Search Results

Search found 17621 results on 705 pages for 'just my correct opinion'.

Page 696/705 | < Previous Page | 692 693 694 695 696 697 698 699 700 701 702 703  | Next Page >

  • C#/.NET Little Wonders: Interlocked CompareExchange()

    - by James Michael Hare
    Once again, in this series of posts I look at the parts of the .NET Framework that may seem trivial, but can help improve your code by making it easier to write and maintain. The index of all my past little wonders posts can be found here. Two posts ago, I discussed the Interlocked Add(), Increment(), and Decrement() methods (here) for adding and subtracting values in a thread-safe, lightweight manner.  Then, last post I talked about the Interlocked Read() and Exchange() methods (here) for safely and efficiently reading and setting 32 or 64 bit values (or references).  This week, we’ll round out the discussion by talking about the Interlocked CompareExchange() method and how it can be put to use to exchange a value if the current value is what you expected it to be. Dirty reads can lead to bad results Many of the uses of Interlocked that we’ve explored so far have centered around either reading, setting, or adding values.  But what happens if you want to do something more complex such as setting a value based on the previous value in some manner? Perhaps you were creating an application that reads a current balance, applies a deposit, and then saves the new modified balance, where of course you’d want that to happen atomically.  If you read the balance, then go to save the new balance and between that time the previous balance has already changed, you’ll have an issue!  Think about it, if we read the current balance as $400, and we are applying a new deposit of $50.75, but meanwhile someone else deposits $200 and sets the total to $600, but then we write a total of $450.75 we’ve lost $200! Now, certainly for int and long values we can use Interlocked.Add() to handles these cases, and it works well for that.  But what if we want to work with doubles, for example?  Let’s say we wanted to add the numbers from 0 to 99,999 in parallel.  We could do this by spawning several parallel tasks to continuously add to a total: 1: double total = 0; 2:  3: Parallel.For(0, 10000, next => 4: { 5: total += next; 6: }); Were this run on one thread using a standard for loop, we’d expect an answer of 4,999,950,000 (the sum of all numbers from 0 to 99,999).  But when we run this in parallel as written above, we’ll likely get something far off.  The result of one of my runs, for example, was 1,281,880,740.  That is way off!  If this were banking software we’d be in big trouble with our clients.  So what happened?  The += operator is not atomic, it will read in the current value, add the result, then store it back into the total.  At any point in all of this another thread could read a “dirty” current total and accidentally “skip” our add.   So, to clean this up, we could use a lock to guarantee concurrency: 1: double total = 0.0; 2: object locker = new object(); 3:  4: Parallel.For(0, count, next => 5: { 6: lock (locker) 7: { 8: total += next; 9: } 10: }); Which will give us the correct result of 4,999,950,000.  One thing to note is that locking can be heavy, especially if the operation being locked over is trivial, or the life of the lock is a high percentage of the work being performed concurrently.  In the case above, the lock consumes pretty much all of the time of each parallel task – and the task being locked on is relatively trivial. Now, let me put in a disclaimer here before we go further: For most uses, lock is more than sufficient for your needs, and is often the simplest solution!    So, if lock is sufficient for most needs, why would we ever consider another solution?  The problem with locking is that it can suspend execution of your thread while it waits for the signal that the lock is free.  Moreover, if the operation being locked over is trivial, the lock can add a very high level of overhead.  This is why things like Interlocked.Increment() perform so well, instead of locking just to perform an increment, we perform the increment with an atomic, lockless method. As with all things performance related, it’s important to profile before jumping to the conclusion that you should optimize everything in your path.  If your profiling shows that locking is causing a high level of waiting in your application, then it’s time to consider lighter alternatives such as Interlocked. CompareExchange() – Exchange existing value if equal some value So let’s look at how we could use CompareExchange() to solve our problem above.  The general syntax of CompareExchange() is: T CompareExchange<T>(ref T location, T newValue, T expectedValue) If the value in location == expectedValue, then newValue is exchanged.  Either way, the value in location (before exchange) is returned. Actually, CompareExchange() is not one method, but a family of overloaded methods that can take int, long, float, double, pointers, or references.  It cannot take other value types (that is, can’t CompareExchange() two DateTime instances directly).  Also keep in mind that the version that takes any reference type (the generic overload) only checks for reference equality, it does not call any overridden Equals(). So how does this help us?  Well, we can grab the current total, and exchange the new value if total hasn’t changed.  This would look like this: 1: // grab the snapshot 2: double current = total; 3:  4: // if the total hasn’t changed since I grabbed the snapshot, then 5: // set it to the new total 6: Interlocked.CompareExchange(ref total, current + next, current); So what the code above says is: if the amount in total (1st arg) is the same as the amount in current (3rd arg), then set total to current + next (2nd arg).  This check and exchange pair is atomic (and thus thread-safe). This works if total is the same as our snapshot in current, but the problem, is what happens if they aren’t the same?  Well, we know that in either case we will get the previous value of total (before the exchange), back as a result.  Thus, we can test this against our snapshot to see if it was the value we expected: 1: // if the value returned is != current, then our snapshot must be out of date 2: // which means we didn't (and shouldn't) apply current + next 3: if (Interlocked.CompareExchange(ref total, current + next, current) != current) 4: { 5: // ooops, total was not equal to our snapshot in current, what should we do??? 6: } So what do we do if we fail?  That’s up to you and the problem you are trying to solve.  It’s possible you would decide to abort the whole transaction, or perhaps do a lightweight spin and try again.  Let’s try that: 1: double current = total; 2:  3: // make first attempt... 4: if (Interlocked.CompareExchange(ref total, current + i, current) != current) 5: { 6: // if we fail, go into a spin wait, spin, and try again until succeed 7: var spinner = new SpinWait(); 8:  9: do 10: { 11: spinner.SpinOnce(); 12: current = total; 13: } 14: while (Interlocked.CompareExchange(ref total, current + i, current) != current); 15: } 16:  This is not trivial code, but it illustrates a possible use of CompareExchange().  What we are doing is first checking to see if we succeed on the first try, and if so great!  If not, we create a SpinWait and then repeat the process of SpinOnce(), grab a fresh snapshot, and repeat until CompareExchnage() succeeds.  You may wonder why not a simple do-while here, and the reason it’s more efficient to only create the SpinWait until we absolutely know we need one, for optimal efficiency. Though not as simple (or maintainable) as a simple lock, this will perform better in many situations.  Comparing an unlocked (and wrong) version, a version using lock, and the Interlocked of the code, we get the following average times for multiple iterations of adding the sum of 100,000 numbers: 1: Unlocked money average time: 2.1 ms 2: Locked money average time: 5.1 ms 3: Interlocked money average time: 3 ms So the Interlocked.CompareExchange(), while heavier to code, came in lighter than the lock, offering a good compromise of safety and performance when we need to reduce contention. CompareExchange() - it’s not just for adding stuff… So that was one simple use of CompareExchange() in the context of adding double values -- which meant we couldn’t have used the simpler Interlocked.Add() -- but it has other uses as well. If you think about it, this really works anytime you want to create something new based on a current value without using a full lock.  For example, you could use it to create a simple lazy instantiation implementation.  In this case, we want to set the lazy instance only if the previous value was null: 1: public static class Lazy<T> where T : class, new() 2: { 3: private static T _instance; 4:  5: public static T Instance 6: { 7: get 8: { 9: // if current is null, we need to create new instance 10: if (_instance == null) 11: { 12: // attempt create, it will only set if previous was null 13: Interlocked.CompareExchange(ref _instance, new T(), (T)null); 14: } 15:  16: return _instance; 17: } 18: } 19: } So, if _instance == null, this will create a new T() and attempt to exchange it with _instance.  If _instance is not null, then it does nothing and we discard the new T() we created. This is a way to create lazy instances of a type where we are more concerned about locking overhead than creating an accidental duplicate which is not used.  In fact, the BCL implementation of Lazy<T> offers a similar thread-safety choice for Publication thread safety, where it will not guarantee only one instance was created, but it will guarantee that all readers get the same instance.  Another possible use would be in concurrent collections.  Let’s say, for example, that you are creating your own brand new super stack that uses a linked list paradigm and is “lock free”.  We could use Interlocked.CompareExchange() to be able to do a lockless Push() which could be more efficient in multi-threaded applications where several threads are pushing and popping on the stack concurrently. Yes, there are already concurrent collections in the BCL (in .NET 4.0 as part of the TPL), but it’s a fun exercise!  So let’s assume we have a node like this: 1: public sealed class Node<T> 2: { 3: // the data for this node 4: public T Data { get; set; } 5:  6: // the link to the next instance 7: internal Node<T> Next { get; set; } 8: } Then, perhaps, our stack’s Push() operation might look something like: 1: public sealed class SuperStack<T> 2: { 3: private volatile T _head; 4:  5: public void Push(T value) 6: { 7: var newNode = new Node<int> { Data = value, Next = _head }; 8:  9: if (Interlocked.CompareExchange(ref _head, newNode, newNode.Next) != newNode.Next) 10: { 11: var spinner = new SpinWait(); 12:  13: do 14: { 15: spinner.SpinOnce(); 16: newNode.Next = _head; 17: } 18: while (Interlocked.CompareExchange(ref _head, newNode, newNode.Next) != newNode.Next); 19: } 20: } 21:  22: // ... 23: } Notice a similar paradigm here as with adding our doubles before.  What we are doing is creating the new Node with the data to push, and with a Next value being the original node referenced by _head.  This will create our stack behavior (LIFO – Last In, First Out).  Now, we have to set _head to now refer to the newNode, but we must first make sure it hasn’t changed! So we check to see if _head has the same value we saved in our snapshot as newNode.Next, and if so, we set _head to newNode.  This is all done atomically, and the result is _head’s original value, as long as the original value was what we assumed it was with newNode.Next, then we are good and we set it without a lock!  If not, we SpinWait and try again. Once again, this is much lighter than locking in highly parallelized code with lots of contention.  If I compare the method above with a similar class using lock, I get the following results for pushing 100,000 items: 1: Locked SuperStack average time: 6 ms 2: Interlocked SuperStack average time: 4.5 ms So, once again, we can get more efficient than a lock, though there is the cost of added code complexity.  Fortunately for you, most of the concurrent collection you’d ever need are already created for you in the System.Collections.Concurrent (here) namespace – for more information, see my Little Wonders – The Concurent Collections Part 1 (here), Part 2 (here), and Part 3 (here). Summary We’ve seen before how the Interlocked class can be used to safely and efficiently add, increment, decrement, read, and exchange values in a multi-threaded environment.  In addition to these, Interlocked CompareExchange() can be used to perform more complex logic without the need of a lock when lock contention is a concern. The added efficiency, though, comes at the cost of more complex code.  As such, the standard lock is often sufficient for most thread-safety needs.  But if profiling indicates you spend a lot of time waiting for locks, or if you just need a lock for something simple such as an increment, decrement, read, exchange, etc., then consider using the Interlocked class’s methods to reduce wait. Technorati Tags: C#,CSharp,.NET,Little Wonders,Interlocked,CompareExchange,threading,concurrency

    Read the article

  • $_GET loading content before head tag instead of in specified div.

    - by s32ialx
    NOT EDITING BELOW BUT THANKS TO SOME REALLY NICE PEOPLE I CAN'T POST AN IMAGE ANYMORE BECAUSE I HAD a 15 Rep but NOW ONLY A 5 becuase my question wasn't what they wanted help with they gave me a neg rep. The problem is that the content loads it displays UNDER the div i placed #CONTENT# inside so the styles are being ignored and it's posting #CONTENT# outside the divs at positions 0,0 any suggestions? Found out whats happening by using "View Source" seems that it's putting all of the #CONTENT#, content that's being loaded in front of the <head> tag. Like this <doctype...> <div class="home"> \ blah blah #CONTENT# bot being loaded in correct specified area </div> / <head> <script src=""></script> </head> <body> <div class="header"></div> <div class="contents"> #CONTENT# < where content SHOULD load </div> <div class="footer"></div> </body> so anyone got a fix? OK so a better description I'll add relevant screen-shots Whats happening is /* file.class.php */ <?php $file = new file(); class file{ var $path = "templates/clean"; var $ext = "tpl"; function loadfile($filename){ return file_get_contents($this->path . "/" . $filename . "." . $this->ext); } function setcontent($content,$newcontent,$vartoreplace='#CONTENT#'){ $val = str_replace($vartoreplace,$newcontent,$content); return $val; } function p($content) { $v = $content; $v = str_replace('#CONTENT#','',$v); print $v; } } if(!isset($_GET['page'])){ // if not, lets load our index page(you can change home.php to whatever you want: include("main.txt"); // else $_GET['page'] was set so lets do stuff: } else { // lets first check if the file exists: if(file_exists($_GET['page'].'.txt')){ // and lets include that then: include($_GET['page'].'.txt'); // sorry mate, could not find it: } else { echo 'Sorry, could not find <strong>' . $_GET['page'] .'.txt</strong>'; } } ?> is calling for a file_get_contents at the bottom which I use in /* index.php */ <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <?php include('classes/file.class.php'); // load the templates $header = $file->loadfile('header'); $body = $file->loadfile('body'); $footer = $file->loadfile('footer'); // fill body.tpl #CONTENT# slot with $content $body = $file->setcontent($body, $content); // cleanup and output the full page $file->p($header . $body . $footer); ?> and loads into /* body.tpl */ <div id="bodys"> <div id="bodt"></div> <div id="bodm"> <div id="contents"> #CONTENT# </div> </div> <div id="bodb"></div> </div> but the issue is as follows the $content loads properly img tags etc <h2> tags etc but CSS styling is TOTALY ignored for position width z-index etc. and as follows here's the screen-shot My Firefox Showing The Problem In Action REPOSTED DUE TO PEOPLE NOT HELPING AND JUST BEING ARROGANT AND GIVING NEGATIVE VOTES and not even saying a word. DO NOT COMMENT UNLESS YOU PLAN TO HELP god I'm a beginner and with you people giving me bad reviews this won't make me help you out when the chance comes.

    Read the article

  • XML parsing and transforming (XSLT or otherwise)

    - by observ
    I have several xml files that are formated this way: <ROOT> <OBJECT> <identity> <id>123</id> </identity> <child2 attr = "aa">32</child2> <child3> <childOfChild3 att1="aaa" att2="bbb" att3="CCC">LN</childOfChild3> </child3> <child4> <child5> <child6>3ddf</child6> <child7> <childOfChild7 att31="RR">1231</childOfChild7> </child7> </child5> </child4> </OBJECT> <OBJECT> <identity> <id>124</id> </identity> <child2 attr = "bb">212</child2> <child3> <childOfChild3 att1="ee" att2="ccc" att3="EREA">OP</childOfChild3> </child3> <child4> <child5> <child6>213r</child6> <child7> <childOfChild7 att31="EE">1233</childOfChild7> </child7> </child5> </child4> </OBJECT> </ROOT> How can i format it this way?: <ROOT> <OBJECT> <id>123</id> <child2>32</child2> <attr>aa</attr> <child3></child3> <childOfChild3>LN</childOfChild3> <att1>aaa</att1> <att2>bbb</att2> <att3>CCC</att3> <child4></child4> <child5></child5> <child6>3ddf</child6> <child7></child7> <childOfChild7>1231</childOfChild7> <att31>RR</att31> </OBJECT> <OBJECT> <id>124</id> <child2>212</child2> <attr>bb</attr> <child3></child3> <childOfChild3>LN</childOfChild3> <att1>ee</att1> <att2>ccc</att2> <att3>EREA</att3> <child4></child4> <child5></child5> <child6>213r</child6> <child7></child7> <childOfChild7>1233</childOfChild7> <att31>EE</att31> </OBJECT> </ROOT> I know some C# so maybe a parser there? or some generic xslt? The xml files are some data received from a client, so i can't control the way they are sending it to me. L.E. Basically when i am trying to test this data in excel (for example i want to make sure that the attribute of childOfChild7 corresponds to the correct identity id) i am getting a lot of blank spaces. If i am importing in access to get only the data i want out, i have to do a thousands subqueries to get them all in a nice table. Basically i just want to see for one Object all its data (one object - One row) and then just delete/hide the columns i don't need.

    Read the article

  • PHP File Serving Script: Unreliable Downloads?

    - by JGB146
    This post started as a question on ServerFault ( http://serverfault.com/questions/131156/user-receiving-partial-downloads ) but I determined that our php script was the culprit. So I'm issuing an updated question here about what I believe is the actual issue. I am using a php script to verify permissions and then serve up a file for users of my website to download. Most of the time, this works, but recently one user has been seeing problems with larger downloads. He is only getting ~80% of downloads for files that are 100MB in size. Also, all downloads from this script fail to report a filesize. Further, tests revealed that the same user COULD reliably download each of the failed files if given a direct link (at which point the filesize is reported). Here's the relevant snippet of code that we are using to serve the file: header("Content-type:$contenttype"); $len = filesize($filename); header("Content-Length: $len"); header("Content-Disposition: attachment; filename=".$title.".".$ext); readfile($filename); Note that $contenttype, $filename, $title, and $ext are all set correctly before we get here. These have been triple-checked. None of them are the problem. Also, $len does provide the correct filesize. While researching this issue, I came across this post: http://stackoverflow.com/questions/1334471/content-length-header-always-zero It seems that I am encountering the same issue. When I use the script, I get chunked encoding on the file and no size is set for content-length. I'm hypothesizing that something is going wrong on the large downloads, leading him to get a zero-length chunk before the end of the file. Here's what the headers look like for a direct request: http://www.grinderschool.com/videos/zfff5061b65ae00e8b21/KillsAids021.wmv GET /videos/zfff5061b65ae00e8b21/KillsAids021.wmv HTTP/1.1 Host: www.grinderschool.com User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.3) Gecko/20100401 Firefox/3.6.3 (.NET CLR 3.5.30729) Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8 Accept-Language: en-us,en;q=0.5 Accept-Encoding: gzip,deflate Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7 Keep-Alive: 115 Connection: keep-alive Referer: http://www.grinderschool.com/phpBB3/viewtopic.php?f=14&p=29468 Cookie: style_cookie=printonly; phpbb3_7c544_u=2; phpbb3_7c544_k=44b832912e5f887d; phpbb3_7c544_sid=e8852df42e08cc1b2250300c2897f78f; __utma=174624884.2719561324781918700.1251850714.1270986325.1270989003.575; __utmz=174624884.1264524375.411.12.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=low%20stakes%20poker%20videos; phpbb3_cmviy_k=; phpbb3_cmviy_u=2; phpbb3_cmviy_sid=d8df5c0943863004ca40ef9c392d371d; __utmb=174624884.4.10.1270989003; __utmc=174624884 Pragma: no-cache Cache-Control: no-cache HTTP/1.1 200 OK Date: Sun, 11 Apr 2010 12:57:41 GMT Server: Apache/2.2.14 (Unix) mod_ssl/2.2.14 OpenSSL/0.9.8l DAV/2 mod_auth_passthrough/2.1 FrontPage/5.0.2.2635 Last-Modified: Sun, 04 Apr 2010 12:51:06 GMT Etag: "eb42d6-7d9b843-48368aa6dc280" Accept-Ranges: bytes Content-Length: 131708995 Keep-Alive: timeout=10, max=30 Connection: Keep-Alive Content-Type: video/x-ms-wmv And here's what they look like for the request answered by my script: http://www.grinderschool.com/download_video_test.php?t=KillsAids021&format=wmv GET /download_video_test.php?t=KillsAids021&format=wmv HTTP/1.1 Host: www.grinderschool.com User-Agent: Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.3) Gecko/20100401 Firefox/3.6.3 (.NET CLR 3.5.30729) Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8 Accept-Language: en-us,en;q=0.5 Accept-Encoding: gzip,deflate Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7 Keep-Alive: 115 Connection: keep-alive Cookie: style_cookie=printonly; phpbb3_7c544_u=2; phpbb3_7c544_k=44b832912e5f887d; phpbb3_7c544_sid=e8852df42e08cc1b2250300c2897f78f; __utma=174624884.2719561324781918700.1251850714.1270986325.1270989003.575; __utmz=174624884.1264524375.411.12.utmcsr=google|utmccn=(organic)|utmcmd=organic|utmctr=low%20stakes%20poker%20videos; phpbb3_cmviy_k=; phpbb3_cmviy_u=2; phpbb3_cmviy_sid=d8df5c0943863004ca40ef9c392d371d; __utmb=174624884.4.10.1270989003; __utmc=174624884 HTTP/1.1 200 OK Date: Sun, 11 Apr 2010 12:58:02 GMT Server: Apache/2.2.14 (Unix) mod_ssl/2.2.14 OpenSSL/0.9.8l DAV/2 mod_auth_passthrough/2.1 FrontPage/5.0.2.2635 X-Powered-By: PHP/5.2.11 Content-Disposition: attachment; filename=KillsAids021.wmv Vary: Accept-Encoding Content-Encoding: gzip Keep-Alive: timeout=10, max=30 Connection: Keep-Alive Transfer-Encoding: chunked Content-Type: video/x-ms-wmv So the question is...what can I do to make downloads from the script work properly? Again, for 99% of users, it works as is (though I find it annoying now that no filesize is reported and thus that no time estimate can be computed about the download).

    Read the article

  • Is there any better way for creating a dynamic HTML table without using any javascript library like

    - by piemesons
    Dont worry we dont need to find out any bug in this code.. Its working perfectly.:-P My boss came to me and said "Hey just tell me whats the best of way of writing code for a dynamic HTML table (add row, delete row, update row).No need to add any CSS. Just javascript. No Jquery library etc. I was confused that in the middle of the project why he asking for some stupid exercise like this. What ever i wrote the following code and mailed him and after 15 mins i got a mail from him. " I was expecting much better code from a guy like you. Anyways good job monkey.(And with a picture of monkey as attachment.) thats was the mail. Line by line. I want to reply him but before that i want to know about the quality of my code. Is this really shitty...!!! Or he was just making fun of mine. I dont think that code is really shitty. Still correct me if you can.Code is working perfectly fine. Just copy paste it in a HTML file. <html> <head> <title> Exercise CSS </title> <script type="text/javascript"> function add_row() { var table = document.getElementById('table'); var rowCount = table.rows.length; var row = table.insertRow(rowCount); var cell1 = row.insertCell(0); var element1 = document.createElement("input"); element1.type = "text"; cell1.appendChild(element1); var cell2 = row.insertCell(1); var element2 = document.createElement("input"); element2.type = "text"; cell2.appendChild(element2); var cell3 = row.insertCell(2); cell3.innerHTML = ' <span onClick="edit(this)">Edit</span>/<span onClick="delete_row(this)">Delete</span>'; cell3.setAttribute("style", "display:none;"); var cell4 = row.insertCell(3); cell4.innerHTML = '<span onClick="save(this)">Save</span>'; } function save(e) { var elTableCells = e.parentNode.parentNode.getElementsByTagName("td"); elTableCells[0].innerHTML=elTableCells[0].firstChild.value; elTableCells[1].innerHTML=elTableCells[1].firstChild.value; elTableCells[2].setAttribute("style", "display:block;"); elTableCells[3].setAttribute("style", "display:none;"); } function edit(e) { var elTableCells = e.parentNode.parentNode.getElementsByTagName("td"); elTableCells[0].innerHTML='<input type="text" value="'+elTableCells[0].innerHTML+'">'; elTableCells[1].innerHTML='<input type="text" value="'+elTableCells[1].innerHTML+'">'; elTableCells[2].setAttribute("style", "display:none;"); elTableCells[3].setAttribute("style", "display:block;"); } function delete_row(e) { e.parentNode.parentNode.parentNode.removeChild(e.parentNode.parentNode); } </script> </head> <body > <div id="display"> <table id='table'> <tr id='id'> <td> Piemesons </td> <td> 23 </td> <td > <span onClick="edit(this)">Edit</span>/<span onClick="delete_row(this)">Delete</span> </td> <td style="display:none;"> <span onClick="save(this)">Save</span> </td> </tr> </table> <input type="button" value="Add new row" onClick="add_row();" /> </div> </body>

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Assembly - Read next sector of a virtual disk

    - by ali
    As any programmer in the world at least once in his/her life, I am trying to create my "revolutionary", the new and only one operating system. :D Well, I am using a virtual emulator (Oracle VM Virtual Box), for which I create a new unknwon operating system, with a vmdk disk. I like vmdk because they are just plain files, so I can paste my boot-loader over the first 512 bytes of the virtual hard disk. Now, I am trying to read the next sector of this virtual disk, on which I would paste a simple kernel that would display a message. I have two questions: Am I reading the second segment (the first -512 bytes- is occupied by the bootloader) correctly? CODE: CitesteDisc: mov bx, 0x8000 ; segment mov es, bx mov bx, 0x0000 ; offset mov ah, 0x02 ; read function mov al, 0x01 ; sectors - this might be wrong, trying to read from hd mov ch, 0x00 ; cylinder mov cl, 0x02 ; sector mov dh, 0x00 ; head mov dl, 0x80 ; drive - trying to read from hd int 0x13 ; disk int mov si, ErrorMessage ; - This will display an error message jc ShowMessage jmp [es:bx] ; buffer Here, I get the error message, after checking CF. However, if I use INT 13, 1 to get last status message, AL is 0 - so no error is saved. Am I pasting my simple kernel in the correct place inside the vmdk? What I do is pasting it after the 512th byte of the file, the first 512 bytes, as I said, are the boot-loader. The file would look like this: BE 45 7C E8 16 00 EB FE B4 0E B7 00 B3 07 CD 10 <- First sector C3 AC 08 C0 74 05 E8 EF FF EB F6 C3 B4 00 B2 80 CD 13 BE 5D 7C 72 F5 BB 00 80 8E C3 BB 00 00 B4 02 B0 06 B5 00 B1 01 B6 00 B2 07 CD 13 BE 4E 7C 72 CF 26 FF 27 57 65 6C 63 6F 6D 65 21 00 52 65 61 64 69 6E 67 20 65 72 72 6F 72 21 00 52 65 73 65 74 74 69 6E 67 20 65 72 72 6F 72 21 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 55 AA <- Boot-loader signature B4 0E B0 2E CD 10 EB FE 00 00 00 00 00 00 00 00 <- Start of the second sector 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 So, this is the way I am trying to add the kernel to the second sector. What do you think is wrong with this? Thanks!

    Read the article

  • login form whith java/sqlite

    - by tuxou
    hi I would like to create a login form for my application with the possibility to add or remove users for an sqlite database, i have created the table users(nam, pass) but i can't unclud it in my login form, it someone could help me this is my login code: import java.awt.*; import java.awt.event.*; import javax.swing.*; public class login extends JFrame { // Variables declaration private JLabel jLabel1; private JLabel jLabel2; private JTextField jTextField1; private JPasswordField jPasswordField1; private JButton jButton1; private JPanel contentPane; // End of variables declaration public login() { super(); create(); this.setVisible(true); } private void create() { jLabel1 = new JLabel(); jLabel2 = new JLabel(); jTextField1 = new JTextField(); jPasswordField1 = new JPasswordField(); jButton1 = new JButton(); contentPane = (JPanel)this.getContentPane(); // // jLabel1 // jLabel1.setHorizontalAlignment(SwingConstants.LEFT); jLabel1.setForeground(new Color(0, 0, 255)); jLabel1.setText("username:"); // // jLabel2 // jLabel2.setHorizontalAlignment(SwingConstants.LEFT); jLabel2.setForeground(new Color(0, 0, 255)); jLabel2.setText("password:"); // // jTextField1 // jTextField1.setForeground(new Color(0, 0, 255)); jTextField1.setSelectedTextColor(new Color(0, 0, 255)); jTextField1.setToolTipText("Enter your username"); jTextField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jTextField1_actionPerformed(e); } }); // // jPasswordField1 // jPasswordField1.setForeground(new Color(0, 0, 255)); jPasswordField1.setToolTipText("Enter your password"); jPasswordField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jPasswordField1_actionPerformed(e); } }); // // jButton1 // jButton1.setBackground(new Color(204, 204, 204)); jButton1.setForeground(new Color(0, 0, 255)); jButton1.setText("Login"); jButton1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jButton1_actionPerformed(e); } }); // // contentPane // contentPane.setLayout(null); contentPane.setBorder(BorderFactory.createEtchedBorder()); contentPane.setBackground(new Color(204, 204, 204)); addComponent(contentPane, jLabel1, 5,10,106,18); addComponent(contentPane, jLabel2, 5,47,97,18); addComponent(contentPane, jTextField1, 110,10,183,22); addComponent(contentPane, jPasswordField1, 110,45,183,22); addComponent(contentPane, jButton1, 150,75,83,28); // // login // this.setTitle("Login To Members Area"); this.setLocation(new Point(76, 182)); this.setSize(new Dimension(335, 141)); this.setDefaultCloseOperation(WindowConstants.EXIT_ON_CLOSE); this.setResizable(false); } /** Add Component Without a Layout Manager (Absolute Positioning) */ private void addComponent(Container container,Component c,int x,int y,int width,int height) { c.setBounds(x,y,width,height); container.add(c); } private void jTextField1_actionPerformed(ActionEvent e) { } private void jPasswordField1_actionPerformed(ActionEvent e) { } private void jButton1_actionPerformed(ActionEvent e) { System.out.println("\njButton1_actionPerformed(ActionEvent e) called."); String username = new String(jTextField1.getText()); String password = new String(jPasswordField1.getText()); if(username.equals("") || password.equals("")) // If password and username is empty Do this { jButton1.setEnabled(false); JLabel errorFields = new JLabel("You must enter a username and password to login."); JOptionPane.showMessageDialog(null,errorFields); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); this.setVisible(true); } else { JLabel optionLabel = new JLabel("You entered "+username+" as your username. Is this correct?"); int confirm =JOptionPane.showConfirmDialog(null,optionLabel); switch(confirm){ // Switch Case case JOptionPane.YES_OPTION: // Attempt to Login user jButton1.setEnabled(false); // Set button enable to false to prevent 2 login attempts break; case JOptionPane.NO_OPTION: // No Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; case JOptionPane.CANCEL_OPTION: // Cancel Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; } // End Switch Case } } public static void main(String[] args) { JFrame.setDefaultLookAndFeelDecorated(true); JDialog.setDefaultLookAndFeelDecorated(true); try { UIManager.setLookAndFeel("com.sun.java.swing.plaf.windows.WindowsLookAndFeel"); } catch (Exception ex) { System.out.println("Failed loading L&F: "); System.out.println(ex); } new login(); }; }

    Read the article

  • My programme is for java

    - by Siddharth Pandey
    I wrote a codding on notepad and i was base on Candidate details i was trying to run the code like for example to say if u r in the school and we need the details for the candidate so all the details like name Id address age dateofbirth and soooo So my exatlly problem is that i have allready created the code and i have written it on the notepad so when ever i am going the command prompt and giving its path and all the details still it always show some problem like class interfierence or expected iw will paste the codding over here and pls if u can help me correct the coding it will be pleasure thank u. import java.swing.*; import javac.awt.*; public CandidateDetails extends JApplets; { JPanel Panel; JLabel LabelStudentID; JLabel LabelStudentNames; JLabel LabelStudentAddress; JLabel LabelStudentAge; JLabel LabelStudentDateofBirth; JLabel LabelStudentMobile no; JLabel LabelStudentCrouse; JTextField textStudentID; JTextField textStudentNames; JTextField textStudentAddress; JTextField textStudentAge; JTextField textStudentDateofBirth; JTextField textStudentMobileNo; JTextField textStudentCrouse; } public void init(); { Label StudentID = new JLabel("Student ID"); Label StudentNames = new JLabel("Student Names"); Label StudentAddress = new JLabel("Student Address"); Label StudentAge = new JLabel("Student Age"); Label StudentDateofBirth = new JLabel("Student DateofBirth"); Label StudentMobileNo = new JLabel("Student MobileNo"); Label StudentCourse = new JLabel("Student Course"); JTextField text("ID"); JTextField text("Names"); JTextField text("Address"); JTextField text("Age"); JTextField text("DateofBirth"); JTextField text("MobileofBirth"); JTextField text("Course"); } { GridBag layourt.NORTHWEST; b1=1; b2=2; gbc.gridconstraint(label Student ID); add.panel(ID); GridBag layourt.NORTHWEST; b1=1; b2=3; gbc.gridconstraint(text Student ID); add.panel(ID); GridBag layourt.NORTHWEST; b1=2; b2=3; gbc.gridconstraint(label Student Names); add.panel(Names); GridBag layourt.NORTHWEST; b1=3; b2=4; gbc.gridconstraint(text Student Names); add.panel(Names); GridBag layourt.NORTHWEST; b1=3; b2=5; gbc.gridconstraint(label Student Address); add.panel(Address); GridBag layourt.NORTHWEST; b1=3; b2=4; gbc.gridconstraint(text Student Address); add.panel(Address); GridBag layourt.NORTHWEST; b1=4; b2=5; gbc.gridconstraint(label Student DateofBirth); add.panel(DateofBirth); GridBag layourt.NORTHWEST; b1=5; b2=6; gbc.gridconstraint(text Student DateofBirth); add.panel(DateofBirth); GridBag layourt.NORTHWEST; b1=5; b2=4; gbc.gridconstraint(label Student MobileNo); add.panel(MobileNo); GridBag layourt.NORTHWEST; b1=5; b2=6; gbc.gridconstraint(text Student MobileNo); add.panel(MobileNo); GridBag layourt.NORTHWEST; b1=6; b2=7; gbc.gridconstraint(label Student Course); add.panel(Course); GridBag layourt.NORTHWEST; b1=7; b2=8; gbc.gridconstraint(text Student Course); add.panel(Course); }

    Read the article

  • creating a color coded time chart using colorbar and colormaps in python

    - by Rusty
    I'm trying to make a time tracking chart based on a daily time tracking file that I used. I wrote code that crawls through my files and generates a few lists. endTimes is a list of times that a particular activity ends in minutes going from 0 at midnight the first day of the month to however many minutes are in a month. labels is a list of labels for the times listed in endTimes. It is one shorter than endtimes since the trackers don't have any data about before 0 minute. Most labels are repeats. categories contains every unique value of labels in order of how well I regard that time. I want to create a colorbar or a stack of colorbars (1 for eachday) that will depict how I spend my time for a month and put a color associated with each label. Each value in categories will have a color associated. More blue for more good. More red for more bad. It is already in order for the jet colormap to be right, but I need to get desecrate color values evenly spaced out for each value in categories. Then I figure the next step would be to convert that to a listed colormap to use for the colorbar based on how the labels associated with the categories. I think this is the right way to do it, but I am not sure. I am not sure how to associate the labels with color values. Here is the last part of my code so far. I found one function to make a discrete colormaps. It does, but it isn't what I am looking for and I am not sure what is happening. Thanks for the help! # now I need to develop the graph import numpy as np from matplotlib import pyplot,mpl import matplotlib from scipy import interpolate from scipy import * def contains(thelist,name): # checks if the current list of categories contains the one just read for val in thelist: if val == name: return True return False def getCategories(lastFile): ''' must determine the colors to use I would like to make a gradient so that the better the task, the closer to blue bad labels will recieve colors closer to blue read the last file given for the information on how I feel the order should be then just keep them in the order of how good they are in the tracker use a color range and develop discrete values for each category by evenly spacing them out any time not found should assume to be sleep sleep should be white ''' tracker = open(lastFile+'.txt') # open the last file # find all the categories categories = [] for line in tracker: pos = line.find(':') # does it have a : or a ? if pos==-1: pos=line.find('?') if pos != -1: # ignore if no : or ? name = line[0:pos].strip() # split at the : or ? if contains(categories,name)==False: # if the category is new categories.append(name) # make a new one return categories # find good values in order of last day newlabels=[] for val in getCategories(lastDay): if contains(labels,val): newlabels.append(val) categories=newlabels # convert discrete colormap to listed colormap python for ii,val in enumerate(labels): if contains(categories,val)==False: labels[ii]='sleep' # create a figure fig = pyplot.figure() axes = [] for x in range(endTimes[-1]%(24*60)): ax = fig.add_axes([0.05, 0.65, 0.9, 0.15]) axes.append(ax) # figure out the colors to use # stole this function to make a discrete colormap # http://www.scipy.org/Cookbook/Matplotlib/ColormapTransformations def cmap_discretize(cmap, N): """Return a discrete colormap from the continuous colormap cmap. cmap: colormap instance, eg. cm.jet. N: Number of colors. Example x = resize(arange(100), (5,100)) djet = cmap_discretize(cm.jet, 5) imshow(x, cmap=djet) """ cdict = cmap._segmentdata.copy() # N colors colors_i = np.linspace(0,1.,N) # N+1 indices indices = np.linspace(0,1.,N+1) for key in ('red','green','blue'): # Find the N colors D = np.array(cdict[key]) I = interpolate.interp1d(D[:,0], D[:,1]) colors = I(colors_i) # Place these colors at the correct indices. A = zeros((N+1,3), float) A[:,0] = indices A[1:,1] = colors A[:-1,2] = colors # Create a tuple for the dictionary. L = [] for l in A: L.append(tuple(l)) cdict[key] = tuple(L) # Return colormap object. return matplotlib.colors.LinearSegmentedColormap('colormap',cdict,1024) # jet colormap goes from blue to red (good to bad) cmap = cmap_discretize(mpl.cm.jet, len(categories)) cmap.set_over('0.25') cmap.set_under('0.75') #norm = mpl.colors.Normalize(endTimes,cmap.N) print endTimes print labels # make a color list by matching labels to a picture #norm = mpl.colors.ListedColormap(colorList) cb1 = mpl.colorbar.ColorbarBase(axes[0],cmap=cmap ,orientation='horizontal' ,boundaries=endTimes ,ticks=endTimes ,spacing='proportional') pyplot.show()

    Read the article

  • JTabbedPane: only first tab is drawn, the second is always empty (newbie Q)

    - by paul
    I created a very simple JTabbedPane by first creating an empty JTabbedPane object, then 2 JPanels that I later add. Each JPanel is holding a object that extends JButton and implements MouseListener. Each of these holds a different image loaded from a file; the image is held locally as a buffered image and as an image icon, etc., all of which works great. The point of all that is to allow resizing of the image when the button is resized (using getscaledinstance()), because the panel is resized, because the JTabbedPane is resized, etc., within the JFrame that holds everything. I override paintComponent() to accomplish this in the class that extends JButton. I am using MigLayout Manager, and all is well on that front controlling layout constraints, growing, filling, initial sizes, preferred sizes, etc. The images the buttons hold are of different sizes and proportions, but this caused no trouble before. Up until 2 days ago everything worked fairly well. I made some changes trying to tweak some resizing issues as I was picking up MigLayout manager. At the time I was playing around with setting various min, max, and preferred sizes using the methods provided for by the components, not the layout manager. I also fooled a bit with pack(), validate(), visible(), opaque() etc., and yes I read the article about Swing and AWT painting here: http://java.sun.com/products/jfc/tsc/articles/painting/ , and I switched to relying more and more on MigLayout. On an unrelated note, it appears JFrame's do not honor maxsize? Somehow, today, with and without using any of these methods provided by swing, with or without using MigLayout manager to handle some of these matters instead, I now have a JTabbedPane that correctly displays the FIRST JPanel I add, but NOT THE SECOND JPanel--which, while present as a tab--does not show when selected. I have switched the order of which panel is added first, and this still holds true regardless of which JPanel I add first, telling me the JPanels are ok, and the problem is most likely in the JTabbedPane. I click on the second tab, the JTabbedPane switches, but I have what appears to be a blank button in the JPanel. A few console system-out statements reveal the following: a) that the second panel and its button are constructed b) no mouse events are being captured when I click on where the second panel and button should reside, as if it didn't exist at that point; c) when I switch to the second tab, the overrided paintComponent() method of the button within that second JPanel is never called, so it is in fact never being painted despite the tab in which it resides becoming visible; d) the JTabbpedPane getComponentCount() returns a correct value of 2 after adding the 2nd panel; e) MigLayout manager actually rocks, but I digress... I cannot now revert to my older code, and despite my best efforts to undo whatever changes caused this, I cannot fix my new problem. I've commented out everything but the most essential calls: constructors for each object--with MigLayout; add() for placing the buttons on the panels using string-arguments appropriate for MigLayout; add() for placing the panels on the JTabbedPane, also with MigLayout string arguments; setting the default op on close for the JFrame; and setting the JFrame visible. This means I do not fiddle with optimization settings, double buffering settings, opaque settings, but leave them as default, and still, no fix; the second panel will not show itself. Each panel, I should add, when it is the first to be loaded, works fine, again re-affirming that the panels and buttons are themselves ok. Here is part of what I am doing: //Note: BuildaButton is a class that merely constructs my instances File f = new File("/foo.jpg"); button1 = new BuildaButton().BuildaButton(f).buildfoo1Button(); f = new File("/foo2.jpg"); button2 = new BuildaButton().BuildaButton(f).buildfoo2Button(); MigLayout ml = new MigLayout("wrap 1", "[fill, grow]0[fill, grow]", "[fill, grow]0[fill, grow]"); MigLayout ml2 = new MigLayout("wrap 2", "[fill, grow]5[fill, grow]", "[fill, grow]0[fill, grow]"); foo1panel = new JPanel(ml); foo1panel.add(button1, "w 234:945:, h 200:807:"); foo2panel = new JPanel(ml); foo2panel.add(button2, "w 186:752:, h 200:807:"); tabs.add("foo1", foo1panel); tabs.add("foo2", foo2panel); System.out.println("contents of tabs: " + tabs.getComponentCount() + " elements"); mainframe.setLayout(ml2); mainframe.setMinimumSize(new Dimension(850,800)); mainframe.add(tabs, "w 600:800:, h 780:780:"); //controlpanel is a still blank jpanel that holds nothing--it is a space holder for now & will be utilized mainframe.add(controlpanel, "w 200:200:200, h 780:780:"); mainframe.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); mainframe.setVisible(true); Thank you in advance for any help you can give.

    Read the article

  • Array subscript is not an integer

    - by Dimitri
    Hello folks, following this previous question Malloc Memory Corruption in C, now i have another problem. I have the same code. Now I am trying to multiply the values contained in the arrays A * vc and store in res. Then A is set to zero and i do a second multiplication with res and vc and i store the values in A. (A and Q are square matrices and mc and vc are N lines two columns matrices or arrays). Here is my code : int jacobi_gpu(double A[], double Q[], double tol, long int dim){ int nrot, p, q, k, tid; double c, s; double *mc, *vc, *res; int i,kc; double vc1, vc2; mc = (double *)malloc(2 * dim * sizeof(double)); vc = (double *)malloc(2 * dim * sizeof(double)); vc = (double *)malloc(dim * dim * sizeof(double)); if( mc == NULL || vc == NULL){ fprintf(stderr, "pb allocation matricre\n"); exit(1); } nrot = 0; for(k = 0; k < dim - 1; k++){ eye(mc, dim); eye(vc, dim); for(tid = 0; tid < floor(dim /2); tid++){ p = (tid + k)%(dim - 1); if(tid != 0) q = (dim - tid + k - 1)%(dim - 1); else q = dim - 1; printf("p = %d | q = %d\n", p, q); if(fabs(A[p + q*dim]) > tol){ nrot++; symschur2(A, dim, p, q, &c, &s); mc[2*tid] = p; vc[2 * tid] = c; mc[2*tid + 1] = q; vc[2*tid + 1] = -s; mc[2*tid + 2*(dim - 2*tid) - 2] = p; vc[2*tid + 2*(dim - 2*tid) - 2 ] = s; mc[2*tid + 2*(dim - 2*tid) - 1] = q; vc[2 * tid + 2*(dim - 2*tid) - 1 ] = c; } } for( i = 0; i< dim; i++){ for(kc=0; kc < dim; kc++){ if( kc < floor(dim/2)) { vc1 = vc[2*kc + i*dim]; vc2 = vc[2*kc + 2*(dim - 2*kc) - 2]; }else { vc1 = vc[2*kc+1 + i*dim]; vc2 = vc[2*kc - 2*(dim - 2*kc) - 1]; } res[kc + i*dim] = A[mc[2*kc] + i*dim]*vc1 + A[mc[2*kc + 1] + i*dim]*vc2; } } zero(A, dim); for( i = 0; i< dim; i++){ for(kc=0; kc < dim; k++){ if( k < floor(dim/2)){ vc1 = vc[2*kc + i*dim]; vc2 = vc[2*kc + 2*(dim - 2*kc) - 2]; }else { vc1 = vc[2*kc+1 + i*dim]; vc2 = vc[2*kc - 2*(dim - 2*kc) - 1]; } A[kc + i*dim] = res[mc[2*kc] + i*dim]*vc1 + res[mc[2*kc + 1] + i*dim]*vc2; } } affiche(mc,dim,2,"Matrice creuse"); affiche(vc,dim,2,"Valeur creuse"); } free(mc); free(vc); free(res); return nrot; } When i try to compile, i have this error : jacobi_gpu.c: In function ‘jacobi_gpu’: jacobi_gpu.c:103: error: array subscript is not an integer jacobi_gpu.c:103: error: array subscript is not an integer jacobi_gpu.c:118: error: array subscript is not an integer jacobi_gpu.c:118: error: array subscript is not an integer make: *** [jacobi_gpu.o] Erreur 1 The corresponding lines are where I store the results in res and A : res[kc + i*dim] = A[mc[2*kc] + i*dim]*vc1 + A[mc[2*kc + 1] + i*dim]*vc2; and A[kc + i*dim] = res[mc[2*kc] + i*dim]*vc1 + res[mc[2*kc + 1] + i*dim]*vc2; Can someone explain me what is this error and how can i correct it? Thanks for your help. ;)

    Read the article

  • Ajax call in a jQuery plugin not working properly

    - by Saneef
    I'm trying to create a jQuery plugin, inside I need to do an AJAX call to load an xml. jQuery.fn.imagetags = function(options) { s = jQuery.extend({ height:null, width:null, url:false, callback:null, title:null, }, options); return this.each(function(){ obj = $(this); //Initialising the placeholder $holder = $('<div />') .width(s.width).height(s.height) .addClass('jimageholder') .css({ position: 'relative', }); obj.wrap($holder); $.ajax({ type: "GET", url: s.url, dataType: "xml", success:function(data){ initGrids(obj,data,s.callback,s.title); } , error: function(data) { alert("Error loading Grid data."); }, }); function initGrids(obj, data,callback,gridtitle){ if (!data) { alert("Error loading Grid data"); } $("gridlist gridset",data).each(function(){ var gridsetname = $(this).children("setname").text(); var gridsetcolor = ""; if ($(this).children("color").text() != "") { gridsetcolor = $(this).children("color").text(); } $(this).children("grid").each(function(){ var gridcolor = gridsetcolor; //This colour will override colour set for the grid set if ($(this).children("color").text() != "") { gridcolor = $(this).children("color").text(); } //addGrid(gridsetname,id,x,y,height,width) addGrid( obj, gridsetname, $(this).children("id").text(), $(this).children("x").text(), $(this).children("y").text(), $(this).children("height").text(), $(this).children("width").text(), gridcolor, gridtitle ); }); }); } function addGrid(obj,gridsetname,id,x,y,height,width,color,gridtitle){ //To compensate for the 2px border height-=4; width-=4; $grid = $('<div />') .addClass(gridsetname) .attr("id",id) .addClass('gridtag') .imagetagsResetHighlight() .css({ "bottom":y+"px", "left":x+"px", "height":height+"px", "width":width+"px", }); if(gridtitle != null){ $grid.attr("title",gridtitle); } if(color != ""){ $grid.css({ "border-color":color, }); } obj.after($grid); } }); } The above plugin I bind with 2 DOM objects and loads two seperate XML files but the callback function is run only on the last DOM object using both loaded XML files. How can I fix this, so that the callback is applied on the corresponding DOMs. Is the above ajax call is correct? Sample usage: <script type="text/javascript"> $(function(){ $(".romeo img").imagetags({ height:500, width:497, url: "sample-data.xml", title: "Testing...", callback:function(id){ console.log(id); }, }); }); </script> <div class="padding-10 min-item background-color-black"> <div class="romeo"><img src="images/samplecontent/test_500x497.gif" alt="Image"> </div> </div> <script type="text/javascript"> $(function(){ $(".romeo2 img").imagetags({ height:500, width:497, url: "sample-data2.xml", title: "Testing...", callback:function(id){ console.log(id); }, }); }); </script> <div class="padding-10 min-item background-color-black"> <div class="romeo2"><img src="images/samplecontent/test2_500x497.gif" alt="Image"> </div> </div> Here is the sample XML data: <?xml version="1.0" encoding="utf-8"?> <gridlist> <gridset> <setname>gridset4</setname> <color>#00FF00</color> <grid> <color>#FF77FF</color> <id>grid2-324</id> <x>300</x> <y>300</y> <height>60</height> <width>60</width> </grid> </gridset> <gridset> <setname>gridset3</setname> <color>#00FF00</color> <grid> <color>#FF77FF</color> <id>grid2-212</id> <x>300</x> <y>300</y> <height>100</height> <width>100</width> </grid> <grid> <color>#FF77FF</color> <id>grid2-1212</id> <x>200</x> <y>10</y> <height>200</height> <width>10</width> </grid> </gridset> </gridlist>

    Read the article

  • Hi i have a c programming doubt in the implementation of hash table?

    - by aks
    Hi i have a c programming doubt in the implementation of hash table? I have implemented the hash table for storing some strings? I am having problem while dealing with hash collisons. I am following chaining link-list approach to overcome the same? But, somehow my code is behaving differently. I am not able to debug the same? Can somebody help? This is what i am facing: Say first time, i insert a string called gaur. My hash map calculates the index as 0 and inserts the string successfully. However, when another string whose hash map also when calculates turns out to be 0, my previous value gets overrridden i.e. gaur will be replaced by new string. This is my code: struct list { char *string; struct list *next; }; struct hash_table { int size; /* the size of the table */ struct list **table; /* the table elements */ }; struct hash_table *create_hash_table(int size) { struct hash_table *new_table; int i; if (size<1) return NULL; /* invalid size for table */ /* Attempt to allocate memory for the table structure */ if ((new_table = malloc(sizeof(struct hash_table))) == NULL) { return NULL; } /* Attempt to allocate memory for the table itself */ if ((new_table->table = malloc(sizeof(struct list *) * size)) == NULL) { return NULL; } /* Initialize the elements of the table */ for(i=0; i<size; i++) new_table->table[i] = '\0'; /* Set the table's size */ new_table->size = size; return new_table; } unsigned int hash(struct hash_table *hashtable, char *str) { unsigned int hashval = 0; int i = 0; for(; *str != '\0'; str++) { hashval += str[i]; i++; } return (hashval % hashtable->size); } struct list *lookup_string(struct hash_table *hashtable, char *str) { printf("\n enters in lookup_string \n"); struct list * new_list; unsigned int hashval = hash(hashtable, str); /* Go to the correct list based on the hash value and see if str is * in the list. If it is, return return a pointer to the list element. * If it isn't, the item isn't in the table, so return NULL. */ for(new_list = hashtable->table[hashval]; new_list != NULL;new_list = new_list->next) { if (strcmp(str, new_list->string) == 0) return new_list; } printf("\n returns NULL in lookup_string \n"); return NULL; } int add_string(struct hash_table *hashtable, char *str) { printf("\n enters in add_string \n"); struct list *new_list; struct list *current_list; unsigned int hashval = hash(hashtable, str); printf("\n hashval = %d", hashval); /* Attempt to allocate memory for list */ if ((new_list = malloc(sizeof(struct list))) == NULL) { printf("\n enters here \n"); return 1; } /* Does item already exist? */ current_list = lookup_string(hashtable, str); if (current_list == NULL) { printf("\n DEBUG Purpose \n"); printf("\n NULL \n"); } /* item already exists, don't insert it again. */ if (current_list != NULL) { printf("\n Item already present...\n"); return 2; } /* Insert into list */ printf("\n Inserting...\n"); new_list->string = strdup(str); new_list->next = NULL; //new_list->next = hashtable->table[hashval]; if(hashtable->table[hashval] == NULL) { hashtable->table[hashval] = new_list; } else { struct list * temp_list = hashtable->table[hashval]; while(temp_list->next!=NULL) temp_list = temp_list->next; temp_list->next = new_list; hashtable->table[hashval] = new_list; } return 0; }

    Read the article

  • App crashes when adding array data to table cells

    - by bassmandan
    I am trying to create a table view that loads a number of tweets into the table (one per cell etc). I am using NSXMLParser to get the information and have got as far as creating an array with the selection of tweets that I want. However, when I try to add them to the table cells, the app crashes on the line: cell.textLabel.text = cellValue; An NSLog before this shows in the console that the app is getting the correct data, so I am a bit stumped as to why this isn't working. This is the block of code that appears to be having the problem: - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier]; } // Set up the cell... NSString *cellValue = [statuses objectAtIndex:indexPath.row]; NSLog(@"%@", cellValue); cell.textLabel.text = cellValue; return cell;} If it makes a difference, I am using ARC and the latest version of XCode. I'm still quite new to all this, so if I need to give some extra information, let me know. Thanks in advance. Edit: Backtrace gives the following: * thread #1: tid = 0x2003, 0x918a19c6 libsystem_kernel.dylib`__pthread_kill + 10, stop reason = signal SIGABRT frame #0: 0x918a19c6 libsystem_kernel.dylib`__pthread_kill + 10 frame #1: 0x9968ff78 libsystem_c.dylib`pthread_kill + 106 frame #2: 0x99680bdd libsystem_c.dylib`abort + 167 frame #3: 0x03c93e78 libc++abi.dylib`_Unwind_DeleteException frame #4: 0x03c9189e libc++abi.dylib`_ZL17default_terminatev + 34 frame #5: 0x0154df4b libobjc.A.dylib`_objc_terminate + 94 frame #6: 0x03c918de libc++abi.dylib`_ZL19safe_handler_callerPFvvE + 13 frame #7: 0x03c91946 libc++abi.dylib`std::terminate() + 23 frame #8: 0x03c92ab2 libc++abi.dylib`__cxa_throw + 110 frame #9: 0x0154de15 libobjc.A.dylib`objc_exception_throw + 311 frame #10: 0x013bdced CoreFoundation`-[NSObject doesNotRecognizeSelector:] + 253 frame #11: 0x01322f00 CoreFoundation`___forwarding___ + 432 frame #12: 0x01322ce2 CoreFoundation`_CF_forwarding_prep_0 + 50 frame #13: 0x0015168f UIKit`-[UILabel setText:] + 56 frame #14: 0x00003088 Twitter`-[TwitterViewController tableView:cellForRowAtIndexPath:] + 376 at TwitterViewController.m:131 frame #15: 0x000ace0f UIKit`-[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:withIndexPath:] + 494 frame #16: 0x000ad589 UIKit`-[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:] + 69 frame #17: 0x00098dfd UIKit`-[UITableView(_UITableViewPrivate) _updateVisibleCellsNow:] + 1350 frame #18: 0x000a7851 UIKit`-[UITableView layoutSubviews] + 242 frame #19: 0x00052301 UIKit`-[UIView(CALayerDelegate) layoutSublayersOfLayer:] + 145 frame #20: 0x013bde72 CoreFoundation`-[NSObject performSelector:withObject:] + 66 frame #21: 0x01d6692d QuartzCore`-[CALayer layoutSublayers] + 266 frame #22: 0x01d70827 QuartzCore`CA::Layer::layout_if_needed(CA::Transaction*) + 231 frame #23: 0x01cf6fa7 QuartzCore`CA::Context::commit_transaction(CA::Transaction*) + 377 frame #24: 0x01cf8ea6 QuartzCore`CA::Transaction::commit() + 374 frame #25: 0x01d8430c QuartzCore`+[CATransaction flush] + 52 frame #26: 0x000124c6 UIKit`-[UIApplication _reportAppLaunchFinished] + 39 frame #27: 0x00012bd6 UIKit`-[UIApplication _runWithURL:payload:launchOrientation:statusBarStyle:statusBarHidden:] + 1324 frame #28: 0x00021743 UIKit`-[UIApplication handleEvent:withNewEvent:] + 1027 frame #29: 0x000221f8 UIKit`-[UIApplication sendEvent:] + 68 frame #30: 0x00015aa9 UIKit`_UIApplicationHandleEvent + 8196 frame #31: 0x012a6fa9 GraphicsServices`PurpleEventCallback + 1274 frame #32: 0x013901c5 CoreFoundation`__CFRUNLOOP_IS_CALLING_OUT_TO_A_SOURCE1_PERFORM_FUNCTION__ + 53 frame #33: 0x012f5022 CoreFoundation`__CFRunLoopDoSource1 + 146 frame #34: 0x012f390a CoreFoundation`__CFRunLoopRun + 2218 frame #35: 0x012f2db4 CoreFoundation`CFRunLoopRunSpecific + 212 frame #36: 0x012f2ccb CoreFoundation`CFRunLoopRunInMode + 123 frame #37: 0x000122a7 UIKit`-[UIApplication _run] + 576 frame #38: 0x00013a9b UIKit`UIApplicationMain + 1175 frame #39: 0x0000239d Twitter`main + 141 at main.m:16 frame #40: 0x00002305 Twitter`start + 53 Debugging console shows this: 2012-04-08 10:10:05.084 Twitter[25309:f803] ( { text = "Have you shared the Shakedown yet? http://t.co/WHrIC9w7"; }, { text = "For all you closet rocknrollas pencil in Sat 12th May The Rebirth of Rock n Roll Party. Haywire Saint @ The Good... http://t.co/OXHKlLIV"; }, { text = "4 weeks today: Vocal tracks will be getting recorded at The Premises Studios"; }, { text = "Rehearsal tonight in preparation to some big recording next month!"; }, { text = "haywire saint 'great taste.' Tune. \n\nhttp://t.co/GKmu5Lna http://t.co/0fii55Hw"; }, { text = "Meeting up with an old roadie for The Cure today. oh the stories...... http://t.co/UeUYccme"; }, { text = "Satisfying day of programming today.. Haywire Saint app coming along nicely with the custom music player ready to rock 'n' roll!"; }, { text = "Happy Friday Everyone!"; }, { text = "We had a great time at The Premises Studios yesterday. We'll be back there before long :D x"; }, { text = "I posted a new photo to Facebook http://t.co/73qAnCvk"; } ) 2012-04-08 10:10:05.093 Twitter[25309:f803] { text = "Have you shared the Shakedown yet? http://t.co/WHrIC9w7"; } 2012-04-08 10:10:05.094 Twitter[25309:f803] -[__NSCFDictionary isEqualToString:]: unrecognized selector sent to instance 0x6877a50 2012-04-08 10:10:05.096 Twitter[25309:f803] *** Terminating app due to uncaught exception 'NSInvalidArgumentException', reason: '-[__NSCFDictionary isEqualToString:]: unrecognized selector sent to instance 0x6877a50' *** First throw call stack: (0x13bc052 0x154dd0a 0x13bdced 0x1322f00 0x1322ce2 0x15168f 0x3088 0xace0f 0xad589 0x98dfd 0xa7851 0x52301 0x13bde72 0x1d6692d 0x1d70827 0x1cf6fa7 0x1cf8ea6 0x1d8430c 0x124c6 0x12bd6 0x21743 0x221f8 0x15aa9 0x12a6fa9 0x13901c5 0x12f5022 0x12f390a 0x12f2db4 0x12f2ccb 0x122a7 0x13a9b 0x239d 0x2305) terminate called throwing an exception2012-04-08 10:10:05.924 Twitter[25309:f803] -[__NSCFConstantString count]: unrecognized selector sent to instance 0x5b30

    Read the article

  • For Loop help In a Hash Cracker Homework.

    - by aaron burns
    On the homework I am working on we are making a hash cracker. I am implementing it so as to have my cracker. java call worker.java. Worker.java implements Runnable. Worker is to take the start and end of a list of char, the hash it is to crack, and the max length of the password that made the hash. I know I want to do a loop in run() BUT I cannot think of how I would do it so it would go to the given max pasword length. I have posted the code I have so far. Any directions or areas I should look into.... I thought there was a way to do this with a certain way to write the loop but I don't know or can't find the correct syntax. Oh.. also. In main I divide up so x amount of threads can be chosen and I know that as of write now it only works for an even number of the 40 possible char given. package HashCracker; import java.util.*; import java.security.MessageDigest; import java.security.NoSuchAlgorithmException; public class Cracker { // Array of chars used to produce strings public static final char[] CHARS = "abcdefghijklmnopqrstuvwxyz0123456789.,-!".toCharArray(); public static final int numOfChar=40; /* Given a byte[] array, produces a hex String, such as "234a6f". with 2 chars for each byte in the array. (provided code) */ public static String hexToString(byte[] bytes) { StringBuffer buff = new StringBuffer(); for (int i=0; i<bytes.length; i++) { int val = bytes[i]; val = val & 0xff; // remove higher bits, sign if (val<16) buff.append('0'); // leading 0 buff.append(Integer.toString(val, 16)); } return buff.toString(); } /* Given a string of hex byte values such as "24a26f", creates a byte[] array of those values, one byte value -128..127 for each 2 chars. (provided code) */ public static byte[] hexToArray(String hex) { byte[] result = new byte[hex.length()/2]; for (int i=0; i<hex.length(); i+=2) { result[i/2] = (byte) Integer.parseInt(hex.substring(i, i+2), 16); } return result; } public static void main(String args[]) throws NoSuchAlgorithmException { if(args.length==1)//Hash Maker { //create a byte array , meassage digestand put password into it //and get out a hash value printed to the screen using provided methods. byte[] myByteArray=args[0].getBytes(); MessageDigest hasher=MessageDigest.getInstance("SHA-1"); hasher.update(myByteArray); byte[] digestedByte=hasher.digest(); String hashValue=Cracker.hexToString(digestedByte); System.out.println(hashValue); } else//Hash Cracker { ArrayList<Thread> myRunnables=new ArrayList<Thread>(); int numOfThreads = Integer.parseInt(args[2]); int charPerThread=Cracker.numOfChar/numOfThreads; int start=0; int end=charPerThread-1; for(int i=0; i<numOfThreads; i++) { //creates, stores and starts threads. Runnable tempWorker=new Worker(start, end, args[1], Integer.parseInt(args[1])); Thread temp=new Thread(tempWorker); myRunnables.add(temp); temp.start(); start=end+1; end=end+charPerThread; } } } import java.util.*; public class Worker implements Runnable{ private int charStart; private int charEnd; private String Hash2Crack; private int maxLength; public Worker(int start, int end, String hashValue, int maxPWlength) { charStart=start; charEnd=end; Hash2Crack=hashValue; maxLength=maxPWlength; } public void run() { byte[] myHash2Crack_=Cracker.hexToArray(Hash2Crack); for(int i=charStart; i<charEnd+1; i++) { Cracker.numOfChar[i]////// this is where I am stuck. } } }

    Read the article

  • Data table columns become out of order after changing data source.

    - by Scott Chamberlain
    This is kind of a oddball problem so I will try to describe the best that I can. I have a DataGridView that shows a list of contracts and various pieces of information about them. There are three view modes: Contract Approval, Pre-Production, and Production. Each mode has it's own set of columns that need to be displayed. What I have been doing is I have three radio buttons one for each contract style. all of them fire their check changed on this function private void rbContracts_CheckedChanged(object sender, EventArgs e) { dgvContracts.Columns.Clear(); if (((RadioButton)sender).Checked == true) { if (sender == rbPreProduction) { dgvContracts.Columns.AddRange(searchSettings.GetPreProductionColumns()); this.contractsBindingSource.DataMember = "Preproduction"; this.preproductionTableAdapter.Fill(this.searchDialogDataSet.Preproduction); } else if (sender == rbProduction) { dgvContracts.Columns.AddRange(searchSettings.GetProductionColumns()); this.contractsBindingSource.DataMember = "Production"; this.productionTableAdapter.Fill(this.searchDialogDataSet.Production); } else if (sender == rbContracts) { dgvContracts.Columns.AddRange(searchSettings.GetContractsColumns()); this.contractsBindingSource.DataMember = "Contracts"; this.contractsTableAdapter.Fill(this.searchDialogDataSet.Contracts); } } } Here is the GetxxxColumns function public DataGridViewColumn[] GetPreProductionColumns() { this.dgvTxtPreAccount.Visible = DgvTxtPreAccountVisable; this.dgvTxtPreImpromedAccNum.Visible = DgvTxtPreImpromedAccNumVisable; this.dgvTxtPreCreateDate.Visible = DgvTxtPreCreateDateVisable; this.dgvTxtPreCurrentSoftware.Visible = DgvTxtPreCurrentSoftwareVisable; this.dgvTxtPreConversionRequired.Visible = DgvTxtPreConversionRequiredVisable; this.dgvTxtPreConversionLevel.Visible = DgvTxtPreConversionLevelVisable; this.dgvTxtPreProgrammer.Visible = DgvTxtPreProgrammerVisable; this.dgvCbxPreEdge.Visible = DgvCbxPreEdgeVisable; this.dgvCbxPreEducationRequired.Visible = DgvCbxPreEducationRequiredVisable; this.dgvTxtPreTargetMonth.Visible = DgvTxtPreTargetMonthVisable; this.dgvCbxPreEdgeDatesDate.Visible = DgvCbxPreEdgeDatesDateVisable; this.dgvTxtPreStartDate.Visible = DgvTxtPreStartDateVisable; this.dgvTxtPreUserName.Visible = DgvTxtPreUserNameVisable; this.dgvCbxPreProductionId.Visible = DgvCbxPreProductionIdVisable; return new System.Windows.Forms.DataGridViewColumn[] { this.dgvTxtPreAccount, this.dgvTxtPreImpromedAccNum, this.dgvTxtPreCreateDate, this.dgvTxtPreCurrentSoftware, this.dgvTxtPreConversionRequired, this.dgvTxtPreConversionLevel, this.dgvTxtPreProgrammer, this.dgvCbxPreEdge, this.dgvCbxPreEducationRequired, this.dgvTxtPreTargetMonth, this.dgvCbxPreEdgeDatesDate, this.dgvTxtPreStartDate, this.dgvTxtPreUserName, this.dgvCbxPreProductionId, this.dgvTxtCmnHold, this.dgvTxtCmnConcern, this.dgvTxtCmnAccuracyStatus, this.dgvTxtCmnEconomicStatus, this.dgvTxtCmnSoftwareStatus, this.dgvTxtCmnServiceStatus, this.dgvTxtCmnHardwareStatus, this.dgvTxtCmnAncillaryStatus, this.dgvTxtCmnFlowStatus, this.dgvTxtCmnImpromedAccountNum, this.dgvTxtCmnOpportunityId}; } public DataGridViewColumn[] GetProductionColumns() { this.dgvcTxtProAccount.Visible = DgvTxtProAccountVisable; this.dgvTxtProImpromedAccNum.Visible = DgvTxtProImpromedAccNumVisable; this.dgvTxtProCreateDate.Visible = DgvTxtProCreateDateVisable; this.dgvTxtProConvRequired.Visible = DgvTxtProConvRequiredVisable; this.dgvTxtProEdgeRequired.Visible = DgvTxtProEdgeRequiredVisable; this.dgvTxtProStartDate.Visible = DgvTxtProStartDateVisable; this.dgvTxtProHardwareRequired.Visible = DgvTxtProHardwareReqiredVisable; this.dgvTxtProStandardDate.Visible = DgvTxtProStandardDateVisable; this.dgvTxtProSystemScheduleDate.Visible = DgvTxtProSystemScheduleDateVisable; this.dgvTxtProHwSystemCompleteDate.Visible = DgvTxtProHwSystemCompleteDateVisable; this.dgvTxtProHardwareTechnician.Visible = DgvTxtProHardwareTechnicianVisable; return new System.Windows.Forms.DataGridViewColumn[] { this.dgvcTxtProAccount, this.dgvTxtProImpromedAccNum, this.dgvTxtProCreateDate, this.dgvTxtProConvRequired, this.dgvTxtProEdgeRequired, this.dgvTxtProStartDate, this.dgvTxtProHardwareRequired, this.dgvTxtProStandardDate, this.dgvTxtProSystemScheduleDate, this.dgvTxtProHwSystemCompleteDate, this.dgvTxtProHardwareTechnician, this.dgvTxtCmnHold, this.dgvTxtCmnConcern, this.dgvTxtCmnAccuracyStatus, this.dgvTxtCmnEconomicStatus, this.dgvTxtCmnSoftwareStatus, this.dgvTxtCmnServiceStatus, this.dgvTxtCmnHardwareStatus, this.dgvTxtCmnAncillaryStatus, this.dgvTxtCmnFlowStatus, this.dgvTxtCmnImpromedAccountNum, this.dgvTxtCmnOpportunityId}; } public DataGridViewColumn[] GetContractsColumns() { this.dgvTxtConAccount.Visible = this.DgvTxtConAccountVisable; this.dgvTxtConAccuracyStatus.Visible = this.DgvTxtConAccuracyStatusVisable; this.dgvTxtConCreateDate.Visible = this.DgvTxtConCreateDateVisable; this.dgvTxtConEconomicStatus.Visible = this.DgvTxtConEconomicStatusVisable; this.dgvTxtConHardwareStatus.Visible = this.DgvTxtConHardwareStatusVisable; this.dgvTxtConImpromedAccNum.Visible = this.DgvTxtConImpromedAccNumVisable; this.dgvTxtConServiceStatus.Visible = this.DgvTxtConServiceStatusVisable; this.dgvTxtConSoftwareStatus.Visible = this.DgvTxtConSoftwareStatusVisable; this.dgvCbxConPreProductionId.Visible = this.DgvCbxConPreProductionIdVisable; this.dgvCbxConProductionId.Visible = this.DgvCbxConProductionVisable; return new System.Windows.Forms.DataGridViewColumn[] { this.dgvTxtConAccount, this.dgvTxtConImpromedAccNum, this.dgvTxtConCreateDate, this.dgvTxtConAccuracyStatus, this.dgvTxtConEconomicStatus, this.dgvTxtConSoftwareStatus, this.dgvTxtConServiceStatus, this.dgvTxtConHardwareStatus, this.dgvCbxConPreProductionId, this.dgvCbxConProductionId, this.dgvTxtCmnHold, this.dgvTxtCmnConcern, this.dgvTxtCmnAccuracyStatus, this.dgvTxtCmnEconomicStatus, this.dgvTxtCmnSoftwareStatus, this.dgvTxtCmnServiceStatus, this.dgvTxtCmnHardwareStatus, this.dgvTxtCmnAncillaryStatus, this.dgvTxtCmnFlowStatus, this.dgvTxtCmnImpromedAccountNum, this.dgvTxtCmnOpportunityId}; } The issue is when I check a button the first time, everything shows up ok. I choose another view, everything is ok. But when I click on the first view the columns are out of order (it is like they are in reverse order but it is not exactly the same). this happens only to the first page you click on, the other two are fine. You can click off and click back on as many times as you want after those initial steps, The first list you selected at the start will be out of order the other two will be correct. Any ideas on what could be causing this?

    Read the article

  • Why isn't this file reading/writing program working?

    - by user320950
    This program is supposed to read files and write them. I took the file open checks out because they kept causing errors. The problem is that the files open like they are supposed to and the names are correct but nothing is on any of the text screens. Do you know what is wrong? #include<iostream> #include<fstream> #include<cstdlib> #include<iomanip> using namespace std; int main() { ifstream in_stream; // reads itemlist.txt ofstream out_stream1; // writes in items.txt ifstream in_stream2; // reads pricelist.txt ofstream out_stream3;// writes in plist.txt ifstream in_stream4;// read recipt.txt ofstream out_stream5;// write display.txt float price=' ',curr_total=0.0; int wrong=0; int itemnum=' '; char next; in_stream.open("ITEMLIST.txt", ios::in); // list of avaliable items out_stream1.open("listWititems.txt", ios::out); // list of avaliable items in_stream2.open("PRICELIST.txt", ios::in); out_stream3.open("listWitdollars.txt", ios::out); in_stream4.open("display.txt", ios::in); out_stream5.open("showitems.txt", ios::out); in_stream.close(); // closing files. out_stream1.close(); in_stream2.close(); out_stream3.close(); in_stream4.close(); out_stream5.close(); system("pause"); in_stream.setf(ios::fixed); while(in_stream.eof()) { in_stream >> itemnum; cin.clear(); cin >> next; } out_stream1.setf(ios::fixed); while (out_stream1.eof()) { out_stream1 << itemnum; cin.clear(); cin >> next; } in_stream2.setf(ios::fixed); in_stream2.setf(ios::showpoint); in_stream2.precision(2); while((price== (price*1.00)) && (itemnum == (itemnum*1))) { while (in_stream2 >> itemnum >> price) // gets itemnum and price { while (in_stream2.eof()) // reads file to end of file { in_stream2 >> itemnum; in_stream2 >> price; price++; curr_total= price++; in_stream2 >> curr_total; cin.clear(); // allows more reading cin >> next; } } } out_stream3.setf(ios::fixed); out_stream3.setf(ios::showpoint); out_stream3.precision(2); while((price== (price*1.00)) && (itemnum == (itemnum*1))) { while (out_stream3 << itemnum << price) { while (out_stream3.eof()) // reads file to end of file { out_stream3 << itemnum; out_stream3 << price; price++; curr_total= price++; out_stream3 << curr_total; cin.clear(); // allows more reading cin >> next; } return itemnum, price; } } in_stream4.setf(ios::fixed); in_stream4.setf(ios::showpoint); in_stream4.precision(2); while ( in_stream4.eof()) { in_stream4 >> itemnum >> price >> curr_total; cin.clear(); cin >> next; } out_stream5.setf(ios::fixed); out_stream5.setf(ios::showpoint); out_stream5.precision(2); out_stream5 <<setw(5)<< " itemnum " <<setw(5)<<" price "<<setw(5)<<" curr_total " <<endl; // sends items and prices to receipt.txt out_stream5 << setw(5) << itemnum << setw(5) <<price << setw(5)<< curr_total; // sends items and prices to receipt.txt out_stream5 << " You have a total of " << wrong++ << " errors " << endl; }

    Read the article

  • ASp.Net Mvc 1.0 Dynamic Images Returned from Controller taking 154 seconds+ to display in IE8, firef

    - by julian guppy
    I have a curious problem with IE, IIS 6.0 dynamic PNG files and I am baffled as to how to fix.. Snippet from Helper (this returns the URL to the view for requesting the images from my Controller. string url = LinkBuilder.BuildUrlFromExpression(helper.ViewContext.RequestContext, helper.RouteCollection, c = c.FixHeight(ir.Filename, ir.AltText, "FFFFFF")); url = url.Replace("&", "&"); sb.Append(string.Format("<removed id=\"TheImage\" src=\"{0}\" alt=\"\" /", url)+Environment.NewLine); This produces a piece of html as follows:- img id="TheImage" src="/ImgText/FixHeight?sFile=Images%2FUser%2FJulianGuppy%2FMediums%2Fconservatory.jpg&backgroundColour=FFFFFF" alt="" / brackets missing because i cant post an image... even though I dont want to post an image I jsut want to post the markup... sigh Snippet from Controller ImgTextController /// <summary> /// This function fixes the height of the image /// </summary> /// <param name="sFile"></param> /// <param name="alternateText"></param> /// <param name="backgroundColour"></param> /// <returns></returns> [AcceptVerbs(HttpVerbs.Get)] public ActionResult FixHeight(string sFile, string alternateText, string backgroundColour) { #region File if (string.IsNullOrEmpty(sFile)) { return new ImgTextResult(); } // MVC specific change to prepend the new directory if (sFile.IndexOf("Content") == -1) { sFile = "~/Content/" + sFile; } // open the file System.Drawing.Image img; try { img = System.Drawing.Image.FromFile(Server.MapPath(sFile)); } catch { img = null; } // did we fail? if (img == null) { return new ImgTextResult(); } #endregion File #region Width // Sort out the width from the image passed to me Int32 nWidth = img.Width; #endregion Width #region Height Int32 nHeight = img.Height; #endregion Height // What is the ideal height given a width of 2100 this should be 1400. var nIdealHeight = (int)(nWidth / 1.40920096852); // So is the actual height of the image already greater than the ideal height? Int32 nSplit; if (nIdealHeight < nHeight) { // Yes, do nothing, well i need to return the iamge... nSplit = 0; } else { // rob wants to not show the white at the top or bottom, so if we were to crop the image how would be do it // 1. Calculate what the width should be If we dont adjust the heigt var newIdealWidth = (int)(nHeight * 1.40920096852); // 2. This newIdealWidth should be smaller than the existing width... so work out the split on that Int32 newSplit = (nWidth - newIdealWidth) / 2; // 3. Now recrop the image using 0-nHeight as the height (i.e. full height) // but crop the sides so that its the correct aspect ration var newRect = new Rectangle(newSplit, 0, newIdealWidth, nHeight); img = CropImage(img, newRect); nHeight = img.Height; nWidth = img.Width; nSplit = 0; } // No, so I want to place this image on a larger canvas and we do this by Creating a new image to be the size that we want System.Drawing.Image canvas = new Bitmap(nWidth, nIdealHeight, PixelFormat.Format24bppRgb); Graphics g = Graphics.FromImage(canvas); #region Color // Whilst we can set the background colour we shall default to white if (string.IsNullOrEmpty(backgroundColour)) { backgroundColour = "FFFFFF"; } Color bc = ColorTranslator.FromHtml("#" + backgroundColour); #endregion Color // Filling the background (which gives us our broder) Brush backgroundBrush = new SolidBrush(bc); g.FillRectangle(backgroundBrush, -1, -1, nWidth + 1, nIdealHeight + 1); // draw the image at the position var rect = new Rectangle(0, nSplit, nWidth, nHeight); g.DrawImage(img, rect); return new ImgTextResult { Image = canvas, ImageFormat = ImageFormat.Png }; } My ImgTextResult is a class that returns an Action result for me but embedding the image from a memory stream into the response.outputstream. snippet from my ImageResults /// <summary> /// Execute the result /// </summary> /// <param name="context"></param> public override void ExecuteResult(ControllerContext context) { // output context.HttpContext.Response.Clear(); context.HttpContext.Response.ContentType = "image/png"; try { var memStream = new MemoryStream(); Image.Save(memStream, ImageFormat.Png); context.HttpContext.Response.BinaryWrite(memStream.ToArray()); context.HttpContext.Response.Flush(); context.HttpContext.Response.Close(); memStream.Dispose(); Image.Dispose(); } catch (Exception ex) { string a = ex.Message; } } Now all of this works locally and lovely, and indeed all of this works on my production server BUT Only for Firefox, Safari, Chrome (and other browsers) IE has a fit and decides that it either wont display the image or it does display the image after approx 154seconds of waiting..... I have made sure my HTML is XHTML compliant, I have made sure I am getting no Routing errors or crashes in my event log on the server.... Now obviously I have been a muppet and have done something wrong... but what I cant fathom is why in development all works fine, and in production all non IE browsers also work fine, but IE 8 using IIS 6.0 production server is having some kind of problem in returning this PNG and I dont have an error to trace... so what I am looking for is guidance as to how I can debug this problem.

    Read the article

  • Asks for Account Type twice

    - by André Fecteau
    Been working on this program for a while now. (had some problems and asked a few times here.) Ran into another one though! The program asks for my account type twice. Can not figure out why or how to fix it. Any help is appreciated, thanks! /* project3.cpp Andre Fecteau CSC135-101 October 29, 2013 This program prints a bank's service fees per month depending on account type */ #include <iostream> using namespace std; /* Basic Function for Copy Paste <function type> <function name> (){ // Declarations // Initalizations // Input // Process // Output // Prolouge } */ void displayInstructions (){ // Declarations // Initalizations // Input // Process // Output cout <<"| -------------------------------------------------------------- |" << endl; cout <<"| ---------- Welcome to the bank fee calculator ---------------- |" << endl; cout <<"| -------------------------------------------------------------- |" << endl; cout <<"| This Program wil ask you to eneter your account number. |" << endl; cout <<"| Then it will ask for your account type Personal or Commercial. |" << endl; cout <<"| Then ask for the amount of checks you have written. |" << endl; cout <<"| Lastly it will output how much your fees are for this month. |" << endl; cout <<"| -------------------------------------------------------------- |" << endl; cout << endl; // Prolouge } int readAccNumb(){ // delarations int accNumber; // intitalizations accNumber = 0.0; // input cout << "Please Enter Account Number:"; cin >> accNumber; // Procesas // output // prolouge return accNumber; } int checksWritten (){ // Declarations int written; // Initalizations written = 0.0; // Input cout <<"Please input the amount of checks you have written this month:"; cin >> written; // Output // Prolouge return written; } char accType (){ // Declarations char answer; int numberBySwitch; // Initalizations numberBySwitch = 1; // Input while (numberBySwitch == 1){ cout << "Please Enter the acount type (C for Comerical and P for Personal):"; cin >> answer; // Process switch (answer){ case 'p': answer = 'P'; numberBySwitch += 2;break; case 'P': numberBySwitch += 2;break; case 'c': answer = 'C'; numberBySwitch += 3;break; case 'C': numberBySwitch += 3;break; default: if(numberBySwitch == 1) { cout << "Error! Please enter a correct type!" <<endl; } } } // Output // Prolouge return answer; } int commericalCalc(int checksWritten){ // Declarations int written; int checkPrice; // Initalizations checkPrice = 0.0; // Input // Process if(written < 20){ checkPrice = 0.10; } // Output // Prolouge return checkPrice; } int personalCalc(int checksWritten){ } double pricePerCheck(char accType, int checksWritten){ // Declarations double price; char answer; // Initalizations price = 0.0; // Input // Process if(accType == 'P'){ } if(accType == 'C'){ if(checksWritten < 20){ price = 0.10; } } // Output // Prolouge return price; } int main(){ // Declarations int accountNumb; char theirAccType; int writtenChecks; double split; // Initalizations accountNumb = 0.0; writtenChecks = 0.0; split = 0.0; theirAccType = ' '; // Input displayInstructions(); theirAccType = accType(); accountNumb = readAccNumb(); split = pricePerCheck(accType(), checksWritten()); // Output cout << endl; cout << "Account Type: " << theirAccType << endl; cout << "Check Price: " << split << endl; // Prolouge return 0; }

    Read the article

  • Unable to Calculate Position within Owner-Draw Text

    - by Jonathan Wood
    I'm trying to use Visual Studio 2012 to create a Windows Forms application that can place the caret at the current position within a owner-drawn string. However, I've been unable to find a way to accurately calculate that position. I've done this successfully before in C++. I've now tried numerous methods in C#. Originally, I tried using .NET classes to determine the correct position, but then I tried accessing the Windows API directly. In some cases, I came close, but after some time I still cannot place the caret accurately. I've created a small test program and posted key parts below. I've also posted the entire project here. The exact font used is not important to me; however, my application assumes a mono-spaced font. Any help is appreciated. Form1.cs This is my main form. public partial class Form1 : Form { private string TestString; private int AveCharWidth; private int Position; public Form1() { InitializeComponent(); TestString = "123456789012345678901234567890123456789012345678901234567890"; AveCharWidth = GetFontWidth(); Position = 0; } private void Form1_Load(object sender, EventArgs e) { Font = new Font(FontFamily.GenericMonospace, 12, FontStyle.Regular, GraphicsUnit.Pixel); } protected override void OnGotFocus(EventArgs e) { Windows.CreateCaret(Handle, (IntPtr)0, 2, (int)Font.Height); Windows.ShowCaret(Handle); UpdateCaretPosition(); base.OnGotFocus(e); } protected void UpdateCaretPosition() { Windows.SetCaretPos(Padding.Left + (Position * AveCharWidth), Padding.Top); } protected override void OnLostFocus(EventArgs e) { Windows.HideCaret(Handle); Windows.DestroyCaret(); base.OnLostFocus(e); } protected override void OnPaint(PaintEventArgs e) { e.Graphics.DrawString(TestString, Font, SystemBrushes.WindowText, new PointF(Padding.Left, Padding.Top)); } protected override bool IsInputKey(Keys keyData) { switch (keyData) { case Keys.Right: case Keys.Left: return true; } return base.IsInputKey(keyData); } protected override void OnKeyDown(KeyEventArgs e) { switch (e.KeyCode) { case Keys.Left: Position = Math.Max(Position - 1, 0); UpdateCaretPosition(); break; case Keys.Right: Position = Math.Min(Position + 1, TestString.Length); UpdateCaretPosition(); break; } base.OnKeyDown(e); } protected int GetFontWidth() { int AverageCharWidth = 0; using (var graphics = this.CreateGraphics()) { try { Windows.TEXTMETRIC tm; var hdc = graphics.GetHdc(); IntPtr hFont = this.Font.ToHfont(); IntPtr hOldFont = Windows.SelectObject(hdc, hFont); var a = Windows.GetTextMetrics(hdc, out tm); var b = Windows.SelectObject(hdc, hOldFont); var c = Windows.DeleteObject(hFont); AverageCharWidth = tm.tmAveCharWidth; } catch { } finally { graphics.ReleaseHdc(); } } return AverageCharWidth; } } Windows.cs Here are my Windows API declarations. public static class Windows { [Serializable, StructLayout(LayoutKind.Sequential, CharSet = CharSet.Auto)] public struct TEXTMETRIC { public int tmHeight; public int tmAscent; public int tmDescent; public int tmInternalLeading; public int tmExternalLeading; public int tmAveCharWidth; public int tmMaxCharWidth; public int tmWeight; public int tmOverhang; public int tmDigitizedAspectX; public int tmDigitizedAspectY; public short tmFirstChar; public short tmLastChar; public short tmDefaultChar; public short tmBreakChar; public byte tmItalic; public byte tmUnderlined; public byte tmStruckOut; public byte tmPitchAndFamily; public byte tmCharSet; } [DllImport("user32.dll")] public static extern bool CreateCaret(IntPtr hWnd, IntPtr hBitmap, int nWidth, int nHeight); [DllImport("User32.dll")] public static extern bool SetCaretPos(int x, int y); [DllImport("User32.dll")] public static extern bool DestroyCaret(); [DllImport("User32.dll")] public static extern bool ShowCaret(IntPtr hWnd); [DllImport("User32.dll")] public static extern bool HideCaret(IntPtr hWnd); [DllImport("gdi32.dll", CharSet = CharSet.Auto)] public static extern bool GetTextMetrics(IntPtr hdc, out TEXTMETRIC lptm); [DllImport("gdi32.dll")] public static extern IntPtr SelectObject(IntPtr hdc, IntPtr hgdiobj); [DllImport("GDI32.dll")] public static extern bool DeleteObject(IntPtr hObject); }

    Read the article

  • Core Data: Fetch all entities in a to-many-relationship of a particular object?

    - by Björn Marschollek
    Hi there, in my iPhone application I am using simple Core Data Model with two entities (Item and Property): Item name properties Property name value item Item has one attribute (name) and one one-to-many-relationship (properties). Its inverse relationship is item. Property has two attributes the according inverse relationship. Now I want to show my data in table views on two levels. The first one lists all items; when one row is selected, a new UITableViewController is pushed onto my UINavigationController's stack. The new UITableView is supposed to show all properties (i.e. their names) of the selected item. To achieve this, I use a NSFetchedResultsController stored in an instance variable. On the first level, everything works fine when setting up the NSFetchedResultsController like this: -(NSFetchedResultsController *) fetchedResultsController { if (fetchedResultsController) return fetchedResultsController; // goal: tell the FRC to fetch all item objects. NSFetchRequest *fetch = [[NSFetchRequest alloc] init]; NSEntityDescription *entity = [NSEntityDescription entityForName:@"Item" inManagedObjectContext:self.moContext]; [fetch setEntity:entity]; NSSortDescriptor *sort = [[NSSortDescriptor alloc] initWithKey:@"name" ascending:YES]; [fetch setSortDescriptors:[NSArray arrayWithObject:sort]]; [fetch setFetchBatchSize:10]; NSFetchedResultsController *frController = [[NSFetchedResultsController alloc] initWithFetchRequest:fetch managedObjectContext:self.moContext sectionNameKeyPath:nil cacheName:@"cache"]; self.fetchedResultsController = frController; fetchedResultsController.delegate = self; [sort release]; [frController release]; [fetch release]; return fetchedResultsController; } However, on the second-level UITableView, I seem to do something wrong. I implemented the fetchedresultsController in a similar way: -(NSFetchedResultsController *) fetchedResultsController { if (fetchedResultsController) return fetchedResultsController; // goal: tell the FRC to fetch all property objects that belong to the previously selected item NSFetchRequest *fetch = [[NSFetchRequest alloc] init]; // fetch all Property entities. NSEntityDescription *entity = [NSEntityDescription entityForName:@"Property" inManagedObjectContext:self.moContext]; [fetch setEntity:entity]; // limit to those entities that belong to the particular item NSPredicate *predicate = [NSPredicate predicateWithFormat:[NSString stringWithFormat:@"item.name like '%@'",self.item.name]]; [fetch setPredicate:predicate]; // sort it. Boring. NSSortDescriptor *sort = [[NSSortDescriptor alloc] initWithKey:@"name" ascending:YES]; [fetch setSortDescriptors:[NSArray arrayWithObject:sort]]; NSError *error = nil; NSLog(@"%d entities found.",[self.moContext countForFetchRequest:fetch error:&error]); // logs "3 entities found."; I added those properties before. See below for my saving "problem". if (error) NSLog("%@",error); // no error, thus nothing logged. [fetch setFetchBatchSize:20]; NSFetchedResultsController *frController = [[NSFetchedResultsController alloc] initWithFetchRequest:fetch managedObjectContext:self.moContext sectionNameKeyPath:nil cacheName:@"cache"]; self.fetchedResultsController = frController; fetchedResultsController.delegate = self; [sort release]; [frController release]; [fetch release]; return fetchedResultsController; } Now it's getting weird. The above NSLog statement returns me the correct number of properties for the selected item. However, the UITableViewDelegate method tells me that there are no properties: -(NSInteger) tableView:(UITableView *)table numberOfRowsInSection:(NSInteger)section { id <NSFetchedResultsSectionInfo> sectionInfo = [[self.fetchedResultsController sections] objectAtIndex:section]; NSLog(@"Found %d properties for item \"%@\". Should have found %d.",[sectionInfo numberOfObjects], self.item.name, [self.item.properties count]); // logs "Found 0 properties for item "item". Should have found 3." return [sectionInfo numberOfObjects]; } The same implementation works fine on the first level. It's getting even weirder. I implemented some kind of UI to add properties. I create a new Property instance via Property *p = [NSEntityDescription insertNewObjectForEntityForName:@"Property" inManagedObjectContext:self.moContext];, set up the relationships and call [self.moContext save:&error]. This seems to work, as error is still nil and the object gets saved (I can see the number of properties when logging the Item instance, see above). However, the delegate methods are not fired. This seems to me due to the possibly messed up fetchRequest(Controller). Any ideas? Did I mess up the second fetch request? Is this the right way to fetch all entities in a to-many-relationship for a particular instance at all?

    Read the article

  • Tooltips problem, making this javascript work with my smarty foreach loop, help pelase!

    - by Kyle Sevenoaks
    I am using an example of tooltips from http://www.dynamicdrive.com/dynamicindex5/stickytooltip.htm on www.euroworker.no/order I have this code here to work with, but it just doesn't seem to work correctly, I've tried everything I can think of (not a lot of things) Here's the code. {foreach from=$cart.cartItems item="item" name="cart"} <div class="{zebra loop="cart"}"> <div id="sgproductview"> <div id="cart2Varekode"> <p> {if $product.sku} <span class="param">{$item.product.sku}</span> {else} <span>{img src=$item.Product.DefaultImage.paths.1 alt=$item.Product.name_lang|escape}</span> {/if} </p> </div> <div id="cart2Produkt"> <p>{if $item.Product.ID} <a href="{productUrl product=$item.Product}" data-tooltip="sticky{$smarty.foreach.cart.iteration}" target="_blank">{$item.Product.name_lang|truncate:20}</a> {else} <span>{$item.Product.name_lang|truncate:20}</span> </a> {/if} </p> <p> {include file="order/itemVariations.tpl"} {include file="order/block/itemOptions.tpl"} {if $multi} {include file="order/selectItemAddress.tpl" item=$item} {/if} </p> </div> {if $item.Product.DefaultImage.paths.3} <div id="mystickytooltip" class="stickytooltip"> <div style="padding:5px;"> <div id="sticky1" class="atip" style="width:200px;"> <img src="{$item.Product.DefaultImage.paths.3}" alt="{$item.Product.name_lang|escape}"><br> {$item.Product.name_lang} </div> <div id="sticky2" class="atip" style="width:200px;"> <img src={$item.Product.DefaultImage.paths.3} alt="{$item.Product.name_lang|escape}"><br> {$item.formattedPrice} </div> <div id="sticky3" class="atip" style="width:200px;"> <img src="{$item.Product.DefaultImage.paths.3}" alt="{$item.Product.name_lang|escape}"><br> {$item.Product.name_lang}PRODUCT 3 </div> <div id="sticky4" class="atip" style="width:200px;"> <img src="{$item.Product.DefaultImage.paths.3}" alt="{$item.Product.name_lang|escape}"><br> {$item.Product.name_lang} </div> </div> </div> {/if} <div id="cart2Price"> <p class="actualPrice"> {$item.formattedPrice} </p> </div> <div id="salg"></div> <div id="cart2Salg"> <p></p> </div> <div id="antallbox"> <p class="cartQuant"> {textfield name="item_`$item.ID`" class="text"} </p> </div> <div id="cart2Total"> <p> {if $item.count == 1} <span class="basePrice">{$item.formattedBasePrice}</span><span class="actualPrice">{$item.formattedPrice}</span> {else} {$item.formattedDisplaySubTotal} <div class="subTotalCalc"> {$item.count} x <span class="basePrice">{$item.formattedBasePrice}</span><span class="actualPrice">{$item.formattedPrice}</span> </div> {/if} </p> </div> <div id="delete"> {if 'ENABLE_WISHLISTS'|config} <a href="{link controller=order action=moveToWishList id=$item.ID query="return=`$return`"}">{t _move_to_wishlist}</a> {/if} <a id="slett" href="{link controller=order action=delete id=$item.ID query="return=`$return`"}" title="Slett"><!--{t _remove}--></a> </div> </div> </div> {/foreach} Anyone can help? {html_image} doesn't work, by the way and all the extensions are present and correct.

    Read the article

  • Find inner arrays in nested arrays

    - by 50ndr33
    I have a nested array in PHP: array ( '0' => "+5x", '1' => array ( '0' => "+", '1' => "(", '2' => "+3", '3' => array ( '0' => "+", '1' => "(", '2' => array ( // I want to find this one. '0' => "+", '1' => "(", '2' => "+5", '3' => "-3", '4' => ")" ), '3' => "-3", '4' => ")" ), '4' => ")" ) ); I need to process the innermost arrays here, the one with the comment: "I want to find this one." Is there a function for that? I have thought about doing (written as an idea, not as correct PHP): foreach ($array as $id => $value) { if ($value is array) { $name = $id; foreach ($array[$id] as $id_2 => $value_2) { if ($value_2 is array) { $name .= "." . $id_2; foreach ($array[$id][$id_2] as $id_3 => $value_3) { if ($value_3 is array) { $name .= "." . $id_3; foreach ($array[$id][$id_2][$id_3] as $id_4 => $value_4) { if ($value_4 is array) { $name .= "." . $id_4; foreach [and so it goes on]; } else { $listOfInnerArrays[] = $name; break; } } } else { $listOfInnerArrays[] = $name; break; } } } else { $listOfInnerArrays[] = $name; break; } } } } So what it does is it makes $name the current key in the array. If the value is an array, it goes into it with foreach and adds "." and the id of the array. So we would in the example array end up with: array ( '0' => "1.3.2", ) Then I can process those values to access the innner arrays. The problem is that the array that I'm trying to find the inner arrays of is dynamic and made of a user input. (It splits an input string where it finds + or -, and puts it in a separate nested array if it contains brackets. So if the user types a lot of brackets, there will be a lot of nested arrays.) Therefore I need to make this pattern go for 20 times down, and still it will only catch 20 nested arrays no matter what. Is there a function for that, again? Or is there a way to make it do this without my long code? Maybe make a loop make the necessary number of the foreach pattern and run it through eval()? Long answer to J. Bruni: <?php $liste = array ( '0' => "+5x", '1' => array ( '0' => "+", '1' => "(", '2' => "+3", '3' => array ( '0' => "+", '1' => "(", '2' => array ( '0' => "+", '1' => "(", '2' => "+5", '3' => "-3", '4' => ")" ), '3' => "-3", '4' => ")" ), '4' => ")" ) ); function find_deepest( $item, $key ) { echo "0"; if ( !is_array( $item ) ) return false; foreach( $item as $sub_item ) { if ( is_array( $sub_item ) ) return false; } echo "1"; print_r( $item ); return true; } array_walk_recursive( $liste, 'find_deepest' ); echo "<pre>"; print_r($liste); ?> I wrote echo 0 and 1 to see what the script did, and here is the output: 00000000000000 Array ( [0] => +5x [1] => Array ( [0] => + [1] => ( [2] => +3 [3] => Array ( [0] => + [1] => ( [2] => Array ( [0] => + [1] => ( [2] => +5 [3] => -3 [4] => ) ) [3] => -3 [4] => ) ) [4] => ) ) )

    Read the article

  • why i am getting popup message when I am tryiing to update user.

    - by kumar
    I am getting Popup mesage something like You have chosen to open Update which is a:application/json From : http://localhost:1234 which ok cancel buttons.. I am using this code to run.. [HttpPost] public JsonResult MEdit(ExpenseBE e) { var cache = CacheFactory.GetCacheManager(); string F_ACTION = "U"; string F_DEBUG = "Y"; var excUpdateStatus = false; for (int i = 0; i <= cache.Count; i++) { var x = (ExpenseBE)cache.GetData("a" + i); if (x != null) { string Resolutioncode = e.Exception.ResolutionCode; string reasoncode = e.Exception.ReasonCode; string actioncode = e.Exception.ActionCode; e.Exception.ExceptionID = x.Exception.ExceptionID; e.Exception.ReasonCode = reasoncode; e.Exception.ReasonCode = Resolutioncode; e.Exception.ActionCode = actioncode; e.Exception.Sequence = x.Exception.Sequence; e.Exception.FollowupDate = x.Exception.FollowupDate; e.Exception.IOL = x.Exception.IOL; e.Exception.LastUpdateUser = User.Identity.Name.ToUpper().Remove(0, 4); excUpdateStatus = common.UpdateException(e.Exception, F_ACTION, F_DEBUG); } } return Json(excUpdateStatus.ToString()); } and my view is <%@ Control Language="C#" Inherits="System.Web.Mvc.ViewUserControl<NorthernTrust.ATP.iTool.Core.Business.Entities.Specialist.ExpenseBE>" %> <% using (Html.BeginForm("MEdit", "expense", FormMethod.Post)) { %> <%= Html.ValidationSummary(true)%> <fieldset class="clearfix" id="fieldset-exception"> <legend>Mass Edit Exception Information</legend> <div class="fiveper"> <label for="ExceptionStatus"> Status: <span> </span> </label> <label for="ResolutionCode"> Resolution: <span> <%=Html.DropDownListFor(model=>model.Exception.ResolutionCode,new SelectList(Model.LookupCodes["C_EXCPT_RESL"], "Key", "Value"))%> </span> </label> <label for="ReasonCode"> Reason: <span><%=Html.DropDownListFor(model => model.Exception.ReasonCode, new SelectList(Model.LookupCodes["C_EXCPT_RSN"], "Key", "Value"))%></span> </label> <label for="ExceptionStatus"> Action Taken: <span><%=Html.DropDownListFor(model => model.Exception.ActionCode, new SelectList(Model.LookupCodes["C_EXCPT_ACT"], "Key", "Value"))%></span> </label> </div> <div class="fiveper"> <label for="FollowupDate"> Follow-up: <span><input type="text" id="exc-flwup-" /></span> <%--<%=Html.EditorFor(model=>model.Exception.FollowupDate) %>--%> </label> <label for="IOL"> Inquiry #: <%=Html.TextBox("Inquiery", ViewData["inq"] ?? "")%> </label> <label>Comment</label> <span> <%=Html.TextArea("value") %> <%=Html.ValidationMessage("value")%> </span> </div> <br /> <br /> <div> <button id="btnSelect" class="button">Select All</button> <button id="btnCancel" class="button">Cancel</button> <input type="submit" class="button" value="Save" /> </div> </fieldset> <% } %> <script type="text/javascript"> $(document).ready(function() { $('#btnSelectAll').click(function() { function validate_excpt(formData, jqForm, options) { var form = jqForm[0]; } $('#btnSelect').click(function() { $('#input [type=checkbox]').attr('checked', 'checked'); }); // post-submit callback function showResponse(responseText, statusText, xhr, $form) { if ('success' == statusText) { $('#error-msg span:last').html('<strong>Update successful.</strong>'); } else { $('#error-msg span:last').html('<strong>Update failed.</strong> ' + responseText); } $('#error-msg').removeClass('hide'); } $('#exc').ajaxForm({ target: '#error-msg', beforeSubmit: validate_excpt, success: showResponse, dataType: 'json' }); $('.button').button(); }); $('.button').button(); $("input[id^='exc-flwup-']").datepicker({ duration: '', showTime: true, constrainInput: true, stepMinutes: 30, stepHours: 1, altTimeField: '', time24h: true, minDate: 0 }); $('#ui-timepicker-div').bgiframe(); }); </script> please correct me if i am doing somwhere wrong? thanks

    Read the article

< Previous Page | 692 693 694 695 696 697 698 699 700 701 702 703  | Next Page >