Search Results

Search found 299 results on 12 pages for 'arjun singh'.

Page 7/12 | < Previous Page | 3 4 5 6 7 8 9 10 11 12  | Next Page >

  • Use Of Android NDK

    - by Shalini Singh
    Hi!!!! i am new for NDK. i want to know what is the benefit of native code in android . By this can we improve our application performance. and main thing exactly when we will use this native code. please clear it. and from where i can get more information............

    Read the article

  • php switch statement error on int = 0

    - by Jagdeep Singh
    I am having a problem in php switch case. When i set $number=0 it should run very first case but here this code returns 10-20K that is in second case. I checked comparison operators, tested them in if else case they return correct values but here first case do not run on $number=0 Why is this happening ? php consider 0 as false or something wrong in code ? Link to codepad paste http://codepad.org/2glDh39K also here is the code <?php $number = 0; switch ($number) { case ($number <= 10000): echo "0-10K"; break; case ($number > 10000 && $number <= 20000): echo "10-20K"; break; case ($number > 20000 && $number <= 30000): echo "20-30K"; break; case ($number > 30000 && $number <= 40000): echo "30-40K"; break; case ($number > 40000 && $number <= 50000): echo "40-50K"; break; case ($number > 50000 && $number <= 60000): echo "50-60K"; break; case ($number > 60000 && $number <= 70000): echo "60-70K"; break; case ($number > 70000 && $number <= 80000): echo "70-80K"; break; case ($number > 80000 && $number <= 90000): echo "80-90K"; break; case ($number > 90000): echo "90K+"; break; default: //default echo "N/A"; break; } ?>

    Read the article

  • How can a user view profile info of other users?

    - by Arvind Singh
    I have stored profile info using this code ProfileBase userprofile = HttpContext.Current.Profile; userprofile.SetPropertyValue("FirstName", TextBoxFirstName.Text); userprofile.SetPropertyValue("LastName", TextBoxLastName.Text); userprofile.SetPropertyValue("AboutMe", TextBoxAboutMe.Text); userprofile.SetPropertyValue("ContactNo", TextBoxContactNo.Text); and in web.config <profile enabled="true" defaultProvider="AspNetSqlProfileProvider"> <properties> <add name="FirstName" type="String" /> <add name="LastName" type="String" /> <add name="AboutMe" type="String" /> <add name="ContactNo" type="String" /> </properties> </profile> The profile info is stored and every user is able to view his own profile info using something like this TextBoxFirstName.Text = HttpContext.Current.Profile.GetPropertyValue("FirstName").ToString(); How to fetch profile info of other user say a user types the username of other user in a text box and clicks a button?

    Read the article

  • Sorting manually generated index using perl script

    - by Pradeep Singh
    \item Bernoulli measure, 14 \item cellular automata \subitem Soft, 3, 28 \subitem balance theorem, 23, 45 \item tiles \subitem tiling problem, 19, 58 \subitem aperiodic tile set, 18, 45 \item Garden-of-Eden -theorem, 12 \item Bernoulli measure, 15, 16, 35 \item cellular automata \subitem balance theorem, 9, 11, 14 \subitem blocking word, 22, 32 \item Garden-of-Eden -theorem, 32 I have to sort the above index alphabetically using a perl script. Duplicate item or subitem entries should be merged and their numbers should be sorted. The subitems also should be sorted under respective item and their numbers should be also sorted. If same item is repeated in more than one place with subitems all the subitems should be merged under a single item and also subitems should be sorted

    Read the article

  • How can we call an activity through service in android???

    - by Shalini Singh
    Hi! friends, i am a android developer,,, want to know is it possible to call an activity through background service in android like : import android.app.Service; import android.content.Intent; import android.content.SharedPreferences; import android.media.MediaPlayer; import android.os.Handler; import android.os.IBinder; import android.os.Message; public class background extends Service{ private int timer1; @Override public void onCreate() { // TODO Auto-generated method stub super.onCreate(); SharedPreferences preferences = getSharedPreferences("SaveTime", MODE_PRIVATE); timer1 = preferences.getInt("time", 0); startservice(); } @Override public IBinder onBind(Intent arg0) { // TODO Auto-generated method stub return null; } private void startservice() { Handler handler = new Handler(); handler.postDelayed(new Runnable(){ public void run() { mediaPlayerPlay.sendEmptyMessage(0); } }, timer1*60*1000); } private Handler mediaPlayerPlay = new Handler(){ @Override public void handleMessage(Message msg) { try { getApplication(); MediaPlayer mp = new MediaPlayer(); mp = MediaPlayer.create(background.this, R.raw.alarm); mp.start(); } catch(Exception e) { e.printStackTrace(); } super.handleMessage(msg); } }; /* * (non-Javadoc) * * @see android.app.Service#onDestroy() */ @Override public void onDestroy() { // TODO Auto-generated method stub super.onDestroy(); } } i want to call my activity......

    Read the article

  • Super class variables not printing through sub class

    - by Abhishek Singh
    Can u tell me why this code is not displaying any result on the console. class employee { protected String name; protected double salary; protected String dob; public employee(String name, double salary, String dob) { this.name = name; this.salary = salary; this.dob = dob; } public employee(String name, double salary) { this.name = name; this.salary = salary; } } public class Manage extends employee { String dept1; public Manage(String name, double salary, String dob, String dept1) { super(name, salary, dob); this.dept1 = dept1; } public Manage(String name, double salary, String dept1) { super(name, salary); this.dept1 = dept1; } public static void main(String args[]) { employee e = new employee("Vikas", 122345); employee e2 = new employee("Vikas", 122345, "12-2-1991"); Manage m = (Manage) new Manage("Vikas", 122345, "Sales"); Manage m2 = new Manage("Vikas", 122345, "12-2-1991", "sales"); m.display(); m2.display(); } public void display() { System.out.println("Name " + name); System.out.println("Salary " + salary); System.out.println("Birth " + dob); System.out.println("Department " + dept1); } }

    Read the article

  • conditional update records mysql query

    - by Shakti Singh
    Hi, Is there any single msql query which can update customer DOB? I want to update the DOB of those customers which have DOB greater than current date. example:- if a customer have dob 2034 update it to 1934 , if have 2068 updated with 1968. There was a bug in my system if you enter date less than 1970 it was storing it as 2070. The bug is solved now but what about the customers which have wrong DOB. So I have to update their DOB. All customers are stored in customer_entity table and the entity_id is the customer_id Details is as follows:- desc customer_entity -> ; +------------------+----------------------+------+-----+---------------------+----------------+ | Field | Type | Null | Key | Default | Extra | +------------------+----------------------+------+-----+---------------------+----------------+ | entity_id | int(10) unsigned | NO | PRI | NULL | auto_increment | | entity_type_id | smallint(8) unsigned | NO | MUL | 0 | | | attribute_set_id | smallint(5) unsigned | NO | | 0 | | | website_id | smallint(5) unsigned | YES | MUL | NULL | | | email | varchar(255) | NO | MUL | | | | group_id | smallint(3) unsigned | NO | | 0 | | | increment_id | varchar(50) | NO | | | | | store_id | smallint(5) unsigned | YES | MUL | 0 | | | created_at | datetime | NO | | 0000-00-00 00:00:00 | | | updated_at | datetime | NO | | 0000-00-00 00:00:00 | | | is_active | tinyint(1) unsigned | NO | | 1 | | +------------------+----------------------+------+-----+---------------------+----------------+ 11 rows in set (0.00 sec) And the DOB is stored in the customer_entity_datetime table the column value contain the DOB. but in this table values of all other attribute are also stored such as fname,lname etc. So the attribute_id with value 11 is DOB attribute. mysql> desc customer_entity_datetime; +----------------+----------------------+------+-----+---------------------+----------------+ | Field | Type | Null | Key | Default | Extra | +----------------+----------------------+------+-----+---------------------+----------------+ | value_id | int(11) | NO | PRI | NULL | auto_increment | | entity_type_id | smallint(8) unsigned | NO | MUL | 0 | | | attribute_id | smallint(5) unsigned | NO | MUL | 0 | | | entity_id | int(10) unsigned | NO | MUL | 0 | | | value | datetime | NO | | 0000-00-00 00:00:00 | | +----------------+----------------------+------+-----+---------------------+----------------+ 5 rows in set (0.01 sec) Thanks.

    Read the article

  • Change only Revision number in AssemblyInfo.cs with msbuild FileUpdate task

    - by Divya mohan Singh
    I need to change only the revision number of an AssemblyInfo.cs file. The version number is in the format Major.Minor.Build.Revision e.g. 1.4.6.0. Currently I change the version with the FileUpdate task (from the MSBuild Community Tasks Project) and the following regex: <FileUpdate Files="@(AssemblyResult)" Regex='(\[\s*assembly:\s*AssemblyVersion\(\s*"[^\.]+\.[^\.]+)\.([^\.]+)(\.)([^\.]+)("\)\s*\])' ReplacementText='[assembly: AssemblyVersion("$(AssemblyMajorNumber).$(AssemblyMinorNumber).$(AssemblyBuildNumber).$(Revision)")]' /> Now I need to update only the revision number and leave major,minor and build unchanged. So, is there any task to do this? Or can it be done with a regex? What would be the regular expression then?

    Read the article

  • Java Memory Management

    - by Tara Singh
    I am designing a client-server chat application in Java. This is a secure application where the messages are exchanged using cryptographic algorithms. I have one server and it can support many clients. My problem is that when one client logs on the server it works fine, but when another user logs into the system, the server starts giving me bad padding exceptions for the encrypted text. I am not able to figure out the problem, according to my logic, when new connection request to server is made, the server creates a thread for listening to the client. Is it possible that once the instance of thread class is created, it does all the processing correctly for the first client, but not for the second client because the variables in server listener thread class already have some previous value, and thus the encrypted text is not decrypted properly? Please advise how I can make this process more robust so that the number of clients does not affect how well the server functions.

    Read the article

  • Trying to insert a row using stored procedured with a parameter binded to an expression.

    - by Arvind Singh
    Environment: asp.net 3.5 (C# and VB) , Ms-sql server 2005 express Tables Table:tableUser ID (primary key) username Table:userSchedule ID (primary key) thecreator (foreign key = tableUser.ID) other fields I have created a procedure that accepts a parameter username and gets the userid and inserts a row in Table:userSchedule Problem: Using stored procedure with datalist control to only fetch data from the database by passing the current username using statement below works fine protected void SqlDataSourceGetUserID_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CurrentUserName"].Value = Context.User.Identity.Name; } But while inserting using DetailsView it shows error Procedure or function OASNewSchedule has too many arguments specified. I did use protected void SqlDataSourceCreateNewSchedule_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CreatedBy"].Value = Context.User.Identity.Name; } DetailsView properties: autogen fields: off, default mode: insert, it shows all the fields that may not be expected by the procedure like ID (primary key) not required in procedure and CreatedBy (user id ) field . So I tried removing the 2 fields from detailsview and shows error Cannot insert the value NULL into column 'CreatedBy', table 'D:\OAS\OAS\APP_DATA\ASPNETDB.MDF.dbo.OASTest'; column does not allow nulls. INSERT fails. The statement has been terminated. For some reason parameters value is not being set. Can anybody bother to understand this and help?

    Read the article

  • check only one checkbox in gridview using jquery

    - by Gurbax Singh Bhangal
    i have a grid view in which i have placed the checkbox in itemtemplate i want only the one checkbox is selected from Gridview to select that perticular row so that i can use that id to edit or delete the row aspx page code is <asp:TemplateField Visible="false"> <ItemTemplate> <asp:Label ID="lblId" runat="server" Text='<%#Eval("id") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Select </HeaderTemplate> <ItemTemplate> <asp:CheckBox ID="chkSelect" runat="server"/> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Branch Name </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblBranch_Name" runat="server" Text='<%# Bind("Branch") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Address </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblAddress" runat="server" Text='<%# Eval("Address") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> City </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblCity" runat="server" Text='<%# Bind("City") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> </Columns> and i want when i click on the checkbox which is at first of each row only one check box is selected from all the rows thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • calling background service from BroadcastReceiver....

    - by Shalini Singh
    Hi , i am trying to call a push notification background from BroadcastReceiver class.but my application is going to crash the code is given bellow public class AlarmReceiver extends BroadcastReceiver { Context ctx; static int count=1; @Override public void onReceive(Context context, Intent intent) { // TODO Auto-generated method stub //Toast.makeText(context, "working"+count, Toast.LENGTH_LONG).show(); count++; Log.e("broadcast***","receiver"); Intent myIntent=new Intent(context,NotifyService.class); myIntent.setFlags(Intent.FLAG_ACTIVITY_NEW_TASK); context.startActivity(myIntent); } } * manifest entry:- <intent-filter> <action android:name="android.intent.action.BOOT_COMPLETED"/> </intent-filter> </receiver> Error: 05-24 15:17:00.042: ERROR/AndroidRuntime(424): Caused by: android.content.ActivityNotFoundException: Unable to find explicit activity class {com.android.alarm/com.android.alarm.NotifyService}; have you declared this activity in your AndroidManifest.xml? Please help me....

    Read the article

  • Cordova - Scrolling with a fixed header and footer (ios)

    - by Samu Singh
    Using Cordova (phonegap) & bootstrap to make a mobile application, testing on IOS for now. Getting an issue with a header and footer bar that are fixed with scrollable content in the middle. When tapping to scroll, the header/footer bar moves down or up with the content but then snaps back to place as soon as the scrolling completes. If I use -webkit-overflow-scrolling: touch; it works as expected, but it makes it really awkward to scroll through the content, and if you scroll passed the end, it only scrolls the header or footer (with elastic overflow) until you stop for a second. here's my html for the header/footer bars: <div id="headerBar"> <div class="container-fluid" style="background-color: #1569C7"> <div class="row"> <div class="col-xs-3 text-left"> <button id="logoutButton" type="button" class="btn btn-default"> Log Out </button> <button type="button" class="btn btn-default" id="restoreQuestionFeedButton"> <span class="glyphicon glyphicon-chevron-left"></span> </button> </div> <div class="col-xs-6 text-center" style="height: 55px"> <strong id="usernameText"></strong> </div> <div class="col-xs-3 text-right"> <button id="oldCreatQuestionButton" type="button" class="btn btn-default"> <span class="glyphicon glyphicon-plus"></span> </button> </div> </div> </div> </div> <div id="footerBar"> <div class="container-fluid" style="padding: 0"> <div class="row text-center"> <button id="createQuestionButton" type="button" class="btn btn-default footerButton"> <span class="glyphicon glyphicon-plus"></span> <strong>Ask a new free question!</strong> </button> </div> </div> </div> And here is the related CSS: #headerBar { position: fixed; z-index: 100; top: 0; left: 0; width: 100%; background-color: #1569C7; } #footerBar { position: fixed; z-index: 100; bottom: 0; left: 0; width: 100%; background-color: #1569C7 !important; }

    Read the article

  • Issues while downloading document from Sharepoint using JAVA

    - by Deepak Singh Rawat
    I am trying to download a file from Sharepoint 2007 sp2 document library using GetItem method of the Copy webservice. I am facing the following issues : In the local instance ( Windows Vista ) I can save only 10.5 Kb of any file. The webservice is returning only 10.5 Kb of data for any file. On the production server, I am able to List the documents using some credentials but when I am trying to download a document using the same credentials I get a 401 : Unauthorized message. I can download the document using the Sharepoint website successfully.

    Read the article

  • Source control on internet i.e. no private networks.

    - by Kavitesh Singh
    Me and my friend are in the process of starting a small project and want to implement a source control. Now both are located in different cities and can communicate using internet for file sharing etc. I need an online hosting solution or any way where i can maintain the source code repository for both of us to check in/out. As of now we want to maintain it as private project. Does sourceforge allow hosting projects which would not be opensource? One option i was thinking, to obtain a static IP form ISP and host the repository.But that mean my system needs to be online when my friend wants to checkin/out or do some diff with old version code. Secondly, would SVN or git be a better choice in such a situation. I have no experience in git/mercurial as of now.

    Read the article

  • select option in Safari ?

    - by Karandeep Singh
    < select size="2" multiple> < option value="1">1< /option> < option value="2">2< /option> < option value="3">3< /option> < option value="4">4< /option> < option value="5">5< /option> < option value="6">6< /option> < option value="7">7< /option> < option value="8">8< /option> < option value="9">9< /option> < option value="10">10< /option> < option value="11">11< /option> < option value="12">12< /option> < option value="13">13< /option> < /select> size attribute of Select tag is not working properly in Safari. if size attribute's value is greater than four then there have no problem, its working. But when I set the value of size less than four then it show four values. above example displays four options in safari but I want two options. What is the reason for this ?

    Read the article

< Previous Page | 3 4 5 6 7 8 9 10 11 12  | Next Page >