Search Results

Search found 163 results on 7 pages for 'filereader'.

Page 7/7 | < Previous Page | 3 4 5 6 7 

  • Added splash screen code to my package

    - by Youssef
    Please i need support to added splash screen code to my package /* * T24_Transformer_FormView.java */ package t24_transformer_form; import org.jdesktop.application.Action; import org.jdesktop.application.ResourceMap; import org.jdesktop.application.SingleFrameApplication; import org.jdesktop.application.FrameView; import org.jdesktop.application.TaskMonitor; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import javax.swing.filechooser.FileNameExtensionFilter; import javax.swing.filechooser.FileFilter; // old T24 Transformer imports import java.io.File; import java.io.FileWriter; import java.io.StringWriter; import java.text.SimpleDateFormat; import java.util.ArrayList; import java.util.Date; import java.util.HashMap; import java.util.Iterator; //import java.util.Properties; import java.util.StringTokenizer; import javax.swing.; import javax.xml.parsers.DocumentBuilder; import javax.xml.parsers.DocumentBuilderFactory; import javax.xml.transform.Result; import javax.xml.transform.Source; import javax.xml.transform.Transformer; import javax.xml.transform.TransformerFactory; import javax.xml.transform.dom.DOMSource; import javax.xml.transform.stream.StreamResult; import org.apache.log4j.Logger; import org.apache.log4j.PropertyConfigurator; import org.w3c.dom.Document; import org.w3c.dom.DocumentFragment; import org.w3c.dom.Element; import org.w3c.dom.Node; import org.w3c.dom.NodeList; import com.ejada.alinma.edh.xsdtransform.util.ConfigKeys; import com.ejada.alinma.edh.xsdtransform.util.XSDElement; import com.sun.org.apache.xml.internal.serialize.OutputFormat; import com.sun.org.apache.xml.internal.serialize.XMLSerializer; /* * The application's main frame. */ public class T24_Transformer_FormView extends FrameView { /**} * static holders for application-level utilities * { */ //private static Properties appProps; private static Logger appLogger; /** * */ private StringBuffer columnsCSV = null; private ArrayList<String> singleValueTableColumns = null; private HashMap<String, String> multiValueTablesSQL = null; private HashMap<Object, HashMap<String, Object>> groupAttrs = null; private ArrayList<XSDElement> xsdElementsList = null; /** * initialization */ private void init() /*throws Exception*/ { // init the properties object //FileReader in = new FileReader(appConfigPropsPath); //appProps.load(in); // log4j.properties constant String PROP_LOG4J_CONFIG_FILE = "log4j.properties"; // init the logger if ((PROP_LOG4J_CONFIG_FILE != null) && (!PROP_LOG4J_CONFIG_FILE.equals(""))) { PropertyConfigurator.configure(PROP_LOG4J_CONFIG_FILE); if (appLogger == null) { appLogger = Logger.getLogger(T24_Transformer_FormView.class.getName()); } appLogger.info("Application initialization successful."); } columnsCSV = new StringBuffer(ConfigKeys.FIELD_TAG + "," + ConfigKeys.FIELD_NUMBER + "," + ConfigKeys.FIELD_DATA_TYPE + "," + ConfigKeys.FIELD_FMT + "," + ConfigKeys.FIELD_LEN + "," + ConfigKeys.FIELD_INPUT_LEN + "," + ConfigKeys.FIELD_GROUP_NUMBER + "," + ConfigKeys.FIELD_MV_GROUP_NUMBER + "," + ConfigKeys.FIELD_SHORT_NAME + "," + ConfigKeys.FIELD_NAME + "," + ConfigKeys.FIELD_COLUMN_NAME + "," + ConfigKeys.FIELD_GROUP_NAME + "," + ConfigKeys.FIELD_MV_GROUP_NAME + "," + ConfigKeys.FIELD_JUSTIFICATION + "," + ConfigKeys.FIELD_TYPE + "," + ConfigKeys.FIELD_SINGLE_OR_MULTI + System.getProperty("line.separator")); singleValueTableColumns = new ArrayList<String>(); singleValueTableColumns.add(ConfigKeys.COLUMN_XPK_ROW + ConfigKeys.DELIMITER_COLUMN_TYPE + ConfigKeys.DATA_TYPE_XSD_NUMERIC); multiValueTablesSQL = new HashMap<String, String>(); groupAttrs = new HashMap<Object, HashMap<String, Object>>(); xsdElementsList = new ArrayList<XSDElement>(); } /** * initialize the <code>DocumentBuilder</code> and read the XSD file * * @param docPath * @return the <code>Document</code> object representing the read XSD file */ private Document retrieveDoc(String docPath) { Document xsdDoc = null; File file = new File(docPath); try { DocumentBuilder builder = DocumentBuilderFactory.newInstance().newDocumentBuilder(); xsdDoc = builder.parse(file); } catch (Exception e) { appLogger.error(e.getMessage()); } return xsdDoc; } /** * perform the iteration/modification on the document * iterate to the level which contains all the elements (Single-Value, and Groups) and start processing each * * @param xsdDoc * @return */ private Document processDoc(Document xsdDoc) { ArrayList<Object> newElementsList = new ArrayList<Object>(); HashMap<String, Object> docAttrMap = new HashMap<String, Object>(); Element sequenceElement = null; Element schemaElement = null; // get document's root element NodeList nodes = xsdDoc.getChildNodes(); for (int i = 0; i < nodes.getLength(); i++) { if (ConfigKeys.TAG_SCHEMA.equals(nodes.item(i).getNodeName())) { schemaElement = (Element) nodes.item(i); break; } } // process the document (change single-value elements, collect list of new elements to be added) for (int i1 = 0; i1 < schemaElement.getChildNodes().getLength(); i1++) { Node childLevel1 = (Node) schemaElement.getChildNodes().item(i1); // <ComplexType> element if (childLevel1.getNodeName().equals(ConfigKeys.TAG_COMPLEX_TYPE)) { // first, get the main attributes and put it in the csv file for (int i6 = 0; i6 < childLevel1.getChildNodes().getLength(); i6++) { Node child6 = childLevel1.getChildNodes().item(i6); if (ConfigKeys.TAG_ATTRIBUTE.equals(child6.getNodeName())) { if (child6.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME) != null) { String attrName = child6.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME).getNodeValue(); if (((Element) child6).getElementsByTagName(ConfigKeys.TAG_SIMPLE_TYPE).getLength() != 0) { Node simpleTypeElement = ((Element) child6).getElementsByTagName(ConfigKeys.TAG_SIMPLE_TYPE) .item(0); if (((Element) simpleTypeElement).getElementsByTagName(ConfigKeys.TAG_RESTRICTION).getLength() != 0) { Node restrictionElement = ((Element) simpleTypeElement).getElementsByTagName( ConfigKeys.TAG_RESTRICTION).item(0); if (((Element) restrictionElement).getElementsByTagName(ConfigKeys.TAG_MAX_LENGTH).getLength() != 0) { Node maxLengthElement = ((Element) restrictionElement).getElementsByTagName( ConfigKeys.TAG_MAX_LENGTH).item(0); HashMap<String, String> elementProperties = new HashMap<String, String>(); elementProperties.put(ConfigKeys.FIELD_TAG, attrName); elementProperties.put(ConfigKeys.FIELD_NUMBER, "0"); elementProperties.put(ConfigKeys.FIELD_DATA_TYPE, ConfigKeys.DATA_TYPE_XSD_STRING); elementProperties.put(ConfigKeys.FIELD_FMT, ""); elementProperties.put(ConfigKeys.FIELD_NAME, attrName); elementProperties.put(ConfigKeys.FIELD_SHORT_NAME, attrName); elementProperties.put(ConfigKeys.FIELD_COLUMN_NAME, attrName); elementProperties.put(ConfigKeys.FIELD_SINGLE_OR_MULTI, "S"); elementProperties.put(ConfigKeys.FIELD_LEN, maxLengthElement.getAttributes().getNamedItem( ConfigKeys.ATTR_VALUE).getNodeValue()); elementProperties.put(ConfigKeys.FIELD_INPUT_LEN, maxLengthElement.getAttributes() .getNamedItem(ConfigKeys.ATTR_VALUE).getNodeValue()); constructElementRow(elementProperties); // add the attribute as a column in the single-value table singleValueTableColumns.add(attrName + ConfigKeys.DELIMITER_COLUMN_TYPE + ConfigKeys.DATA_TYPE_XSD_STRING + ConfigKeys.DELIMITER_COLUMN_TYPE + maxLengthElement.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE).getNodeValue()); // add the attribute as an element in the elements list addToElementsList(attrName, attrName); appLogger.debug("added attribute: " + attrName); } } } } } } // now, loop on the elements and process them for (int i2 = 0; i2 < childLevel1.getChildNodes().getLength(); i2++) { Node childLevel2 = (Node) childLevel1.getChildNodes().item(i2); // <Sequence> element if (childLevel2.getNodeName().equals(ConfigKeys.TAG_SEQUENCE)) { sequenceElement = (Element) childLevel2; for (int i3 = 0; i3 < childLevel2.getChildNodes().getLength(); i3++) { Node childLevel3 = (Node) childLevel2.getChildNodes().item(i3); // <Element> element if (childLevel3.getNodeName().equals(ConfigKeys.TAG_ELEMENT)) { // check if single element or group if (isGroup(childLevel3)) { processGroup(childLevel3, true, null, null, docAttrMap, xsdDoc, newElementsList); // insert a new comment node with the contents of the group tag sequenceElement.insertBefore(xsdDoc.createComment(serialize(childLevel3)), childLevel3); // remove the group tag sequenceElement.removeChild(childLevel3); } else { processElement(childLevel3); } } } } } } } // add new elements // this step should be after finishing processing the whole document. when you add new elements to the document // while you are working on it, those new elements will be included in the processing. We don't need that! for (int i = 0; i < newElementsList.size(); i++) { sequenceElement.appendChild((Element) newElementsList.get(i)); } // write the new required attributes to the schema element Iterator<String> attrIter = docAttrMap.keySet().iterator(); while(attrIter.hasNext()) { Element attr = (Element) docAttrMap.get(attrIter.next()); Element newAttrElement = xsdDoc.createElement(ConfigKeys.TAG_ATTRIBUTE); appLogger.debug("appending attr. [" + attr.getAttribute(ConfigKeys.ATTR_NAME) + "]..."); newAttrElement.setAttribute(ConfigKeys.ATTR_NAME, attr.getAttribute(ConfigKeys.ATTR_NAME)); newAttrElement.setAttribute(ConfigKeys.ATTR_TYPE, attr.getAttribute(ConfigKeys.ATTR_TYPE)); schemaElement.appendChild(newAttrElement); } return xsdDoc; } /** * add a new <code>XSDElement</code> with the given <code>name</code> and <code>businessName</code> to * the elements list * * @param name * @param businessName */ private void addToElementsList(String name, String businessName) { xsdElementsList.add(new XSDElement(name, businessName)); } /** * add the given <code>XSDElement</code> to the elements list * * @param element */ private void addToElementsList(XSDElement element) { xsdElementsList.add(element); } /** * check if the <code>element</code> sent is single-value element or group * element. the comparison depends on the children of the element. if found one of type * <code>ComplexType</code> then it's a group element, and if of type * <code>SimpleType</code> then it's a single-value element * * @param element * @return <code>true</code> if the element is a group element, * <code>false</code> otherwise */ private boolean isGroup(Node element) { for (int i = 0; i < element.getChildNodes().getLength(); i++) { Node child = (Node) element.getChildNodes().item(i); if (child.getNodeName().equals(ConfigKeys.TAG_COMPLEX_TYPE)) { // found a ComplexType child (Group element) return true; } else if (child.getNodeName().equals(ConfigKeys.TAG_SIMPLE_TYPE)) { // found a SimpleType child (Single-Value element) return false; } } return false; /* String attrName = null; if (element.getAttributes() != null) { Node attribute = element.getAttributes().getNamedItem(XSDTransformer.ATTR_NAME); if (attribute != null) { attrName = attribute.getNodeValue(); } } if (attrName.startsWith("g")) { // group element return true; } else { // single element return false; } */ } /** * process a group element. recursively, process groups till no more group elements are found * * @param element * @param isFirstLevelGroup * @param attrMap * @param docAttrMap * @param xsdDoc * @param newElementsList */ private void processGroup(Node element, boolean isFirstLevelGroup, Node parentGroup, XSDElement parentGroupElement, HashMap<String, Object> docAttrMap, Document xsdDoc, ArrayList<Object> newElementsList) { String elementName = null; HashMap<String, Object> groupAttrMap = new HashMap<String, Object>(); HashMap<String, Object> parentGroupAttrMap = new HashMap<String, Object>(); XSDElement groupElement = null; if (element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME) != null) { elementName = element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME).getNodeValue(); } appLogger.debug("processing group [" + elementName + "]..."); groupElement = new XSDElement(elementName, elementName); // get the attributes if a non-first-level-group // attributes are: groups's own attributes + parent group's attributes if (!isFirstLevelGroup) { // get the current element (group) attributes for (int i1 = 0; i1 < element.getChildNodes().getLength(); i1++) { if (ConfigKeys.TAG_COMPLEX_TYPE.equals(element.getChildNodes().item(i1).getNodeName())) { Node complexTypeNode = element.getChildNodes().item(i1); for (int i2 = 0; i2 < complexTypeNode.getChildNodes().getLength(); i2++) { if (ConfigKeys.TAG_ATTRIBUTE.equals(complexTypeNode.getChildNodes().item(i2).getNodeName())) { appLogger.debug("add group attr: " + ((Element) complexTypeNode.getChildNodes().item(i2)).getAttribute(ConfigKeys.ATTR_NAME)); groupAttrMap.put(((Element) complexTypeNode.getChildNodes().item(i2)).getAttribute(ConfigKeys.ATTR_NAME), complexTypeNode.getChildNodes().item(i2)); docAttrMap.put(((Element) complexTypeNode.getChildNodes().item(i2)).getAttribute(ConfigKeys.ATTR_NAME), complexTypeNode.getChildNodes().item(i2)); } } } } // now, get the parent's attributes parentGroupAttrMap = groupAttrs.get(parentGroup); if (parentGroupAttrMap != null) { Iterator<String> iter = parentGroupAttrMap.keySet().iterator(); while (iter.hasNext()) { String attrName = iter.next(); groupAttrMap.put(attrName, parentGroupAttrMap.get(attrName)); } } // add the attributes to the group element that will be added to the elements list Iterator<String> itr = groupAttrMap.keySet().iterator(); while(itr.hasNext()) { groupElement.addAttribute(itr.next()); } // put the attributes in the attributes map groupAttrs.put(element, groupAttrMap); } for (int i = 0; i < element.getChildNodes().getLength(); i++) { Node childLevel1 = (Node) element.getChildNodes().item(i); if (childLevel1.getNodeName().equals(ConfigKeys.TAG_COMPLEX_TYPE)) { for (int j = 0; j < childLevel1.getChildNodes().getLength(); j++) { Node childLevel2 = (Node) childLevel1.getChildNodes().item(j); if (childLevel2.getNodeName().equals(ConfigKeys.TAG_SEQUENCE)) { for (int k = 0; k < childLevel2.getChildNodes().getLength(); k++) { Node childLevel3 = (Node) childLevel2.getChildNodes().item(k); if (childLevel3.getNodeName().equals(ConfigKeys.TAG_ELEMENT)) { // check if single element or group if (isGroup(childLevel3)) { // another group element.. // unfortunately, a recursion is // needed here!!! :-( processGroup(childLevel3, false, element, groupElement, docAttrMap, xsdDoc, newElementsList); } else { // reached a single-value element.. copy it under the // main sequence and apply the name<>shorname replacement processGroupElement(childLevel3, element, groupElement, isFirstLevelGroup, xsdDoc, newElementsList); } } } } } } } if (isFirstLevelGroup) { addToElementsList(groupElement); } else { parentGroupElement.addChild(groupElement); } appLogger.debug("finished processing group [" + elementName + "]."); } /** * process the sent <code>element</code> to extract/modify required * information: * 1. replace the <code>name</code> attribute with the <code>shortname</code>. * * @param element */ private void processElement(Node element) { String fieldShortName = null; String fieldColumnName = null; String fieldDataType = null; String fieldFormat = null; String fieldInputLength = null; String elementName = null; HashMap<String, String> elementProperties = new HashMap<String, String>(); if (element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME) != null) { elementName = element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME).getNodeValue(); } appLogger.debug("processing element [" + elementName + "]..."); for (int i = 0; i < element.getChildNodes().getLength(); i++) { Node childLevel1 = (Node) element.getChildNodes().item(i); if (childLevel1.getNodeName().equals(ConfigKeys.TAG_ANNOTATION)) { for (int j = 0; j < childLevel1.getChildNodes().getLength(); j++) { Node childLevel2 = (Node) childLevel1.getChildNodes().item(j); if (childLevel2.getNodeName().equals(ConfigKeys.TAG_APP_INFO)) { for (int k = 0; k < childLevel2.getChildNodes().getLength(); k++) { Node childLevel3 = (Node) childLevel2.getChildNodes().item(k); if (childLevel3.getNodeName().equals(ConfigKeys.TAG_HAS_PROPERTY)) { if (childLevel3.getAttributes() != null) { String attrName = null; Node attribute = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME); if (attribute != null) { attrName = attribute.getNodeValue(); elementProperties.put(attrName, childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue()); if (attrName.equals(ConfigKeys.FIELD_SHORT_NAME)) { fieldShortName = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_COLUMN_NAME)) { fieldColumnName = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_DATA_TYPE)) { fieldDataType = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_FMT)) { fieldFormat = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_INPUT_LEN)) { fieldInputLength = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } } } } } } } } } // replace the name attribute with the shortname if (element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME) != null) { element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME).setNodeValue(fieldShortName); } elementProperties.put(ConfigKeys.FIELD_SINGLE_OR_MULTI, "S"); constructElementRow(elementProperties); singleValueTableColumns.add(fieldShortName + ConfigKeys.DELIMITER_COLUMN_TYPE + fieldDataType + fieldFormat + ConfigKeys.DELIMITER_COLUMN_TYPE + fieldInputLength); // add the element to elements list addToElementsList(fieldShortName, fieldColumnName); appLogger.debug("finished processing element [" + elementName + "]."); } /** * process the sent <code>element</code> to extract/modify required * information: * 1. copy the element under the main sequence * 2. replace the <code>name</code> attribute with the <code>shortname</code>. * 3. add the attributes of the parent groups (if non-first-level-group) * * @param element */ private void processGroupElement(Node element, Node parentGroup, XSDElement parentGroupElement, boolean isFirstLevelGroup, Document xsdDoc, ArrayList<Object> newElementsList) { String fieldShortName = null; String fieldColumnName = null; String fieldDataType = null; String fieldFormat = null; String fieldInputLength = null; String elementName = null; Element newElement = null; HashMap<String, String> elementProperties = new HashMap<String, String>(); ArrayList<String> tableColumns = new ArrayList<String>(); HashMap<String, Object> groupAttrMap = null; if (element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME) != null) { elementName = element.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME).getNodeValue(); } appLogger.debug("processing element [" + elementName + "]..."); // 1. copy the element newElement = (Element) element.cloneNode(true); newElement.setAttribute(ConfigKeys.ATTR_MAX_OCCURS, "unbounded"); // 2. if non-first-level-group, replace the element's SimpleType tag with a ComplexType tag if (!isFirstLevelGroup) { if (((Element) newElement).getElementsByTagName(ConfigKeys.TAG_SIMPLE_TYPE).getLength() != 0) { // there should be only one tag of SimpleType Node simpleTypeNode = ((Element) newElement).getElementsByTagName(ConfigKeys.TAG_SIMPLE_TYPE).item(0); // create the new ComplexType element Element complexTypeNode = xsdDoc.createElement(ConfigKeys.TAG_COMPLEX_TYPE); complexTypeNode.setAttribute(ConfigKeys.ATTR_MIXED, "true"); // get the list of attributes for the parent group groupAttrMap = groupAttrs.get(parentGroup); Iterator<String> attrIter = groupAttrMap.keySet().iterator(); while(attrIter.hasNext()) { Element attr = (Element) groupAttrMap.get(attrIter.next()); Element newAttrElement = xsdDoc.createElement(ConfigKeys.TAG_ATTRIBUTE); appLogger.debug("adding attr. [" + attr.getAttribute(ConfigKeys.ATTR_NAME) + "]..."); newAttrElement.setAttribute(ConfigKeys.ATTR_REF, attr.getAttribute(ConfigKeys.ATTR_NAME)); newAttrElement.setAttribute(ConfigKeys.ATTR_USE, "optional"); complexTypeNode.appendChild(newAttrElement); } // replace the old SimpleType node with the new ComplexType node newElement.replaceChild(complexTypeNode, simpleTypeNode); } } // 3. replace the name with the shortname in the new element for (int i = 0; i < newElement.getChildNodes().getLength(); i++) { Node childLevel1 = (Node) newElement.getChildNodes().item(i); if (childLevel1.getNodeName().equals(ConfigKeys.TAG_ANNOTATION)) { for (int j = 0; j < childLevel1.getChildNodes().getLength(); j++) { Node childLevel2 = (Node) childLevel1.getChildNodes().item(j); if (childLevel2.getNodeName().equals(ConfigKeys.TAG_APP_INFO)) { for (int k = 0; k < childLevel2.getChildNodes().getLength(); k++) { Node childLevel3 = (Node) childLevel2.getChildNodes().item(k); if (childLevel3.getNodeName().equals(ConfigKeys.TAG_HAS_PROPERTY)) { if (childLevel3.getAttributes() != null) { String attrName = null; Node attribute = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME); if (attribute != null) { attrName = attribute.getNodeValue(); elementProperties.put(attrName, childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue()); if (attrName.equals(ConfigKeys.FIELD_SHORT_NAME)) { fieldShortName = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_COLUMN_NAME)) { fieldColumnName = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_DATA_TYPE)) { fieldDataType = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_FMT)) { fieldFormat = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } else if (attrName.equals(ConfigKeys.FIELD_INPUT_LEN)) { fieldInputLength = childLevel3.getAttributes().getNamedItem(ConfigKeys.ATTR_VALUE) .getNodeValue(); } } } } } } } } } if (newElement.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME) != null) { newElement.getAttributes().getNamedItem(ConfigKeys.ATTR_NAME).setNodeValue(fieldShortName); } // 4. save the new element to be added to the sequence list newElementsList.add(newElement); elementProperties.put(ConfigKeys.FIELD_SINGLE_OR_MULTI, "M"); constructElementRow(elementProperties); // create the MULTI-VALUE table // 0. Primary Key tableColumns.add(ConfigKeys.COLUMN_XPK_ROW + ConfigKeys.DELIMITER_COLUMN_TYPE + ConfigKeys.DATA_TYPE_XSD_STRING + ConfigKeys.DELIMITER_COLUMN_TYPE + ConfigKeys.COLUMN_XPK_ROW_LENGTH); // 1. foreign key tableColumns.add(ConfigKeys.COLUMN_FK_ROW + ConfigKeys.DELIMITER_COLUMN_TYPE + ConfigKeys.DATA_TYPE_XSD_NUMERIC); // 2. field value tableColumns.add(fieldShortName + ConfigKeys.DELIMITER_COLUMN_TYPE + fieldDataType + fieldFormat + ConfigKeys.DELIMITER_COLUMN_TYPE + fieldInputLength); // 3. attributes if (groupAttrMap != null) { Iterator<String> attrIter = groupAttrMap.keySet().iterator(); while (attrIter.hasNext()) { Element attr = (Element) groupAttrMap.get(attrIter.next()); tableColumns.add(attr.getAttribute(ConfigKeys.ATTR_NAME) + ConfigKeys.DELIMITER_COLUMN_TYPE + ConfigKeys.DATA_TYPE_XSD_NUMERIC); } } multiValueTablesSQL.put(sub_table_prefix.getText() + fieldShortName, constructMultiValueTableSQL( sub_table_prefix.getText() + fieldShortName, tableColumns)); // add the element to it's parent group children parentGroupElement.addChild(new XSDElement(fieldShortName, fieldColumnName)); appLogger.debug("finished processing element [" + elementName + "]."); } /** * write resulted files * * @param xsdDoc * @param docPath */ private void writeResults(Document xsdDoc, String resultsDir, String newXSDFileName, String csvFileName) { String rsDir = resultsDir + File.separator + new SimpleDateFormat("yyyyMMdd-HHmm").format(new Date()); try { File resultsDirFile = new File(rsDir); if (!resultsDirFile.exists()) { resultsDirFile.mkdirs(); } // write the XSD doc appLogger.info("writing the transformed XSD..."); Source source = new DOMSource(xsdDoc); Result result = new StreamResult(rsDir + File.separator + newXSDFileName); Transformer xformer = TransformerFactory.newInstance().newTransformer(); // xformer.setOutputProperty("indent", "yes"); xformer.transform(source, result); appLogger.info("finished writing the transformed XSD."); // write the CSV columns file appLogger.info("writing the CSV file..."); FileWriter csvWriter = new FileWriter(rsDir + File.separator + csvFileName); csvWriter.write(columnsCSV.toString()); csvWriter.close(); appLogger.info("finished writing the CSV file."); // write the master single-value table appLogger.info("writing the creation script for master table (single-values)..."); FileWriter masterTableWriter = new FileWriter(rsDir + File.separator + main_edh_table_name.getText() + ".sql"); masterTableWriter.write(constructSingleValueTableSQL(main_edh_table_name.getText(), singleValueTableColumns)); masterTableWriter.close(); appLogger.info("finished writing the creation script for master table (single-values)."); // write the multi-value tables sql appLogger.info("writing the creation script for slave tables (multi-values)..."); Iterator<String> iter = multiValueTablesSQL.keySet().iterator(); while (iter.hasNext()) { String tableName = iter.next(); String sql = multiValueTablesSQL.get(tableName); FileWriter tableSQLWriter = new FileWriter(rsDir + File.separator + tableName + ".sql"); tableSQLWriter.write(sql); tableSQLWriter.close(); } appLogger.info("finished writing the creation script for slave tables (multi-values)."); // write the single-value view appLogger.info("writing the creation script for single-value selection view..."); FileWriter singleValueViewWriter = new FileWriter(rsDir + File.separator + view_name_single.getText() + ".sql"); singleValueViewWriter.write(constructViewSQL(ConfigKeys.SQL_VIEW_SINGLE)); singleValueViewWriter.close(); appLogger.info("finished writing the creation script for single-value selection view."); // debug for (int i = 0; i < xsdElementsList.size(); i++) { getMultiView(xsdElementsList.get(i)); /*// if (xsdElementsList.get(i).getAllDescendants() != null) { // for (int j = 0; j < xsdElementsList.get(i).getAllDescendants().size(); j++) { // appLogger.debug(main_edh_table_name.getText() + "." + ConfigKeys.COLUMN_XPK_ROW // + "=" + xsdElementsList.get(i).getAllDescendants().get(j).getName() + "." + ConfigKeys.COLUMN_FK_ROW); // } // } */ } } catch (Exception e) { appLogger.error(e.getMessage()); } } private String getMultiView(XSDElement element)

    Read the article

  • Java Logger API

    - by Koppar
    This is a more like a tip rather than technical write up and serves as a quick intro for newbies. The logger API helps to diagnose application level or JDK level issues at runtime. There are 7 levels which decide the detailing in logging (SEVERE, WARNING, INFO, CONFIG, FINE, FINER, FINEST). Its best to start with highest level and as we narrow down, use more detailed logging for a specific area. SEVERE is the highest and FINEST is the lowest. This may not make sense until we understand some jargon. The Logger class provides the ability to stream messages to an output stream in a format that can be controlled by the user. What this translates to is, I can create a logger with this simple invocation and use it add debug messages in my class: import java.util.logging.*; private static final Logger focusLog = Logger.getLogger("java.awt.focus.KeyboardFocusManager"); if (focusLog.isLoggable(Level.FINEST)) { focusLog.log(Level.FINEST, "Calling peer setCurrentFocusOwner}); LogManager acts like a book keeper and all the getLogger calls are forwarded to LogManager. The LogManager itself is a singleton class object which gets statically initialized on JVM start up. More on this later. If there is no existing logger with the given name, a new one is created. If there is one (and not yet GC’ed), then the existing Logger object is returned. By default, a root logger is created on JVM start up. All anonymous loggers are made as the children of the root logger. Named loggers have the hierarchy as per their name resolutions. Eg: java.awt.focus is the parent logger for java.awt.focus.KeyboardFocusManager etc. Before logging any message, the logger checks for the log level specified. If null is specified, the log level of the parent logger will be set. However, if the log level is off, no log messages would be written, irrespective of the parent’s log level. All the messages that are posted to the Logger are handled as a LogRecord object.i.e. FocusLog.log would create a new LogRecord object with the log level and message as its data members). The level of logging and thread number are also tracked. LogRecord is passed on to all the registered Handlers. Handler is basically a means to output the messages. The output may be redirected to either a log file or console or a network logging service. The Handler classes use the LogManager properties to set filters and formatters. During initialization or JVM start up, LogManager looks for logging.properties file in jre/lib and sets the properties if the file is provided. An alternate location for properties file can also be specified by setting java.util.logging.config.file system property. This can be set in Java Control Panel ? Java ? Runtime parameters as -Djava.util.logging.config.file = <mylogfile> or passed as a command line parameter java -Djava.util.logging.config.file = C:/Sunita/myLog The redirection of logging depends on what is specified rather registered as a handler with JVM in the properties file. java.util.logging.ConsoleHandler sends the output to system.err and java.util.logging.FileHandler sends the output to file. File name of the log file can also be specified. If you prefer XML format output, in the configuration file, set java.util.logging.FileHandler.formatter = java.util.logging.XMLFormatter and if you prefer simple text, set set java.util.logging.FileHandler.formatter =java.util.logging.SimpleFormatter Below is the default logging Configuration file: ############################################################ # Default Logging Configuration File # You can use a different file by specifying a filename # with the java.util.logging.config.file system property. # For example java -Djava.util.logging.config.file=myfile ############################################################ ############################################################ # Global properties ############################################################ # "handlers" specifies a comma separated list of log Handler # classes. These handlers will be installed during VM startup. # Note that these classes must be on the system classpath. # By default we only configure a ConsoleHandler, which will only # show messages at the INFO and above levels. handlers= java.util.logging.ConsoleHandler # To also add the FileHandler, use the following line instead. #handlers= java.util.logging.FileHandler, java.util.logging.ConsoleHandler # Default global logging level. # This specifies which kinds of events are logged across # all loggers. For any given facility this global level # can be overriden by a facility specific level # Note that the ConsoleHandler also has a separate level # setting to limit messages printed to the console. .level= INFO ############################################################ # Handler specific properties. # Describes specific configuration info for Handlers. ############################################################ # default file output is in user's home directory. java.util.logging.FileHandler.pattern = %h/java%u.log java.util.logging.FileHandler.limit = 50000 java.util.logging.FileHandler.count = 1 java.util.logging.FileHandler.formatter = java.util.logging.XMLFormatter # Limit the message that are printed on the console to INFO and above. java.util.logging.ConsoleHandler.level = INFO java.util.logging.ConsoleHandler.formatter = java.util.logging.SimpleFormatter ############################################################ # Facility specific properties. # Provides extra control for each logger. ############################################################ # For example, set the com.xyz.foo logger to only log SEVERE # messages: com.xyz.foo.level = SEVERE Since I primarily use this method to track focus issues, here is how I get detailed awt focus related logging. Just set the logger name to java.awt.focus.level=FINEST and change the default log level to FINEST. Below is a basic sample program. The sample programs are from http://www2.cs.uic.edu/~sloan/CLASSES/java/ and have been modified to illustrate the logging API. By changing the .level property in the logging.properties file, one can control the output written to the logs. To play around with the example, try changing the levels in the logging.properties file and notice the difference in messages going to the log file. Example --------KeyboardReader.java------------------------------------------------------------------------------------- import java.io.*; import java.util.*; import java.util.logging.*; public class KeyboardReader { private static final Logger mylog = Logger.getLogger("samples.input"); public static void main (String[] args) throws java.io.IOException { String s1; String s2; double num1, num2, product; // set up the buffered reader to read from the keyboard BufferedReader br = new BufferedReader (new InputStreamReader (System.in)); System.out.println ("Enter a line of input"); s1 = br.readLine(); if (mylog.isLoggable(Level.SEVERE)) { mylog.log (Level.SEVERE,"The line entered is " + s1); } if (mylog.isLoggable(Level.INFO)) { mylog.log (Level.INFO,"The line has " + s1.length() + " characters"); } if (mylog.isLoggable(Level.FINE)) { mylog.log (Level.FINE,"Breaking the line into tokens we get:"); } int numTokens = 0; StringTokenizer st = new StringTokenizer (s1); while (st.hasMoreTokens()) { s2 = st.nextToken(); numTokens++; if (mylog.isLoggable(Level.FINEST)) { mylog.log (Level.FINEST, " Token " + numTokens + " is: " + s2); } } } } ----------MyFileReader.java---------------------------------------------------------------------------------------- import java.io.*; import java.util.*; import java.util.logging.*; public class MyFileReader extends KeyboardReader { private static final Logger mylog = Logger.getLogger("samples.input.file"); public static void main (String[] args) throws java.io.IOException { String s1; String s2; // set up the buffered reader to read from the keyboard BufferedReader br = new BufferedReader (new FileReader ("MyFileReader.txt")); s1 = br.readLine(); if (mylog.isLoggable(Level.SEVERE)) { mylog.log (Level.SEVERE,"ATTN The line is " + s1); } if (mylog.isLoggable(Level.INFO)) { mylog.log (Level.INFO, "The line has " + s1.length() + " characters"); } if (mylog.isLoggable(Level.FINE)) { mylog.log (Level.FINE,"Breaking the line into tokens we get:"); } int numTokens = 0; StringTokenizer st = new StringTokenizer (s1); while (st.hasMoreTokens()) { s2 = st.nextToken(); numTokens++; if (mylog.isLoggable(Level.FINEST)) { mylog.log (Level.FINEST,"Breaking the line into tokens we get:"); mylog.log (Level.FINEST," Token " + numTokens + " is: " + s2); } } //end of while } // end of main } // end of class ----------MyFileReader.txt------------------------------------------------------------------------------------------ My first logging example -------logging.properties------------------------------------------------------------------------------------------- handlers= java.util.logging.ConsoleHandler, java.util.logging.FileHandler .level= FINEST java.util.logging.FileHandler.pattern = java%u.log java.util.logging.FileHandler.limit = 50000 java.util.logging.FileHandler.count = 1 java.util.logging.FileHandler.formatter = java.util.logging.SimpleFormatter java.util.logging.ConsoleHandler.level = FINEST java.util.logging.ConsoleHandler.formatter = java.util.logging.SimpleFormatter java.awt.focus.level=ALL ------Output log------------------------------------------------------------------------------------------- May 21, 2012 11:44:55 AM MyFileReader main SEVERE: ATTN The line is My first logging example May 21, 2012 11:44:55 AM MyFileReader main INFO: The line has 24 characters May 21, 2012 11:44:55 AM MyFileReader main FINE: Breaking the line into tokens we get: May 21, 2012 11:44:55 AM MyFileReader main FINEST: Breaking the line into tokens we get: May 21, 2012 11:44:55 AM MyFileReader main FINEST: Token 1 is: My May 21, 2012 11:44:55 AM MyFileReader main FINEST: Breaking the line into tokens we get: May 21, 2012 11:44:55 AM MyFileReader main FINEST: Token 2 is: first May 21, 2012 11:44:55 AM MyFileReader main FINEST: Breaking the line into tokens we get: May 21, 2012 11:44:55 AM MyFileReader main FINEST: Token 3 is: logging May 21, 2012 11:44:55 AM MyFileReader main FINEST: Breaking the line into tokens we get: May 21, 2012 11:44:55 AM MyFileReader main FINEST: Token 4 is: example Invocation command: "C:\Program Files (x86)\Java\jdk1.6.0_29\bin\java.exe" -Djava.util.logging.config.file=logging.properties MyFileReader References Further technical details are available here: http://docs.oracle.com/javase/1.4.2/docs/guide/util/logging/overview.html#1.0 http://docs.oracle.com/javase/1.4.2/docs/api/java/util/logging/package-summary.html http://www2.cs.uic.edu/~sloan/CLASSES/java/

    Read the article

  • How do i use GraphMLReader2 in Jung?

    - by askus
    I want to use class GraphMLReader to read a Undirected Graph from graphML with JUNG2.0. The code is as follow: import edu.uci.ics.jung.io.*; import edu.uci.ics.jung.io.graphml.*; import java.io.*; import java.util.*; import org.apache.commons.collections15.Transformer; import edu.uci.ics.jung.graph.*; class Vertex{ int id; String type; String value; } class Edge{ int id ; String type; String value; } public class Loader{ static String src = "test.xsl"; public static void Main( String[] args){ Reader reader = new FileReader(src ); Transformer<NodeMetadata, Vertex> vtrans = new Transformer<NodeMetadata,Vertex>(){ public Vertex transform(NodeMetadata nmd ){ Vertex v = new Vertex() ; v.type = nmd.getProperty("type"); v.value = nmd.getProperty("value"); v.id = Integer.valueOf( nmd.getId() ); return v; } }; Transformer<EdgeMetadata, Edge> etrans = new Transformer<EdgeMetadata,Edge>(){ public Edge transform( EdgeMetadata emd ){ Edge e = new Edge() ; e.type = emd.getProperty("type"); e.value = emd.getProperty("value"); e.id = Integer.valueOf( emd.getId() ); return e; } }; Transformer<HyperEdgeMetadata, Edge> hetrans = new Transformer<HyperEdgeMetadata,Edge>(){ public Edge transform( HyperEdgeMetadata emd ){ Edge e = new Edge() ; e.type = emd.getProperty("type"); e.value = emd.getProperty("value"); e.id = Integer.valueOf( emd.getId() ); return e; } }; Transformer< GraphMetadata , UndirectedSparseGraph> gtrans = new Transformer<GraphMetadata,UndirectedSparseGraph>(){ public UndirectedSparseGraph<Vertex,Edge> transform( GraphMetadata gmd ){ return new UndirectedSparseGraph<Vertex,Edge>(); } }; GraphMLReader2< UndirectedSparseGraph<Vertex,Edge> , Vertex , Edge> gmlr = new GraphMLReader2< UndirectedSparseGraph<Vertex,Edge> ,Vertex, Edge>( reader, gtrans, vtrans, etrans, hetrans); UndirectedSparseGraph<Vertex,Edge> g = gmlr.readGraph(); return ; } } However, compiler alert that: Loader.java:60: cannot find symbol symbol : constructor GraphMLReader2(java.io.Reader,org.apache.commons.collections15.Transformer<edu.uci.ics.jung.io.graphml.GraphMetadata,edu.uci.ics.jung.graph.UndirectedSparseGraph>,org.apache.commons.collections15.Transformer<edu.uci.ics.jung.io.graphml.NodeMetadata,Vertex>,org.apache.commons.collections15.Transformer<edu.uci.ics.jung.io.graphml.EdgeMetadata,Edge>) location: class edu.uci.ics.jung.io.graphml.GraphMLReader2<edu.uci.ics.jung.graph.UndirectedSparseGraph<Vertex,Edge>,Vertex,Edge> new GraphMLReader2< UndirectedSparseGraph<Vertex,Edge> ,Vertex, Edge>( ^ 1 error How can i solve this problem? Thanks.

    Read the article

  • How the JOptionPane works

    - by DevAno1
    How can I control what happens with window after clicking JOPtionPane buttons ? I'm trying to implement simple file chooser. In my frame I have 3 buttons (OK, Cancel, Browse). Browse button opens file search window, and after picking files should return to main frame. Clicking OK will open a frame with the content of the file. Now porblem looks this way. With the code below, I can choose file but directly after that a new frame is created, and my frame with buttons dissapears : import java.io.File; import java.io.BufferedReader; import java.io.FileReader; import java.io.IOException; import java.awt.*; import javax.swing.*; import java.io.*; public class Main { public static void main(String args[]) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { show("Window"); } }); } public static void show(String frame_name){ JFrame frame = new JFrame(frame_name); frame.setPreferredSize(new Dimension(450, 300)); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); JPanel top = new JPanel(); top.setLayout(new BoxLayout(top, BoxLayout.Y_AXIS)); JFileChooser fc = new JFileChooser(new File(".")); JPanel creator = new JPanel(); creator.setLayout(new BoxLayout(creator, BoxLayout.Y_AXIS)); creator.add(top); String[] buttons = {"OK", "Cancel", "Browse"}; int rc = JOptionPane.showOptionDialog( null, creator, frame_name, JOptionPane.DEFAULT_OPTION, JOptionPane.PLAIN_MESSAGE, null, buttons, buttons[0] ); String approveButt = ""; switch(rc){ case 0: break; case 1: break; case 2: approveButt = buttons[rc]; int retVal = fc.showDialog(null, approveButt); if (retVal == JFileChooser.APPROVE_OPTION) System.out.println(approveButt + " " + fc.getSelectedFile()); break; } frame.pack(); frame.setVisible(true); } } With the second code I can return to my menu, but in no way I am able to pop this new frame, which appeared with first code. How to control this ? What am I missing ? public class Main { public static void main(String args[]) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { show("Window"); } }); } public static void show(String frame_name){ JFrame frame = new JFrame(frame_name); frame.setPreferredSize(new Dimension(450, 300)); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); JPanel top = new JPanel(); top.setLayout(new BoxLayout(top, BoxLayout.Y_AXIS)); JFileChooser fc = new JFileChooser(new File(".")); JPanel creator = new JPanel(); creator.setLayout(new BoxLayout(creator, BoxLayout.Y_AXIS)); creator.add(top); String[] buttons = {"OK", "Cancel", "Browse"}; String approveButt = ""; Plane m = null; int rc = -1; while (rc != 0) { rc = JOptionPane.showOptionDialog( null, creator, frame_name, JOptionPane.DEFAULT_OPTION, JOptionPane.PLAIN_MESSAGE, null, buttons, buttons[0] ); switch (rc) { case 0: m = new Plane(); case 1: System.exit(0); case 2: approveButt = buttons[rc]; int retVal = fc.showDialog(null, approveButt); if (retVal == JFileChooser.APPROVE_OPTION) System.out.println(approveButt + " " + fc.getSelectedFile()); break; default: break; } } addComponents(frame.getContentPane(), m); frame.pack(); frame.setVisible(true); } private static void addComponents(Container c, Plane e) { c.setLayout(new BoxLayout(c, BoxLayout.Y_AXIS)); c.add(e); } } class Plane extends JPanel { public Plane(){ } @Override public void paint(Graphics g){ g.setColor(Color.BLUE); g.fillRect(0, 0, 400, 250); } }

    Read the article

  • Jquery only works the first time

    - by Tripping
    I am trying to teach myself general web development skills. I am trying to create a image upload with preview functionality using HTML5 FileAPI. Till now, I have created a file input which shows the preview of image when selected. Html mark up is below: <div> <!-- Photos --> <fieldset> <legend>PropertyPhotos</legend> <div class="upload-box" id="upload-box-1"> <div class="preview-box"> <img alt="Field for image cutting" id="preview_1" src="@Url.Content("~/Content/empty.png")" /> </div> <div> @Html.FileFor(model => model.File1) @Html.ValidationMessageFor(model => model.File1) </div> </div> <div class="upload-box" id="upload-box-2"> <div class="preview-box"> <img alt="Field for image cutting" id="preview_2" src="@Url.Content("~/Content/empty.png")" /> </div> <div> @Html.FileFor(model => model.File2) @Html.ValidationMessageFor(model => model.File2) </div> </div> <div class="upload-box" id="upload-box-3"> <div class="preview-box"> <img alt="Field for image cutting" id="preview_3" src="@Url.Content("~/Content/empty.png")" /> </div> <div> @Html.FileFor(model => model.File3) @Html.ValidationMessageFor(model => model.File3) </div> </div> </fieldset> </div> The Jquery to show preview and then display the next "upload-box" is as follows: <script type="text/javascript"> $(document).ready(function () { // show first box $("#upload-box-1").fadeIn(); //Get current & next step index var stepNum = $('div.upload-box').attr('id').replace(/[^\d]/g, ''); var nextNum = parseInt(stepNum)+1; //Get the preview image tag var preview = $('#preview_'+stepNum); //Load preview on file tag change and display second upload-box $('#File'+stepNum).change(function (evt) { var f = evt.target.files[0]; var reader = new FileReader(); if (!f.type.match('image.*')) { alert("The selected file does not appear to be an image."); return; } reader.onload = function (e) { preview.attr('src', e.target.result); }; reader.readAsDataURL(f); //Show next upload-box $("#upload-box-" + nextNum).fadeIn(); }); }); </script> However, this code only first for the first time ... i.e. on selecting a file - It shows a preview and then shows the next "upload-box". However, when I browse using the second file it doesn't show any preview. From what I have ready, I need to close the Jquery function so that it can be initialised again but I am not sure how to do that. Any help will be grateful.

    Read the article

  • save as .txt format

    - by user1180492
    I made a NotePad program. The problem is it doesn't save in .txt format, It save as a file with no format. But it can open .txt files. How can i fix it? Here is my work. import javax.swing.*; import java.awt.*; import java.awt.event.*; import java.util.Scanner; import java.io.*; public class NotePad extends JFrame { private JTextArea noteArea; public static void main(String[] args) { NotePad p = new NotePad(); p.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); p.setSize(500,300); p.setVisible(true); } public NotePad() { super("Java Notepad"); setLayout(new BorderLayout()); noteArea = new JTextArea("",20,20); noteArea.setWrapStyleWord(true); noteArea.setLineWrap(true); Font font = new Font("sanserif", Font.BOLD,14); noteArea.setFont(font); JScrollPane scroller = new JScrollPane(noteArea); scroller.setVerticalScrollBarPolicy(ScrollPaneConstants.VERTICAL_SCROLLBAR_ALWAYS); scroller.setHorizontalScrollBarPolicy(ScrollPaneConstants.HORIZONTAL_SCROLLBAR_NEVER); add(scroller,BorderLayout.CENTER); JMenuBar menuBar = new JMenuBar(); JMenu fileMenu = new JMenu("File"); JMenuItem openMenu = new JMenuItem("Open"); openMenu.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent ae) { JFileChooser openFile = new JFileChooser(); openFile.showOpenDialog(new NotePad()); loadFile(openFile.getSelectedFile()); } }); JMenuItem saveMenu = new JMenuItem("Save"); saveMenu.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent ae) { JFileChooser saveFile = new JFileChooser(); saveFile.showSaveDialog(new NotePad()); fileSaved(saveFile.getSelectedFile()); } }); JMenuItem exitMenu = new JMenuItem("Close"); exitMenu.addActionListener(new ActionListener(){ public void actionPerformed(ActionEvent ae) { System.exit(0); } }); fileMenu.add(openMenu); fileMenu.add(saveMenu); fileMenu.add(exitMenu); menuBar.add(fileMenu); this.setJMenuBar(menuBar); } public void loadFile(File file) { noteArea.setText(""); try { BufferedReader read = new BufferedReader(new FileReader(file)); String line = null; while((line =read.readLine())!=null) { noteArea.append(line +"\n"); } read.close(); } catch (Exception e) { System.out.println("Error " + e.toString()); } } public void fileSaved(File file) { try { PrintWriter writer = new PrintWriter(file); String[] lines = noteArea.getText().split("\\n"); for (String ) { writer.println(words); } writer.close(); } catch (Exception e) { System.out.println("Error " + e.toString()); } } } btw I can't post my question because of not explaning the scenario according to the site. So there. Thanks for the help

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Parsing csv line to Java objects

    - by Noobling
    I was wondering if someone here could help me, I can't find a solution for my problem and I have tried everything. What I am trying to do is read and parse lines in a csv file into java objects and I have succeeded in doing that but after it reads all the lines it should insert the lines into the database but it only inserts the 1st line the entire time and I don't no why. When I do a print it shows that it is reading all the lines and placing them in the objects but as soon as I do the insert it wants to insert only the 1st line. Please see my code below: public boolean lineReader(File file){ BufferedReader br = null; String line= ""; String splitBy = ","; storeList = new ArrayList<StoreFile>(); try { br = new BufferedReader(new FileReader(file)); while((line = br.readLine())!=null){ line = line.replace('|', ','); //split on pipe ( | ) String[] array = line.split(splitBy, 14); //Add values from csv to store object //Add values from csv to storeF objects StoreFile StoreF = new StoreFile(); if (array[0].equals("H") || array[0].equals("T")) { return false; } else { StoreF.setRetailID(array[1].replaceAll("/", "")); StoreF.setChain(array[2].replaceAll("/","")); StoreF.setStoreID(array[3].replaceAll("/", "")); StoreF.setStoreName(array[4].replaceAll("/", "")); StoreF.setAddress1(array[5].replaceAll("/", "")); StoreF.setAddress2(array[6].replaceAll("/", "")); StoreF.setAddress3(array[7].replaceAll("/", "")); StoreF.setProvince(array[8].replaceAll("/", "")); StoreF.setAddress4(array[9].replaceAll("/", "")); StoreF.setCountry(array[10].replaceAll("/", "")); StoreF.setCurrency(array[11].replaceAll("/", "")); StoreF.setAddress5(array[12].replaceAll("/", "")); StoreF.setTelNo(array[13].replaceAll("/", "")); //Add stores to list storeList.add(StoreF); } } //print list stores in file printStoreList(storeList); executeStoredPro(storeList); } catch (Exception ex) { nmtbatchservice.NMTBatchService2.LOG.error("An exception accoured: " + ex.getMessage(), ex); //copy to error folder //email } return false; } public void printStoreList(List<StoreFile> storeListToPrint) { for(int i = 0; i <storeListToPrint.size();i++){ System.out.println( storeListToPrint.get(i).getRetailID() + storeListToPrint.get(i).getChain() + storeListToPrint.get(i).getStoreID() + storeListToPrint.get(i).getStoreName() + storeListToPrint.get(i).getAddress1() + storeListToPrint.get(i).getAddress2() + storeListToPrint.get(i).getAddress3() + storeListToPrint.get(i).getProvince() + storeListToPrint.get(i).getAddress4() + storeListToPrint.get(i).getCountry() + storeListToPrint.get(i).getCurrency() + storeListToPrint.get(i).getAddress5() + storeListToPrint.get(i).getTelNo()); } } public void unzip(String source, String destination) { try { ZipFile zipFile = new ZipFile(source); zipFile.extractAll(destination); deleteStoreFile(source); } catch (ZipException ex) { nmtbatchservice.NMTBatchService2.LOG.error("Error unzipping file : " + ex.getMessage(), ex); } } public void deleteStoreFile(String directory) { try { File file = new File(directory); file.delete(); } catch (Exception ex) { nmtbatchservice.NMTBatchService2.LOG.error("An exception accoured when trying to delete file " + directory + " : " + ex.getMessage(), ex); } } public void executeStoredPro(List<StoreFile> storeListToInsert) { Connection con = null; CallableStatement st = null; try { String connectionURL = MSSQLConnectionURL; Class.forName("com.microsoft.sqlserver.jdbc.SQLServerDriver").newInstance(); con = DriverManager.getConnection(connectionURL, MSSQLUsername, MSSQLPassword); for(int i = 0; i <storeListToInsert.size();i++){ st = con.prepareCall( "IF EXISTS (SELECT * FROM tblPay@RetailStores WHERE StoreID = " + storeListToInsert.get(i).getStoreID() + " AND RetailID = "+ storeListToInsert.get(i).getRetailID() + ")" + " UPDATE tblPay@RetailStores " + " SET RetailID = '" + storeListToInsert.get(i).getRetailID() + "'," + " StoreID = '" + storeListToInsert.get(i).getStoreID() + "'," + " StoreName = '" + storeListToInsert.get(i).getStoreName() + "'," + " TestStore = 0," + " Address1 = '" + storeListToInsert.get(i).getAddress1() + "'," + " Address2 = '" + storeListToInsert.get(i).getAddress2() + "'," + " Address3 = '" + storeListToInsert.get(i).getAddress3() + "'," + " Address4 = '" + storeListToInsert.get(i).getAddress4() + "'," + " Address5 = '" + storeListToInsert.get(i).getAddress5() + "'," + " Province = '" + storeListToInsert.get(i).getProvince() + "'," + " TelNo = '" + storeListToInsert.get(i).getTelNo() + "'," + " Enabled = 1" + " ELSE " + " INSERT INTO tblPay@RetailStores ( [RetailID], [StoreID], [StoreName], [TestStore], [Address1], [Address2], [Address3], [Address4], [Address5], [Province], [TelNo] , [Enabled] ) " + " VALUES " + "('" + storeListToInsert.get(i).getRetailID() + "'," + "'" + storeListToInsert.get(i).getStoreID() + "'," + "'" + storeListToInsert.get(i).getStoreName() + "'," + "0," + "'" + storeListToInsert.get(i).getAddress1() + "'," + "'" + storeListToInsert.get(i).getAddress2() + "'," + "'" + storeListToInsert.get(i).getAddress3() + "'," + "'" + storeListToInsert.get(i).getAddress4() + "'," + "'" + storeListToInsert.get(i).getAddress5() + "'," + "'" + storeListToInsert.get(i).getProvince() + "'," + "'" + storeListToInsert.get(i).getTelNo() + "'," + "1)"); st.executeUpdate(); } con.close(); } catch (Exception ex) { nmtbatchservice.NMTBatchService2.LOG.error("Error executing Stored proc with error : " + ex.getMessage(), ex); nmtbatchservice.NMTBatchService2.mailingQueue.addToQueue(new Mail("[email protected]", "Service Email Error", "An error occurred during Store Import failed with error : " + ex.getMessage())); } } Any advise would be appreciated. Thanks

    Read the article

  • OBJ model loaded in LWJGL has a black area with no texture

    - by gambiting
    I have a problem with loading an .obj file in LWJGL and its textures. The object is a tree(it's a paid model from TurboSquid, so I can't post it here,but here's the link if you want to see how it should look like): http://www.turbosquid.com/FullPreview/Index.cfm/ID/701294 I wrote a custom OBJ loader using the LWJGL tutorial from their wiki. It looks like this: public class OBJLoader { public static Model loadModel(File f) throws FileNotFoundException, IOException { BufferedReader reader = new BufferedReader(new FileReader(f)); Model m = new Model(); String line; Texture currentTexture = null; while((line=reader.readLine()) != null) { if(line.startsWith("v ")) { float x = Float.valueOf(line.split(" ")[1]); float y = Float.valueOf(line.split(" ")[2]); float z = Float.valueOf(line.split(" ")[3]); m.verticies.add(new Vector3f(x,y,z)); }else if(line.startsWith("vn ")) { float x = Float.valueOf(line.split(" ")[1]); float y = Float.valueOf(line.split(" ")[2]); float z = Float.valueOf(line.split(" ")[3]); m.normals.add(new Vector3f(x,y,z)); }else if(line.startsWith("vt ")) { float x = Float.valueOf(line.split(" ")[1]); float y = Float.valueOf(line.split(" ")[2]); m.texVerticies.add(new Vector2f(x,y)); }else if(line.startsWith("f ")) { Vector3f vertexIndicies = new Vector3f(Float.valueOf(line.split(" ")[1].split("/")[0]), Float.valueOf(line.split(" ")[2].split("/")[0]), Float.valueOf(line.split(" ")[3].split("/")[0])); Vector3f textureIndicies = new Vector3f(Float.valueOf(line.split(" ")[1].split("/")[1]), Float.valueOf(line.split(" ")[2].split("/")[1]), Float.valueOf(line.split(" ")[3].split("/")[1])); Vector3f normalIndicies = new Vector3f(Float.valueOf(line.split(" ")[1].split("/")[2]), Float.valueOf(line.split(" ")[2].split("/")[2]), Float.valueOf(line.split(" ")[3].split("/")[2])); m.faces.add(new Face(vertexIndicies,textureIndicies,normalIndicies,currentTexture.getTextureID())); }else if(line.startsWith("g ")) { if(line.length()>2) { String name = line.split(" ")[1]; currentTexture = TextureLoader.getTexture("PNG", ResourceLoader.getResourceAsStream("res/" + name + ".png")); System.out.println(currentTexture.getTextureID()); } } } reader.close(); System.out.println(m.verticies.size() + " verticies"); System.out.println(m.normals.size() + " normals"); System.out.println(m.texVerticies.size() + " texture coordinates"); System.out.println(m.faces.size() + " faces"); return m; } } Then I create a display list for my model using this code: objectDisplayList = GL11.glGenLists(1); GL11.glNewList(objectDisplayList, GL11.GL_COMPILE); Model m = null; try { m = OBJLoader.loadModel(new File("res/untitled4.obj")); } catch (Exception e1) { e1.printStackTrace(); } int currentTexture=0; for(Face face: m.faces) { if(face.texture!=currentTexture) { currentTexture = face.texture; GL11.glBindTexture(GL11.GL_TEXTURE_2D, currentTexture); } GL11.glColor3f(1f, 1f, 1f); GL11.glBegin(GL11.GL_TRIANGLES); Vector3f n1 = m.normals.get((int) face.normal.x - 1); GL11.glNormal3f(n1.x, n1.y, n1.z); Vector2f t1 = m.texVerticies.get((int) face.textures.x -1); GL11.glTexCoord2f(t1.x, t1.y); Vector3f v1 = m.verticies.get((int) face.vertex.x - 1); GL11.glVertex3f(v1.x, v1.y, v1.z); Vector3f n2 = m.normals.get((int) face.normal.y - 1); GL11.glNormal3f(n2.x, n2.y, n2.z); Vector2f t2 = m.texVerticies.get((int) face.textures.y -1); GL11.glTexCoord2f(t2.x, t2.y); Vector3f v2 = m.verticies.get((int) face.vertex.y - 1); GL11.glVertex3f(v2.x, v2.y, v2.z); Vector3f n3 = m.normals.get((int) face.normal.z - 1); GL11.glNormal3f(n3.x, n3.y, n3.z); Vector2f t3 = m.texVerticies.get((int) face.textures.z -1); GL11.glTexCoord2f(t3.x, t3.y); Vector3f v3 = m.verticies.get((int) face.vertex.z - 1); GL11.glVertex3f(v3.x, v3.y, v3.z); GL11.glEnd(); } GL11.glEndList(); The currentTexture is an int - it contains the ID of the currently used texture. So my model looks absolutely fine without textures: (sorry I cannot post hyperlinks since I am a new user) i.imgur.com/VtoK0.png But look what happens if I enable GL_TEXTURE_2D: i.imgur.com/z8Kli.png i.imgur.com/5e9nn.png i.imgur.com/FAHM9.png As you can see an entire side of the tree appears to be missing - and it's not transparent, since it's not in the colour of the background - it's rendered black. It's not a problem with the model - if I load it using Kanji's OBJ loader it works fine(but the thing is,that I need to write my own OBJ loader) i.imgur.com/YDATo.png this is my OpenGL init section: //init display try { Display.setDisplayMode(new DisplayMode(Support.SCREEN_WIDTH, Support.SCREEN_HEIGHT)); Display.create(); Display.setVSyncEnabled(true); } catch (LWJGLException e) { e.printStackTrace(); System.exit(0); } GL11.glLoadIdentity(); GL11.glEnable(GL11.GL_TEXTURE_2D); GL11.glClearColor(1.0f, 0.0f, 0.0f, 1.0f); GL11.glShadeModel(GL11.GL_SMOOTH); GL11.glEnable(GL11.GL_DEPTH_TEST); GL11.glDepthFunc(GL11.GL_LESS); GL11.glDepthMask(true); GL11.glEnable(GL11.GL_NORMALIZE); GL11.glMatrixMode(GL11.GL_PROJECTION); GLU.gluPerspective (90.0f,800f/600f, 1f, 500.0f); GL11.glMatrixMode(GL11.GL_MODELVIEW); GL11.glEnable(GL11.GL_CULL_FACE); GL11.glCullFace(GL11.GL_BACK); //enable lighting GL11.glEnable(GL11.GL_LIGHTING); ByteBuffer temp = ByteBuffer.allocateDirect(16); temp.order(ByteOrder.nativeOrder()); GL11.glMaterial(GL11.GL_FRONT, GL11.GL_DIFFUSE, (FloatBuffer)temp.asFloatBuffer().put(lightDiffuse).flip()); GL11.glMaterialf(GL11.GL_FRONT, GL11.GL_SHININESS,(int)material_shinyness); GL11.glLight(GL11.GL_LIGHT2, GL11.GL_DIFFUSE, (FloatBuffer)temp.asFloatBuffer().put(lightDiffuse2).flip()); // Setup The Diffuse Light GL11.glLight(GL11.GL_LIGHT2, GL11.GL_POSITION,(FloatBuffer)temp.asFloatBuffer().put(lightPosition2).flip()); GL11.glLight(GL11.GL_LIGHT2, GL11.GL_AMBIENT,(FloatBuffer)temp.asFloatBuffer().put(lightAmbient).flip()); GL11.glLight(GL11.GL_LIGHT2, GL11.GL_SPECULAR,(FloatBuffer)temp.asFloatBuffer().put(lightDiffuse2).flip()); GL11.glLightf(GL11.GL_LIGHT2, GL11.GL_CONSTANT_ATTENUATION, 0.1f); GL11.glLightf(GL11.GL_LIGHT2, GL11.GL_LINEAR_ATTENUATION, 0.0f); GL11.glLightf(GL11.GL_LIGHT2, GL11.GL_QUADRATIC_ATTENUATION, 0.0f); GL11.glEnable(GL11.GL_LIGHT2); Could somebody please help me?

    Read the article

  • The Clocks on USACO

    - by philip
    I submitted my code for a question on USACO titled "The Clocks". This is the link to the question: http://ace.delos.com/usacoprob2?a=wj7UqN4l7zk&S=clocks This is the output: Compiling... Compile: OK Executing... Test 1: TEST OK [0.173 secs, 13928 KB] Test 2: TEST OK [0.130 secs, 13928 KB] Test 3: TEST OK [0.583 secs, 13928 KB] Test 4: TEST OK [0.965 secs, 13928 KB] Run 5: Execution error: Your program (`clocks') used more than the allotted runtime of 1 seconds (it ended or was stopped at 1.584 seconds) when presented with test case 5. It used 13928 KB of memory. ------ Data for Run 5 ------ 6 12 12 12 12 12 12 12 12 ---------------------------- Your program printed data to stdout. Here is the data: ------------------- time:_0.40928452 ------------------- Test 5: RUNTIME 1.5841 (13928 KB) I wrote my program so that it will print out the time taken (in seconds) for the program to complete before it exits. As can be seen, it took 0.40928452 seconds before exiting. So how the heck did the runtime end up to be 1.584 seconds? What should I do about it? This is the code if it helps: import java.io.; import java.util.; class clocks { public static void main(String[] args) throws IOException { long start = System.nanoTime(); // Use BufferedReader rather than RandomAccessFile; it's much faster BufferedReader f = new BufferedReader(new FileReader("clocks.in")); // input file name goes above PrintWriter out = new PrintWriter(new BufferedWriter(new FileWriter("clocks.out"))); // Use StringTokenizer vs. readLine/split -- lots faster int[] clock = new int[9]; for (int i = 0; i < 3; i++) { StringTokenizer st = new StringTokenizer(f.readLine()); // Get line, break into tokens clock[i * 3] = Integer.parseInt(st.nextToken()); clock[i * 3 + 1] = Integer.parseInt(st.nextToken()); clock[i * 3 + 2] = Integer.parseInt(st.nextToken()); } ArrayList validCombination = new ArrayList();; for (int i = 1; true; i++) { ArrayList combination = getPossibleCombinations(i); for (int j = 0; j < combination.size(); j++) { if (tryCombination(clock, (int[]) combination.get(j))) { validCombination.add(combination.get(j)); } } if (validCombination.size() > 0) { break; } } int [] min = (int[])validCombination.get(0); if (validCombination.size() > 1){ String minS = ""; for (int i=0; i<min.length; i++) minS += min[i]; for (int i=1; i<validCombination.size(); i++){ String tempS = ""; int [] temp = (int[])validCombination.get(i); for (int j=0; j<temp.length; j++) tempS += temp[j]; if (tempS.compareTo(minS) < 0){ minS = tempS; min = temp; } } } for (int i=0; i<min.length-1; i++) out.print(min[i] + " "); out.println(min[min.length-1]); out.close(); // close the output file long end = System.nanoTime(); System.out.println("time: " + (end-start)/1000000000.0); System.exit(0); // don't omit this! } static boolean tryCombination(int[] clock, int[] steps) { int[] temp = Arrays.copyOf(clock, clock.length); for (int i = 0; i < steps.length; i++) transform(temp, steps[i]); for (int i=0; i<temp.length; i++) if (temp[i] != 12) return false; return true; } static void transform(int[] clock, int n) { if (n == 1) { int[] clocksToChange = {0, 1, 3, 4}; add3(clock, clocksToChange); } else if (n == 2) { int[] clocksToChange = {0, 1, 2}; add3(clock, clocksToChange); } else if (n == 3) { int[] clocksToChange = {1, 2, 4, 5}; add3(clock, clocksToChange); } else if (n == 4) { int[] clocksToChange = {0, 3, 6}; add3(clock, clocksToChange); } else if (n == 5) { int[] clocksToChange = {1, 3, 4, 5, 7}; add3(clock, clocksToChange); } else if (n == 6) { int[] clocksToChange = {2, 5, 8}; add3(clock, clocksToChange); } else if (n == 7) { int[] clocksToChange = {3, 4, 6, 7}; add3(clock, clocksToChange); } else if (n == 8) { int[] clocksToChange = {6, 7, 8}; add3(clock, clocksToChange); } else if (n == 9) { int[] clocksToChange = {4, 5, 7, 8}; add3(clock, clocksToChange); } } static void add3(int[] clock, int[] position) { for (int i = 0; i < position.length; i++) { if (clock[position[i]] != 12) { clock[position[i]] += 3; } else { clock[position[i]] = 3; } } } static ArrayList getPossibleCombinations(int size) { ArrayList l = new ArrayList(); int[] current = new int[size]; for (int i = 0; i < current.length; i++) { current[i] = 1; } int[] end = new int[size]; for (int i = 0; i < end.length; i++) { end[i] = 9; } l.add(Arrays.copyOf(current, size)); while (!Arrays.equals(current, end)) { incrementWithoutRepetition(current, current.length - 1); l.add(Arrays.copyOf(current, size)); } int [][] combination = new int[l.size()][size]; for (int i=0; i<l.size(); i++) combination[i] = (int[])l.get(i); return l; } static int incrementWithoutRepetition(int[] n, int index) { if (n[index] != 9) { n[index]++; return n[index]; } else { n[index] = incrementWithoutRepetition(n, index - 1); return n[index]; } } static void p(int[] n) { for (int i = 0; i < n.length; i++) { System.out.print(n[i] + " "); } System.out.println(""); } }

    Read the article

  • Optimizing a lot of Scanner.findWithinHorizon(pattern, 0) calls

    - by darvids0n
    I'm building a process which extracts data from 6 csv-style files and two poorly laid out .txt reports and builds output CSVs, and I'm fully aware that there's going to be some overhead searching through all that whitespace thousands of times, but I never anticipated converting about about 50,000 records would take 12 hours. Excerpt of my manual matching code (I know it's horrible that I use lists of tokens like that, but it was the best thing I could think of): public static String lookup(List<String> tokensBefore, List<String> tokensAfter) { String result = null; while(_match(tokensBefore)) { // block until all input is read if(id.hasNext()) { result = id.next(); // capture the next token that matches if(_matchImmediate(tokensAfter)) // try to match tokensAfter to this result return result; } else return null; // end of file; no match } return null; // no matches } private static boolean _match(List<String> tokens) { return _match(tokens, true); } private static boolean _match(List<String> tokens, boolean block) { if(tokens != null && !tokens.isEmpty()) { if(id.findWithinHorizon(tokens.get(0), 0) == null) return false; for(int i = 1; i <= tokens.size(); i++) { if (i == tokens.size()) { // matches all tokens return true; } else if(id.hasNext() && !id.next().matches(tokens.get(i))) { break; // break to blocking behaviour } } } else { return true; // empty list always matches } if(block) return _match(tokens); // loop until we find something or nothing else return false; // return after just one attempted match } private static boolean _matchImmediate(List<String> tokens) { if(tokens != null) { for(int i = 0; i <= tokens.size(); i++) { if (i == tokens.size()) { // matches all tokens return true; } else if(!id.hasNext() || !id.next().matches(tokens.get(i))) { return false; // doesn't match, or end of file } } return false; // we have some serious problems if this ever gets called } else { return true; // empty list always matches } } Basically wondering how I would work in an efficient string search (Boyer-Moore or similar). My Scanner id is scanning a java.util.String, figured buffering it to memory would reduce I/O since the search here is being performed thousands of times on a relatively small file. The performance increase compared to scanning a BufferedReader(FileReader(File)) was probably less than 1%, the process still looks to be taking a LONG time. I've also traced execution and the slowness of my overall conversion process is definitely between the first and last like of the lookup method. In fact, so much so that I ran a shortcut process to count the number of occurrences of various identifiers in the .csv-style files (I use 2 lookup methods, this is just one of them) and the process completed indexing approx 4 different identifiers for 50,000 records in less than a minute. Compared to 12 hours, that's instant. Some notes (updated): I don't necessarily need the pattern-matching behaviour, I only get the first field of a line of text so I need to match line breaks or use Scanner.nextLine(). All ID numbers I need start at position 0 of a line and run through til the first block of whitespace, after which is the name of the corresponding object. I would ideally want to return a String, not an int locating the line number or start position of the result, but if it's faster then it will still work just fine. If an int is being returned, however, then I would now have to seek to that line again just to get the ID; storing the ID of every line that is searched sounds like a way around that. Anything to help me out, even if it saves 1ms per search, will help, so all input is appreciated. Thankyou! Usage scenario 1: I have a list of objects in file A, who in the old-style system have an id number which is not in file A. It is, however, POSSIBLY in another csv-style file (file B) or possibly still in a .txt report (file C) which each also contain a bunch of other information which is not useful here, and so file B needs to be searched through for the object's full name (1 token since it would reside within the second column of any given line), and then the first column should be the ID number. If that doesn't work, we then have to split the search token by whitespace into separate tokens before doing a search of file C for those tokens as well. Generalised code: String field; for (/* each record in file A */) { /* construct the rest of this object from file A info */ // now to find the ID, if we can List<String> objectName = new ArrayList<String>(1); objectName.add(Pattern.quote(thisObject.fullName)); field = lookup(objectSearchToken, objectName); // search file B if(field == null) // not found in file B { lookupReset(false); // initialise scanner to check file C objectName.clear(); // not using the full name String[] tokens = thisObject.fullName.split(id.delimiter().pattern()); for(String s : tokens) objectName.add(Pattern.quote(s)); field = lookup(objectSearchToken, objectName); // search file C lookupReset(true); // back to file B } else { /* found it, file B specific processing here */ } if(field != null) // found it in B or C thisObject.ID = field; } The objectName tokens are all uppercase words with possible hyphens or apostrophes in them, separated by spaces. Much like a person's name. As per a comment, I will pre-compile the regex for my objectSearchToken, which is just [\r\n]+. What's ending up happening in file C is, every single line is being checked, even the 95% of lines which don't contain an ID number and object name at the start. Would it be quicker to use ^[\r\n]+.*(objectname) instead of two separate regexes? It may reduce the number of _match executions. The more general case of that would be, concatenate all tokensBefore with all tokensAfter, and put a .* in the middle. It would need to be matching backwards through the file though, otherwise it would match the correct line but with a huge .* block in the middle with lots of lines. The above situation could be resolved if I could get java.util.Scanner to return the token previous to the current one after a call to findWithinHorizon. I have another usage scenario. Will put it up asap.

    Read the article

  • Traditional IO vs memory-mapped

    - by Senne
    I'm trying to illustrate the difference in performance between traditional IO and memory mapped files in java to students. I found an example somewhere on internet but not everything is clear to me, I don't even think all steps are nececery. I read a lot about it here and there but I'm not convinced about a correct implementation of neither of them. The code I try to understand is: public class FileCopy{ public static void main(String args[]){ if (args.length < 1){ System.out.println(" Wrong usage!"); System.out.println(" Correct usage is : java FileCopy <large file with full path>"); System.exit(0); } String inFileName = args[0]; File inFile = new File(inFileName); if (inFile.exists() != true){ System.out.println(inFileName + " does not exist!"); System.exit(0); } try{ new FileCopy().memoryMappedCopy(inFileName, inFileName+".new" ); new FileCopy().customBufferedCopy(inFileName, inFileName+".new1"); }catch(FileNotFoundException fne){ fne.printStackTrace(); }catch(IOException ioe){ ioe.printStackTrace(); }catch (Exception e){ e.printStackTrace(); } } public void memoryMappedCopy(String fromFile, String toFile ) throws Exception{ long timeIn = new Date().getTime(); // read input file RandomAccessFile rafIn = new RandomAccessFile(fromFile, "rw"); FileChannel fcIn = rafIn.getChannel(); ByteBuffer byteBuffIn = fcIn.map(FileChannel.MapMode.READ_WRITE, 0,(int) fcIn.size()); fcIn.read(byteBuffIn); byteBuffIn.flip(); RandomAccessFile rafOut = new RandomAccessFile(toFile, "rw"); FileChannel fcOut = rafOut.getChannel(); ByteBuffer writeMap = fcOut.map(FileChannel.MapMode.READ_WRITE,0,(int) fcIn.size()); writeMap.put(byteBuffIn); long timeOut = new Date().getTime(); System.out.println("Memory mapped copy Time for a file of size :" + (int) fcIn.size() +" is "+(timeOut-timeIn)); fcOut.close(); fcIn.close(); } static final int CHUNK_SIZE = 100000; static final char[] inChars = new char[CHUNK_SIZE]; public static void customBufferedCopy(String fromFile, String toFile) throws IOException{ long timeIn = new Date().getTime(); Reader in = new FileReader(fromFile); Writer out = new FileWriter(toFile); while (true) { synchronized (inChars) { int amountRead = in.read(inChars); if (amountRead == -1) { break; } out.write(inChars, 0, amountRead); } } long timeOut = new Date().getTime(); System.out.println("Custom buffered copy Time for a file of size :" + (int) new File(fromFile).length() +" is "+(timeOut-timeIn)); in.close(); out.close(); } } When exactly is it nececary to use RandomAccessFile? Here it is used to read and write in the memoryMappedCopy, is it actually nececary just to copy a file at all? Or is it a part of memorry mapping? In customBufferedCopy, why is synchronized used here? I also found a different example that -should- test the performance between the 2: public class MappedIO { private static int numOfInts = 4000000; private static int numOfUbuffInts = 200000; private abstract static class Tester { private String name; public Tester(String name) { this.name = name; } public long runTest() { System.out.print(name + ": "); try { long startTime = System.currentTimeMillis(); test(); long endTime = System.currentTimeMillis(); return (endTime - startTime); } catch (IOException e) { throw new RuntimeException(e); } } public abstract void test() throws IOException; } private static Tester[] tests = { new Tester("Stream Write") { public void test() throws IOException { DataOutputStream dos = new DataOutputStream( new BufferedOutputStream( new FileOutputStream(new File("temp.tmp")))); for(int i = 0; i < numOfInts; i++) dos.writeInt(i); dos.close(); } }, new Tester("Mapped Write") { public void test() throws IOException { FileChannel fc = new RandomAccessFile("temp.tmp", "rw") .getChannel(); IntBuffer ib = fc.map( FileChannel.MapMode.READ_WRITE, 0, fc.size()) .asIntBuffer(); for(int i = 0; i < numOfInts; i++) ib.put(i); fc.close(); } }, new Tester("Stream Read") { public void test() throws IOException { DataInputStream dis = new DataInputStream( new BufferedInputStream( new FileInputStream("temp.tmp"))); for(int i = 0; i < numOfInts; i++) dis.readInt(); dis.close(); } }, new Tester("Mapped Read") { public void test() throws IOException { FileChannel fc = new FileInputStream( new File("temp.tmp")).getChannel(); IntBuffer ib = fc.map( FileChannel.MapMode.READ_ONLY, 0, fc.size()) .asIntBuffer(); while(ib.hasRemaining()) ib.get(); fc.close(); } }, new Tester("Stream Read/Write") { public void test() throws IOException { RandomAccessFile raf = new RandomAccessFile( new File("temp.tmp"), "rw"); raf.writeInt(1); for(int i = 0; i < numOfUbuffInts; i++) { raf.seek(raf.length() - 4); raf.writeInt(raf.readInt()); } raf.close(); } }, new Tester("Mapped Read/Write") { public void test() throws IOException { FileChannel fc = new RandomAccessFile( new File("temp.tmp"), "rw").getChannel(); IntBuffer ib = fc.map( FileChannel.MapMode.READ_WRITE, 0, fc.size()) .asIntBuffer(); ib.put(0); for(int i = 1; i < numOfUbuffInts; i++) ib.put(ib.get(i - 1)); fc.close(); } } }; public static void main(String[] args) { for(int i = 0; i < tests.length; i++) System.out.println(tests[i].runTest()); } } I more or less see whats going on, my output looks like this: Stream Write: 653 Mapped Write: 51 Stream Read: 651 Mapped Read: 40 Stream Read/Write: 14481 Mapped Read/Write: 6 What is makeing the Stream Read/Write so unbelievably long? And as a read/write test, to me it looks a bit pointless to read the same integer over and over (if I understand well what's going on in the Stream Read/Write) Wouldn't it be better to read int's from the previously written file and just read and write ints on the same place? Is there a better way to illustrate it? I've been breaking my head about a lot of these things for a while and I just can't get the whole picture..

    Read the article

  • Trouble calling a method from an external class

    - by Bradley Hobbs
    Here is my employee database program: import java.util.*; import java.io.*; import java.io.File; import java.io.FileReader; import java.util.ArrayList; public class P { //Instance Variables private static String empName; private static String wage; private static double wages; private static double salary; private static double numHours; private static double increase; // static ArrayList<String> ARempName = new ArrayList<String>(); // static ArrayList<Double> ARwages = new ArrayList<Double>(); // static ArrayList<Double> ARsalary = new ArrayList<Double>(); static ArrayList<Employee> emp = new ArrayList<Employee>(); public static void main(String[] args) throws Exception { clearScreen(); printMenu(); question(); exit(); } public static void printArrayList(ArrayList<Employee> emp) { for (int i = 0; i < emp.size(); i++){ System.out.println(emp.get(i)); } } public static void clearScreen() { System.out.println("\u001b[H\u001b[2J"); } private static void exit() { System.exit(0); } private static void printMenu() { System.out.println("\t------------------------------------"); System.out.println("\t|Commands: n - New employee |"); System.out.println("\t| c - Compute paychecks |"); System.out.println("\t| r - Raise wages |"); System.out.println("\t| p - Print records |"); System.out.println("\t| d - Download data |"); System.out.println("\t| u - Upload data |"); System.out.println("\t| q - Quit |"); System.out.println("\t------------------------------------"); System.out.println(""); } public static void question() { System.out.print("Enter command: "); Scanner q = new Scanner(System.in); String input = q.nextLine(); input.replaceAll("\\s","").toLowerCase(); boolean valid = (input.equals("n") || input.equals("c") || input.equals("r") || input.equals("p") || input.equals("d") || input.equals("u") || input.equals("q")); if (!valid){ System.out.println("Command was not recognized; please try again."); printMenu(); question(); } else if (input.equals("n")){ System.out.print("Enter the name of new employee: "); Scanner stdin = new Scanner(System.in); empName = stdin.nextLine(); System.out.print("Hourly (h) or salaried (s): "); Scanner stdin2 = new Scanner(System.in); wage = stdin2.nextLine(); wage.replaceAll("\\s","").toLowerCase(); if (!(wage.equals("h") || wage.equals("s"))){ System.out.println("Input was not h or s; please try again"); } else if (wage.equals("h")){ System.out.print("Enter hourly wage: "); Scanner stdin4 = new Scanner(System.in); wages = stdin4.nextDouble(); Employee emp1 = new HourlyEmployee(empName, wages); emp.add(emp1); printMenu(); question();} else if (wage.equals("s")){ System.out.print("Enter annual salary: "); Scanner stdin5 = new Scanner(System.in); salary = stdin5.nextDouble(); Employee emp1 = new SalariedEmployee(empName, salary); printMenu(); question();}} else if (input.equals("c")){ for (int i = 0; i < emp.size(); i++){ System.out.println("Enter number of hours worked by " + emp.get(i) + ":"); } Scanner stdin = new Scanner(System.in); numHours = stdin.nextInt(); System.out.println("Pay: " + emp1.computePay(numHours)); System.out.print("Enter number of hours worked by " + empName); Scanner stdin2 = new Scanner(System.in); numHours = stdin2.nextInt(); System.out.println("Pay: " + emp1.computePay(numHours)); printMenu(); question();} else if (input.equals("r")){ System.out.print("Enter percentage increase: "); Scanner stdin = new Scanner(System.in); increase = stdin.nextDouble(); System.out.println("\nNew Wages"); System.out.println("---------"); // System.out.println(Employee.toString()); printMenu(); question(); } else if (input.equals("p")){ printArrayList(emp); printMenu(); question(); } else if (input.equals("q")){ exit(); } } } Here is one of the class files: public abstract class Employee { private String name; private double wage; protected Employee(String name, double wage){ this.name = name; this.wage = wage; } public String getName() { return name; } public double getWage() { return wage; } public void setName(String name) { this.name = name; } public void setWage(double wage) { this.wage = wage; } public void percent(double wage, double percent) { wage *= percent; } } And here are the errors: P.java:108: cannot find symbol symbol : variable emp1 location: class P System.out.println("Pay: " + emp1.computePay(numHours)); ^ P.java:112: cannot find symbol symbol : variable emp1 location: class P System.out.println("Pay: " + emp1.computePay(numHours)); ^ 2 errors I'm trying to the get paycheck to print out but i'm having trouble with how to call the method. It should take the user inputed numHours and calculate it then print on the paycheck for each employee. Thanks!

    Read the article

< Previous Page | 3 4 5 6 7