtual machines?

  - by Raghu Dodda

  I have a new Dell Mobile Precision M6500 laptop with 8 GB RAM. it has two hard drives - 500 GB @7200 RPM and a 128 GB SSD. The main purpose of these laptop is software development in virtual machines. The plan is to install the base OS (Windows 7) and all the programs in the 500 GB drive, and let the SSD only contain the virtual machine images. It is my understanding that the we get most performance from the virtual machines if the images are on a separate hard drive than the base OS. Is this the way to go, or should I install the OS on the SSD as well? What are the pros and cons? The virtual machine images would be between 20 - 30 GB, and I might run 1 or 2 at a time.

  Read the article

• Building my own computer

  - by There is nothing we can do

  I'm planning to build my own computer. I do not have enough cash to buy all components I need in one go. I want to ask, if I buy motherboard which is compatible with i7 processor (any) and compatible with graphic card Nvidia gtx 780, does it mean that this mother board will be compatible with processors (from intel) which will be released next year? Same for graphic cards? The point is that I'd like to avoid situation where I buy motherboard let's say now, and in couple of months there will be new graphic card/processor which will not be compatible with my mother board? Or maybe shall I start completely somewhere else?

  Read the article

• PC3200 RAM in Older Computer?

  - by skaz

  Hello all, I am inheriting a Dell Dimension 8200, but it needs RAM to get up and running. I have PC3200 sticks lying around, but I am not sure how to go about figuring out if the RAM is compatible, as RAM has always confused me. Here is the Dell Dimension 8200 Tech Specs: http://support.dell.com/support/edocs/systems/dim8200/specs.htm For RAM, it says: Memory type PC800 (non-ECC) I don't know if that is just the kind that comes with it, and I can put in PC3200 (I think, if it worked, this would run at the lower rating? Is that true?), or if that means only PC800 is compatible. Any help would be appreciated.

  Read the article

• Multi-monitors and the corners of the screen

  - by Neil Barnwell

  I currently have two monitors (let's call them "left" and "middle" - you'll see why in a sec), and would love three (let's call it "right"). However, I often will throw the mouse-cursor up to the top-right corner on "middle" because for a maximised window that's where the close button will be. If I add the "right" monitor, the mouse cursor will just carry on off "middle" into "right", and aiming for the close button on "middle" will become more difficult. I'm currently using UltraMon 3.10, but does anyone know of a way to get the mouse to stick to the corners, so that it doesn't go off into the other monitor (Synergy allows this by configuring the "gap" where the mouse is allowed to travel from monitor to monitor).

  Read the article

• Mozilla nonsense. Page changes size by itself

  - by Browser Madness

  I have never intentionally changed the size of font on latest mozilla browser install on windows machine. For example Google site is now 200% size, and I did nothing to make this happen. Whats worse is it does not change back but remembers this! Similarly other sites are too small and they remember this per site. What is going on here? I mean what nonsense! How can I undo this? And for extra points who came up with this absurd behavior at mozilla? Not making this up folks. 15.0.1 Not at all clear why it changes size or how to go back to default size for these sites Acutally it just happened again while editing this entry. Icon changes and than font size is too small.

  Read the article

• error when using OWA access to mail server exchange 2010

  - by e0594cn

  Suddenly it will come out the below error when accessing the exchange 2010 mail server using OWA after clicking sign in button on initial page? ***The website cannot display the page HTTP 500 Most likely causes: •The website is under maintenance. •The website has a programming error. What you can try: Refresh the page. Go back to the previous page. More information This error (HTTP 500 Internal Server Error) means that the website you are visiting had a server problem which prevented the webpage from displaying. For more information about HTTP errors, see Help.* Any suggestion? Thanks!

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Virtualbox PUEL Interpretation

  - by modernzombie

  Sorry if this seems like a lame question but I want to be sure before making a decision. The Virtualbox PUEL license says “Personal Use” requires that you use the Product on the same Host Computer where you installed it yourself and that no more than one client connect to that Host Computer at a time for the purpose of displaying Guest Computers remotely. I take this to mean that if I want to setup a development server (web server) that's only used by me to do my work this falls under personal use. But if I make this server available for clients to connect to the websites to view my progress this is no longer personal use also meaning that using Vbox to run a production web server is also against the license. Again sorry if this is a dumb question but I find it hard to follow the wording used in licenses. I know I could go with OSE but I have not looked into VNC versus RDP yet. Thanks.

  Read the article

• Why are my Google searches redirected?

  - by Please Help

  This machine was infected with various malware. I have scanned the system with Malwarebytes. It found and removed some 600 or so infected files. Now the machine seems to be running well with only one exception. Some Google search results are being redirected to some shady search engines. If I were to copy the url from the Google Search results and paste it in the address bar it would go to the correct site but if I click the link I will be redirected somewhere else. Here is my log file from HijackThis: http://pastebin.com/ZE3wiCrk

  Read the article

• How can I organize my video collection and update meta data?

  - by Pieter Breed

  I have a large collection of downloaded video files containing different movies, tv shows and music videos. I have a FreeNAS box set up that uses Fuppes as a UPnP media server. My media player on Windows correctly detects this UPnP collection and can stream from it fine. However, All of my music videos, tv shows and movies are all sorted under the same 'Videos' group. I would like to seperate the different types of video files so that they can correctly go under 'Recorded TV' or whatever the case may be. Any ideas? I guess I am looking for something like an MP3Tagger but for video files?

  Read the article

• Is there a good, free way to fix broken/corrupt .wmv files?

  - by chbtn

  I've recovered some files from an hdd that weren't supposed to be deleted in the first place, but they have seeking problems/crash the players. Since they have the right size, I'm thinking it might be a problem of corrupt index/header, so I'm trying to find a way to fix them. It's easy to find examples on how to fix corrupt .avi files with mencoder, but .wmv seems trickier. Also, I realize there might not be a way to fix these files, but I figure I might as well as try. As far as players go, I've tried opening it with vlc/mplayer/windows media player. I can use anything on Windows XP/7 and Ubuntu, as long as it's free. Since the files are 200mb+ and there are quite a few, I don't think trial software would work.

  Read the article

• Microsoft mouse screws up my power settings

  - by Patriot

  Running a new computer with Windows 7 and 64-bit OS. Had a wireless Logitech mouse that worked perfectly with this set up. The mouse was old, and the buttons were sticking and causing double clicks, so I bought a new Microsoft Mobile Wireless 3000 mouse to replace it. The new mouse works perfectly, but now my screen saver is disabled and my computer won't go into sleep mode after 15 minutes as per my power setting. If I hook the Logitech mouse back up, screen saver works fine and computer goes to sleep as it should. Am I missing something, or is Microsoft's mouse just junk. Got no software with the new mouse, so no drivers seem available.

  Read the article

• Backup folder on sometimes attached external usb harddrive

  - by ctrler

  My girlfriend no longer has space her laptops drive to store her photos. The drive she has now is 750GB, so to go to a bigger drive would be expensive, as there isn't many 1.5tb 2.5 inch 9.5mm hdd on the market (as of now, there is only one). Because of that, I am thinking of moving her pictures to a cheap external usb hdd. As of now, I'm automatically backing up her important folders (My Documents, Pictures, etc.) using Windows 7 default backup software to a network drive. My problem is that I don't know of a good solution to automatically backup a folder residing on an usb disk. The usb disk won't be attached to the computer all the time, so I can't just treat it as a normal backup folder. Sometimes the backup would run and the folder would not be there! Anyone knows any software or methodology to backup folders on external usb hard drives that are not always present? Thanks

  Read the article

• Unidentified Window OnStartup

  - by CMP

  Every time I start up windows vista lately, I see a random floating window. It is a tiny little window with no title, and only the resize, maximize and restore buttons. I'd post an image, but I don't have reputation here yet. I can close it, and it does indeed go away, but I would love to figure out what it is and stop it from popping up at all. I used Autohotkey's window spy on it and all I learned is that it is a swing window, which doesn't help me out a whole lot. Is there a good way to identify which process it belongs to and figure out how to kill it?

  Read the article

< Previous Page | 671 672 673 674 675 676 677 678 679 680 681 682  | Next Page >