Search Results

Search found 266 results on 11 pages for 'sudhakar singh'.

Page 7/11 | < Previous Page | 3 4 5 6 7 8 9 10 11  | Next Page >

  • Cordova - Scrolling with a fixed header and footer (ios)

    - by Samu Singh
    Using Cordova (phonegap) & bootstrap to make a mobile application, testing on IOS for now. Getting an issue with a header and footer bar that are fixed with scrollable content in the middle. When tapping to scroll, the header/footer bar moves down or up with the content but then snaps back to place as soon as the scrolling completes. If I use -webkit-overflow-scrolling: touch; it works as expected, but it makes it really awkward to scroll through the content, and if you scroll passed the end, it only scrolls the header or footer (with elastic overflow) until you stop for a second. here's my html for the header/footer bars: <div id="headerBar"> <div class="container-fluid" style="background-color: #1569C7"> <div class="row"> <div class="col-xs-3 text-left"> <button id="logoutButton" type="button" class="btn btn-default"> Log Out </button> <button type="button" class="btn btn-default" id="restoreQuestionFeedButton"> <span class="glyphicon glyphicon-chevron-left"></span> </button> </div> <div class="col-xs-6 text-center" style="height: 55px"> <strong id="usernameText"></strong> </div> <div class="col-xs-3 text-right"> <button id="oldCreatQuestionButton" type="button" class="btn btn-default"> <span class="glyphicon glyphicon-plus"></span> </button> </div> </div> </div> </div> <div id="footerBar"> <div class="container-fluid" style="padding: 0"> <div class="row text-center"> <button id="createQuestionButton" type="button" class="btn btn-default footerButton"> <span class="glyphicon glyphicon-plus"></span> <strong>Ask a new free question!</strong> </button> </div> </div> </div> And here is the related CSS: #headerBar { position: fixed; z-index: 100; top: 0; left: 0; width: 100%; background-color: #1569C7; } #footerBar { position: fixed; z-index: 100; bottom: 0; left: 0; width: 100%; background-color: #1569C7 !important; }

    Read the article

  • using internationalization on list data

    - by singh
    i am using Struts2 in application. <s:iterator value="listObject"> <s:component template="abc.vm"> <s:param name="text" value="listValue" /> <s:param name="prefix" value="listIndex" /> </s:component> </s:iterator> listValue is a values of list. i am using iterator to traverse the list. now on listValue, i want to put here internationalization concept.so that all the list value can be display based on Locale which store in a list. please suggest!

    Read the article

  • Sending URL as a parameter using javascript

    - by Prashant Singh
    I have to send a name and a link from client side to the server. I thought of using AJAX called by Javascript to do this. This is what I mean. I wished to make an ajax request to a file called abc.php with parameters :- 1. http://thumbs2.ebaystatic.com/m/m7dFgOtLUUUSpktHRspjhXw/140.jpg 2. Apple iPod touch, 3rd generation, 32GB To begin with, I encoded the URL and tried to send it. But the server says status Forbidden Any solution to this ? UPDATE :: It end up calling to http://abc.com/addToWishlist.php?rand=506075547542422&image=http://thumbs1.ebaystatic.com/m/mO64jQrMqam2jde9aKiXC9A/140.jpg&prod=Flat%20USB%20Data%20Sync%20Charging%20Charger%20Cable%20Apple%20iPhone%204G%204S%20iPod%20Touch%20Nano Javascript Code :: function addToWishlist(num) { var myurl = "addToWishlist.php"; var myurl1 = myurl; myRand = parseInt(Math.random()*999999999999999); var rand = "?rand="+myRand ; var modurl = myurl1+ rand + "&image=" + encodeURI(storeArray[num][1]) + "&prod=" + encodeURI(storeArray[num][0]); httpq2.open("GET", modurl, true); httpq2.onreadystatechange = useHttpResponseq2; httpq2.send(null); } function useHttpResponseq2() { if (httpq2.readyState == 4) { if(httpq2.status == 200) { var mytext = httpq2.responseText; document.getElementById('wish' + num).innerHTML = "Added to your wishlist."; } } } Server Code <?php include('/home/ankit/public_html/connect_db.php'); $image = $_GET['image']; $prod = $_GET['prod']; $id = $_GET['id']; echo $prod; echo $image; ?> As I mentioned, its pretty basics More Updates : On trying to send a POST request via AJAX to the server, it says :- Refused to set unsafe header "Content-length" Refused to set unsafe header "Connection"

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Preloading and caching of images in silverlight

    - by Prabhjot Singh
    Hi there I have a silverlight application in vs2010 and iam using silverlight 4.0. I have to show a videoppt in which a video is synchronised with images and it runs as a video powerpoint presentation. Is it possible to preload the images or cache them, so that they get rendered as soon as the video starts. If there is a way out, plz guide me.

    Read the article

  • how to reload the whole page through a button placed in a division in jsp

    - by ajeet singh
    when i tried to make web project, i placed the links on the left on one division and a bigger division on the right to load the jsp pages on clicking the links making the main page same... but when there is a need arises to load the whole page by clicking the button placed on the right division, i found that the only page is loaded on the right division jsp calling its action... please help me to sort out this problem..

    Read the article

  • Lan Chatting system [closed]

    - by jay prakash singh
    Possible Duplicate: LAN chating system or LAN chat server displaying list of user to all the user window my code is i m use RMI so this is the interface declaration public void sendPublicMessage(String keyword, String username, String message) throws RemoteException; public void sendPrivateMessage(String keyword, String username, String message) throws RemoteException; public ArrayList getClientList() throws RemoteException; public void connect(String username) throws RemoteException; public void disconnect(String username) throws RemoteException; } chat Server here connectedUser is the HasMap object we use the follo0wing code for connection here ChatImpl is the stub try { InetAddress Address = InetAddress.getLocalHost(); ChatImpl csi = new ChatImpl(this); Naming.rebind("rmi://"+Address.getHostAddress()+":1099/ChatService", csi); } public ArrayList getClientList() { ArrayList myUser = new ArrayList(); Iterator i = connectedUser.keySet().iterator(); String user = null; while(i.hasNext()) { user = i.next().toString(); myUser.add(user); } return myUser; } public void addClient(Socket clientSocket) throws RemoteException { connectedUser.put(getUsername(), clientSocket); sendPublicMessage(ONLINE, getUsername(), "CLIENT"); } this is the client side code for array list public void updateClient(ArrayList allClientList) throws RemoteException { listClient.clear(); int i = 0; String username; for(i=0; i<allClientList.size(); i++) { username = allClientList.get(i).toString(); listClient.addElement(username); } }

    Read the article

  • Need to open to two excel files and add numbers from them into a third file using vba.

    - by Harpyar Singh
    I have two excel files which has similar formatting and the data map each other from cell b15:h31. Row 15 is heading and so is the column B. I want to read file1 cell by cell and add that cell's content to the corresponding cell in File 2 i.e C16 in file 1 gets added to C16 in file 2, C17 in file 1 to C17 in file 2 and so on. The output goes in file 3 or anything. trying to implement through vba but of no success so far. Does anyone know how to go about it.

    Read the article

  • How to get dynamically session object in struts2

    - by Sujeet Singh
    I am trying to get dynamically session object in struts2 application. <s:if test="%{#session['resToken'].bookingType == 1}"> resToken can be get by <s:property value="%{resToken}">.. But I can't write <s:property> within <s:if test=""> its giving me error of double quotes.. org.apache.jasper.JasperException: /WEB-INF/jsp/booking/banquet/guest-Info-View.jsp(150,40) Unterminated &lt;s:if tag

    Read the article

  • Google Map key in Android?

    - by Amandeep singh
    I am developing an android app in which i have to show map view i have done it once in a previous app but the key i used in the previous is not working int his app . It is just showing a pin in the application with blank screen. Do i have to use a different Map key for each project , If not Kindly help me how can i use my previous Key in this. and also I tried generating a new key but gave the the same key back . Here is the code i used public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.map); btn=(Button)findViewById(R.id.mapbtn); str1=getIntent().getStringExtra("LATITUDE"); str2=getIntent().getStringExtra("LONGITUDE"); mapView = (MapView)findViewById(R.id.mapView1); //View zoomView = mapView.getZoomControls(); mapView.setBuiltInZoomControls(true); //mapView.setSatellite(true); mc = mapView.getController(); btn.setOnClickListener(this); MapOverlay mapOverlay = new MapOverlay(); List<Overlay> listOfOverlays = mapView.getOverlays(); listOfOverlays.clear(); listOfOverlays.add(mapOverlay); String coordinates[] = {str1, str2}; double lat = Double.parseDouble(coordinates[0]); double lng = Double.parseDouble(coordinates[1]); p = new GeoPoint( (int) (lat * 1E6), (int) (lng * 1E6)); mc.animateTo(p); mc.setZoom(17); mapView.invalidate(); //mp.equals(o); } @Override protected boolean isRouteDisplayed() { // TODO Auto-generated method stub return false; } class MapOverlay extends com.google.android.maps.Overlay { @Override public boolean draw(Canvas canvas, MapView mapView, boolean shadow, long when) { super.draw(canvas, mapView, shadow); Paint mPaint = new Paint(); mPaint.setDither(true); mPaint.setColor(Color.RED); mPaint.setStyle(Paint.Style.FILL_AND_STROKE); mPaint.setStrokeJoin(Paint.Join.ROUND); mPaint.setStrokeCap(Paint.Cap.ROUND); mPaint.setStrokeWidth(2); //---translate the GeoPoint to screen pixels--- Point screenPts = new Point(); mapView.getProjection().toPixels(p, screenPts); //---add the marker--- Bitmap bmp = BitmapFactory.decodeResource(getResources(), R.drawable.pin); canvas.drawBitmap(bmp, screenPts.x, screenPts.y-50, null); return true; } Thanks....

    Read the article

  • Non-Git Github?

    - by Mihir Singh
    This is probably a really weird question... but is there a non-git Github? I want a place to post my projects and share my code (like Github) but I don't want to have to works with versions, commits, etc. I don't like having to create a link between my folder and my git repo and then push the changes etc. In addition, I don't want to have to have a local copy to create or add files; I can edit existing files in Github, but to create or add files, I have to do it locally and then commit and push. I'm not sure if this is the best site to ask on, but I figured someone might have the answer. Thanks in advance.

    Read the article

  • How to send html content in the Email body

    - by Shalini Singh
    Hi, i am using android code with html tag.. but in mail getting same html tag please help me how can i send html link ... the code is giving below Intent emailIntent = new Intent(android.content.Intent.ACTION_SEND); emailIntent.setType("text/html"); emailIntent.putExtra(android.content.Intent.EXTRA_EMAIL, new String[] {"[EMAIL PROTECTED]"}); emailIntent.putExtra(android.content.Intent.EXTRA_SUBJECT, "Subject"); emailIntent.putExtra(android.content.Intent.EXTRA_TEXT, "Example"); context.startActivity(Intent.createChooser(emailIntent, "Send mail..."));

    Read the article

  • Question regarding common class

    - by Rocky Singh
    I have following two classes: public class A : System.Web.UI.WebControls.Button { public virtual string X { get { object obj = ViewState["X"]; if (obj != null) return (string)obj; return null; } set { ViewState["X"] = value; } } protected override void OnLoad(EventArgs e) { X=2; } } and public class B : System.Web.UI.WebControls.TextBox { public virtual string X { get { object obj = ViewState["X"]; if (obj != null) return (string)obj; return null; } set { ViewState["X"] = value; } } protected override void OnLoad(EventArgs e) { X=2; } } As you must be seeing the class A and B have exactly the same code , my question is how can I make a common class for it and use these two classes.

    Read the article

  • Is rand() predictable in C++

    - by singh
    When I run the below program I always get the same values each time. Is rand not a true random function? int main() { while(1) { getch(); cout<<rand()<<endl; } } In each run I am getting the below values. 41 18467 6334 26500 19169 15724 ......

    Read the article

  • How to upload a file from app in VC++ 6 to a web server?

    - by Arvind Singh
    I have an application in VC++ 6 (not MFC) , feature requires it to upload a file to a web server on regular basis. Web server is under our control, anonymous upload scripts/page are already setup that would accept a file manually. How to program in VC++ 6 to upload? which classes to use? I understand it is much possible with smtp and ftp but how through http?

    Read the article

  • What is the best approach to manipulate assets in Drupal from .Net application?

    - by Amandeep Singh
    I'm beginning work on a project that will access a Drupal site to create nodes on the site. This includes file uploading, as the project is to allow people to upload pictures en mass to a Drupal site with minimal ado. Note that my application is written in .Net. What I would like to know is the best approach to achieve the same? Based on initial research it looks like there are several options: 1. XML-RPC 2. Custom PHP module deployed in drupal. But, what is the way to invoke it from .Net? 3. Use a cron job to pick up the files from a watch folder. And add a cron_hook in my module to deploy the file.

    Read the article

< Previous Page | 3 4 5 6 7 8 9 10 11  | Next Page >