Search Results

Search found 1388 results on 56 pages for 'ravi kumar singh'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 7/56 | < Previous Page | 3 4 5 6 7 8 9 10 11 12 13 14  | Next Page >

  • generate all subsets of size k from a set

    - by Kumar
    hi, i want to generate all the subsets of size k from a set. eg:-say i have a set of 6 elements, i have to list all the subsets in which the cardinality of elements is 3. I tried looking for solution,but those are code snippets. Its been long since I have done coding,so I find it hard to understand the code and construct a executable program around it. A complete executable program in C or C++ will be quite helpful. Hoping of an optimal solution using recursion. Thanks in advance. Kumar.

    Read the article

  • A Multi-Channel Contact Center Can Reduce Total Cost of Ownership

    - by Tom Floodeen
    In order to remain competitive in today’s market, CRM customers need to provide feature-rich superior call center experience to their customers across all communication channels while improving their service agent productivity. They also require their call center to be deeply integrated with their CRM system; and they need to implement all this quickly, seamlessly, and without breaking the bank. Oracle’s Siebel Customer Relationship Management (CRM) is the world’s leading application suite for automated customer-facing operations for Sales and Marketing and for managing all aspects of providing service to customers. Oracle’s Contact On Demand (COD) is a world-class carrier grade hosted multi-channel contact center solution that can be deployed in days without up-front capital expenditures or integration costs. Agents can work efficiently from anywhere in the world with 360-degree views into customer interactions and real-time business intelligence. Customers gain from rapid and personalized sales and service, while organizations can dramatically reduce costs and increase revenues Oracle’s latest update of Siebel CRM now comes pre-integrated with Oracle’s Contact On Demand. This solution seamlessly runs fully-functional contact center provided by a single vendor, significantly reducing your total cost of ownership. This solution supports Siebel 7.8 and higher for Voice and Siebel 8.1 and higher for Voice and Siebel CRM Chat.  The impressive feature list of Oracle’s COD solution includes full-control CTI toolbar with Voice, Chat, and Click to Dial features.  It also includes context-sensitive screens, automated desktops, built-in IVR, Multidimensional routing, Supervisor and Quality monitoring, and Instant Provisioning. The solution also ships with Extensible Web Services interface for implementing more complex business processes. Click here to learn how to reduce complexity and total cost of ownership of your contact center. Contact Ann Singh at [email protected] for additional information.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Cannot get Correct month for a call from call log history

    - by Nishant Kumar
    I am trying to extract information from the call log of the android. I am getting the call date that is one month back from the actual time of call. I mean to say that the information extracted by my code for the date of call is one mont back than the actual call date. I have the following in the Emulator: I saved a contact. Then I made a call to the contact. Code: I have 3 ways of extracting call Date information but getting the same wrong result. My code is as follows: /* Make the query to call log content */ Cursor callLogResult = context.getContentResolver().query( CallLog.Calls.CONTENT_URI, null, null, null, null); int columnIndex = callLogResult.getColumnIndex(Calls.DATE); Long timeInResult = callLogResult.getLong(columnIndex); /* Method 1 to change the milliseconds obtained to the readable date formate */ Time time = new Time(); time.toMillis(true); time.set(timeInResult); String callDate= time.monthDay+"-"+time.month+"-"+time.year; /* Method 2 for extracting the date from tha value read from the column */ Calendar calendar = Calendar.getInstance(); calendar.setTimeInMillis(time); String Month = calendar.get(Calendar.MONTH) ; /* Method 3 for extracting date from the result obtained */ Date date = new Date(timeInResult); String mont = date.getMonth() While using the Calendar method , I also tried to set the DayLight SAving Offset but it didnot worked, calendar.setTimeZone(TimeZone.getTimeZone("Europe/Paris")); int DST_OFFSET = calendar.get( Calendar.DST_OFFSET ); // DST_OFFSET Boolean isSet = calendar.getTimeZone().useDaylightTime(); if(isSet) calendar.set(Calendar.DST_OFFSET , 0); int reCheck = calendar.get(Calendar.DST_OFFSET ); But the value is not set to 0 in recheck. I am getting the wrong month value by using this also. Please some one help me where I am wrong? or is this the error in emulator ?? Thanks, Nishant Kumar Engineering Student

    Read the article

  • FMS NetConnection.Connect.Close happening when starts and even in the middle of video in Flash with

    - by Sunil Kumar
    Hi I have developed a Flash Video player in Flash CS3 with Action Script 2.0 to play video from Adobe Flash Media Server 3.5. To play video from FMS 3.5, first I have to verify my swf file on FMS 3.5 server console so that it can be ensure that RTMP video URL only be play in verified SWF file. Right now I am facing problem of "NetConnection.Connect.Close" when I try to connect my NetConnection Object to FMS 3.5 to stream video from that server. So now I am getting this message "NetConnection.Connect.Close" from FMS 3.5. When this is happening in my office area at the same time when I am checking the the same video url from out side the office (With help of my friends who is in another office) area it is working fine. My friends naver faced even a single issue with NetConnection.Connect.Close. But in my office when I got message NetConnection.Connect.Close, I can play another streaming video very well like mtv.com jaman.com rajshri.com etc. Some time FMS works fine and video starts playing but in the middle of the video same thing happen "NetConnection.Connect.Close" There is no issue of Bandwidth in my office. I do't know why this is happening. Please see the message when I am getting "NetConnection.Connect.Close" message. NetConn == data: NetConn == objectEncoding: 0 NetConn == description: Connection succeeded. NetConn == code: NetConnection.Connect.Success NetConn == level: status NetConn == level: status NetConn == code: NetConnection.Connect.Closed Please help Thanks & regards Sunil Kumar

    Read the article

  • which xml validator will work perfectly for multithreading project

    - by Sunil Kumar Sahoo
    Hi All, I have used jdom for xml validation against schema. The main problem there is that it gives an error FWK005 parse may not be called while parsing The main reason was that multiple of threads working for xerces validation at the same time. SO I got the solution that i have to lock that validation. which is not good So I want to know which xml validator works perfectly for multithreading project public static HashMap validate(String xmlString, Validator validator) { HashMap<String, String> map = new HashMap<String, String>(); long t1 = System.currentTimeMillis(); DocumentBuilder builder = null; try { //obtain lock to proceed // lock.lock(); try { builder = DocumentBuilderFactory.newInstance().newDocumentBuilder(); // Source source = new DOMSource(builder.parse(new ByteArrayInputStream(xmlString.getBytes()))); validator.validate(new StreamSource(new StringReader(xmlString))); map.put("ISVALID", "TRUE"); logger.info("We have successfuly validated the schema"); } catch (Exception ioe) { ioe.printStackTrace(); logger.error("NOT2 VALID STRING IS :" + xmlString); map.put("MSG", ioe.getMessage()); // logger.error("IOException while validating the input XML", ioe); } logger.info(map); long t2 = System.currentTimeMillis(); logger.info("XML VALIDATION TOOK:::" + (t2 - t1)); } catch (Exception e) { logger.error(e); } finally { //release lock // lock.unlock(); builder = null; } return map; } Thanks Sunil Kumar Sahoo

    Read the article

  • How to play .3gp videos in mobile using RTMP (FMS) and HTTP?

    - by Sunil Kumar
    Hi I am not able to play video on mobile device which is .3gp container and H.263 / AMR_NB encoded. I just want to play my website videos in mobile device also just like youtube.com. I want to use RTMP and HTTP both. My requirement is as follows- Which codec and container will be best? Should I use FLV to play video on mobile device? RTSP required or can be use RTMP? Is NetStream and NetConnection methods different from Flash Player in Flash Lite Player? How to play 3gp video using RTMP stream ie. ns.play(“mp4:mobilevideo.3gp”, 0, -1, true) is it ok or any thing else required? For mobile browser and computer browser, can I use single player or I have to make different player for computer browser and mobile browser? It would be better if I can do it with single player for both mobile and computer browser. Sample code required for testing. If you can. I got below article in which they mention that we can play video 3gp container in mobile also. Please find the article. Articles URL- http://www.hsharma.com/tech/articles/flash-lite-30-video-formats-and-video-volume/ http://www.adobe.com/devnet/logged_in/dmotamedi_fms3.html Thanks Sunil Kumar

    Read the article

  • android odbc connection

    - by Vijay Kumar
    i want to connect odbc connection for my android application. Here in my program i'm using oracle database 11g and my table name is sample. After i run the program close the emulator open the database the values could not be stored. Please give one solution or any changes in my program or connection string. package com.odbc; import java.sql.Connection; import java.sql.DriverManager; import java.sql.PreparedStatement; import android.app.Activity; import android.os.Bundle; public class OdbcActivity extends Activity { /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); String first="vijay"; String last="kumar"; try { DriverManager.registerDriver(new oracle.jdbc.driver.OracleDriver()); Connection con=DriverManager.getConnection("jdbc:oracle:thin:@localshot:1521:XE","system","vijay"); PreparedStatement pst=con.prepareStatement("insert into sample(first,last) values(?,?"); pst.setString(1,first); pst.setString(2,last); pst.executeUpdate(); } catch(Exception e) { System.out.println("Exception:"+e); } } }

    Read the article

  • Help regarding Android NDK

    - by Siva Kumar
    I am a beginner in using Android NDK. I am using Eclipse and I installed cygwin to build the c file to generate the .so file But while building the c file in cygwin I am always getting the error make: ***No rule to make target 'file.c' ... .Stop I tried building different C codes but for every file it says the same error .. Here is the source code: public class ndktest extends Activity { static { System.loadLibrary("ndkt"); } private native void helloLog(String logThis); @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); helloLog("this is to test log file"); } } file.c void Java_com_ndktest_helloLog(JNIEnv * env, jobject this, jstring logThis) { jboolean isCopy; const char * szLogThis = (*env)->GetStringUTFChars(env, logThis, &isCopy); (*env)->ReleaseStringUTFChars(env, logThis, szLogThis); } And here is my Android.mk LOCAL_PATH := $(call my-dir) include $(CLEAR_VARS) LOCAL_LDLIBS := -llog LOCAL_MODULE := ndkt LOCAL_SRC_FILES := file.c include $(BUILD_SHARED_LIBRARY) I searched for the solution for the cause of error ... but nothing works for me. Can anyone tell me where I am making the mistake ? Thanks, Siva Kumar

    Read the article

  • Lync CMS replication is failing for all Domain Computers

    - by Ravi Kanneganti
    I have Lync Server 2010 and Active Directory installed on 2 different Windows Server 2008 R2 machines. I have added a Windows 7 PC to AD. And I have added this computer to Trusted Application Servers Pool and published the topology. I want to build an UCMA application to extend Lync Server functionality. I have installed UCMA 3.0 SDK in the same computer where Lync Server is residing. But, CMS Replication isn't happening and "Get-CsManagementStoreReplicationStatus" always gives Uptodate as "False" for my Windows 7 PC. I have even tried "Invoke-CSManagementStoreReplication" but nothing changed. Also, this is the error message that I can see in the log file: TL_WARN(TF_COMPONENT) [2]0500.07B8::04/05/2012-14:55:07.296.00000f85 (XDS_Replica_Replicator,FileDistributeTask.Execute:filedistributetask.cs(165))(000000000043B3FA)**Could not distribute the file. Exception: [System.IO.IOException: The process cannot access the file because it is being used by another process.** at System.IO.__Error.WinIOError(Int32 errorCode, String maybeFullPath) at System.IO.File.Move(String sourceFileName, String destFileName) at Microsoft.Rtc.Xds.Replication.Replicator.Common.FileDistributeTask.Execute()]. TL_NOISE(TF_DIAG) [2]0500.07B8::04/05/2012-14:55:07.296.00000f86 (XDS_Replica_Replicator,ReplicaTaskContainer<T>.OnError:replicataskcontainer.cs(166))(00000000005C39D4)Enter. TL_INFO(TF_COMPONENT) [2]0500.07B8::04/05/2012-14:55:07.296.00000f87 (XDS_Replica_Replicator,ReplicaTaskContainer<T>.OnError:replicataskcontainer.cs(171))(00000000005C39D4)Task error callback is about to be called. TL_VERBOSE(TF_DIAG) [2]0500.07B8::04/05/2012-14:55:07.296.00000f88 (XDS_Replica_Replicator,PerReplicaTaskManager<T>.HandleTaskError:perreplicataskmanager.cs(230))(000000000385E79C)Enter. TL_INFO(TF_COMPONENT) [2]0500.07B8::04/05/2012-14:55:07.296.00000f89 (XDS_Replica_Replicator,PerReplicaTaskManager<T>.HandleTaskError:perreplicataskmanager.cs(234))(000000000385E79C)Task encountered an error: [ReplicaTaskContainer<FileDistributeTask>{FileDistributeTask{E:\RtcReplicaRoot\xds-replica\from-master\data.zip, E:\RtcReplicaRoot\xds-replica\working\replication\from-master\data.zip, **Access failed**. (E:\RtcReplicaRoot\xds-replica\from-master\data.zip)}, FileDistributeTask{E:\RtcReplicaRoot\xds-replica\from-master\data.zip, E:\RtcReplicaRoot\xds-replica\working\replication\from-master\data.zip, }}]

    Read the article

  • Get to know error and error codes of Mysqldump

    - by Ravi
    Hi I would like to back up our mysql database. We have huge records in the database. What are the errors can occur and possible while running mysqldump.? Mysql official site did not mention the specific error and error codes for mysqldump, They just commonly put the error and error codes. I am expecting some mysql expert can help me out. I would like to take some action in case any error happen for that I want know possible error and errocodes. Thank You

    Read the article

  • Losing windows XP files. How to retrieve them?

    - by ravi
    I have a portable 500 GB HDD.Since last few days, all files of some folder are getting kinda corrupted.I can't access/delete them. Here is the example. If I try to access these files/folders, I get following error. This thing is kinda spreading in my HDD.Till now it has affected two folders worth 70 GB.In which one folder is backup folder where all my important data resides.So I am really in loss if I loose this data. How can I retrieve this data? Please help.

    Read the article

  • Fully FOSS EMail solution

    - by Ravi
    I am looking at various FOSS options to build a robust EMail solution for a government funded university. Commercial options are to be chosen only in the worst case scenario. Here are the requirements: Approx 1000-1500 users - Postfix or Exim? (Sendmail is out;-)) Mailing lists for different groups/Need web based archive - Mailman? Sympa? Centralised identity store - OpenLDAP? Fedora 389DS? Secure IMAP only - no POP3 required - Courier? Dovecot? Cyrus?? Anti Spam - SpamAssasin? what else? Calendaring - ?? webmail - good to have, not mandatory - needs to be very secure...so squirrelmail is out;-)? Other questions: What mailbox storage format to use? where to store? database/file system? Simple and effective HA options? Is there a web proxy equivalent to squid in the mail server world? software load balancers?CARP? Monitoring and alert? Backup? The govt wants to stimulate the local economy by buying hardware locally from whitebox vendors. Also local consultants and university students will do the integration. We looked at out-of-the-box integrated solutions like Axigen, Zimbra and GMail but each was ruled out in favour of a DIY approach in the hopes of full control over the data and avoiding vendor lockin - which i though was a smart thing to do. I wish more provincial governments in the developing world think of these sort of initiatives As for OS - Debian, FreeBSD would be first preference. Commercial OS's need not apply. CentOS as second tier option...

    Read the article

  • ApplicationPool in IIS 7.5 crashes with identifty set to NetworkService

    - by Ravi
    We have a web application running on IIS 7.5 with the identity of the Custom Application Pool set to NetworkService. This was working fine for some days and now the application pool has gone in to a stopped state. The following error message is displayed in the Event Viewer Faulting application name: w3wp.exe, version: 7.5.7600.16385, time stamp: 0x4a5bcd2b Faulting module name: ntdll.dll, version: 6.1.7600.16559, time stamp: 0x4ba9b29c Exception code: 0xc0000005 Fault offset: 0x00038c19 Faulting process id: 0xa28 Faulting application start time: 0x01cbb2e5707aa2b2 Faulting application path: C:\Windows\SysWOW64\inetsrv\w3wp.exe Faulting module path: C:\Windows\SysWOW64\ntdll.dll Report Id: ae3f0610-1ed8-11e0-abf8-000c297f918f We are able to start the application pool only after changing the identity to LocalSystem. Why does the application pool fails to run with identity set to NetworkService. Can any one help us resolving this issue?

    Read the article

  • Hosted Exchange 2010 Send As

    - by Ravi
    I have a hosted exchange 2010 and I am trying to setup the Send-As permission. I am following http://technet.microsoft.com/en-us/library/bb676368.aspx which basically describes the commands for achieving this. I have user account aaa and bbb [PS] C:\Windows\system32get-mailbox -organization myorg -identity "aaa" Name Alias ServerName ProhibitSendQuota ---- ----- ---------- ----------------- aaa aaa mx1 4.95 GB (5,315,022,848 bytes) [PS] C:\Windows\system32get-mailbox -organization myorg-identity "bbb" Name Alias ServerName ProhibitSendQuota ---- ----- ---------- ----------------- bbb bbb mx1 4.95 GB (5,315,022,848 bytes) Now, when I use the command below to give bbb permission to send-as aaa, I get the following error: [PS] C:\Windows\system32get-mailbox -organization myorg -identity "aaa" | Add-ADPermission -Extended Rights "Send As" -user "bbb" mx1/Microsoft Exchange Hosted Organizations/myorg/aaa wasn't found. Please make sure you've typed it correctly. + CategoryInfo : InvalidArgument: (:) [Add-ADPermission], ManagementObjectNotFoundException + FullyQualifiedErrorId : D2FD338,Microsoft.Exchange.Management.RecipientTasks.AddADPermission The error message that 'aaa' was not found does not make sense because i just retrieved the mailbox in the previous commands. I have tried using email addresses instead of alias but it does not work.

    Read the article

  • SBS 2011 on different subnet than domain computers

    - by Ravi
    The setup is as follows: SBS 2011 in datacentre on subnet A Domain PCs at another location on subnet B There is a site-to-site VPN. The domain PCs have joined the domain and have the SBS as their primary DNS server. The domain PCs can ping the DC but the problem is that the DC cannot ping any of the remote subnet (subnet B) SBS --Switch -- Router A ------------------- Router B -- Switch -- Domain PCs What is strange is that router A can ping any host on the subnet B. Another host on Subnet A can also ping any host on subnet B. It's only the DC which cannot ping anything to that specific remote subnet B. I did a tracert from the SBS to router B. The packet reaches Router A from the SBS but then it fails. Am I missing some specific settings that needs to be done when SBS is on a different subnet than its member pcs ?

    Read the article

  • Windows scheduled task not running

    - by Ravi Kumar Singh
    I have several SQL server backups on a server. I have created a batch file which then copies these to network drives. These are mapped to the server, and it works properly. Now, I've created a scheduled task to do this. If I select "run the task when logged in", I can test the task. It works fine. However I cannot test it with the other option "run task if logged in or not". I've read that testing this task is not possible manually. However the task runs when we log off the server automatically.

    Read the article

  • How to connect to a remote desktop using Tight VNC server.

    - by Ravi shankar
    Can some one suggest me the best network application debugging tools. As I am trying to connect to remote VNC server uisng windows 7. I have diabled windows firewall and antivirus but sitll not able to connect to the remote server. I have also tried Putty to connect to the remote pc but was not successfull. But when I try to access the PC using windows I can access the shared documents.

    Read the article

  • How to enable remote desktop view in windows 7 ?

    - by Ravi shankar
    Hi, I am trying to connect to a tight VNC server for remote desktop view. Its working fine when VNC server is running in XP PC but I am not able to connect remotly when VNC server is running in windows 7 PC. I am also able to connect to localhost in windows 7. I have turn off windows fire wall and other anti virus.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 3 4 5 6 7 8 9 10 11 12 13 14  | Next Page >