Search Results

Search found 35102 results on 1405 pages for 'text mining'.

Page 71/1405 | < Previous Page | 67 68 69 70 71 72 73 74 75 76 77 78  | Next Page >

  • How to color highlight text in a black/white document easily

    - by Lateron
    I am editing a 96 chapter book. The text is in normal black letters on a white background. What I want to be able to do is: I want to have any changes or additions automatically shown in another (per-selected) color. Without having to a)high lite a word or phrase to be changed or added and then b)going to the toolbar and clicking on the font color In other words I want the original color of the text to remain as it is and any additions or changes to be visible in another color without having to use the toolbar. Can this be done? I use OpenOffice or Word 2007 in Windows 7.

    Read the article

  • Text on Cisco ASA console is garbled/missing letters

    - by Some Linux Nerd
    I've actually looked up a number of solutions for this problem and none of them work. There's this Cisco ASA 5505 that I'd like to use, that outputs mildly garbled text with missing characters. I did some googling and found that the most likely problem is a bad baud rate, so I tried all the baud rates, 7N1, 8N2... basically every possibility minicom had. Then I figured (since I can type ok, just not read) that if I factory reset it that it would fix whatever is set wrong with the terminal. That didn't work either. This usb-db9 adapter and console cable work fine on the catalyst switch in our office. My serial settings are 9600 8N1 with no flow control. Anyone know how to fix this? I have an example of the text on pastebin: http://pastebin.com/MAJF0mVU - it's just lots of "Dfaut cnfiuraionfil cotais 1enty." instead of "Default configuration blah blah"

    Read the article

  • SQL Server 2008 R2 Writing To Text File

    - by zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz
    I used to write to text files from SQL Server using the code listed below: DECLARE @FS INT --File System Object DECLARE @OLEResult INT --Result message/code DECLARE @FileID INT --Pointer to file --Create file system object (OLE Object) EXECUTE @OLEResult = sp_OACreate 'Scripting.FileSystemObject', @FS OUT IF @OLEResult <> 0 PRINT 'Scripting.FileSystemObject.Failed' -----OPEN FILE----- EXECUTE @OLEResult = sp_OAMethod @FS, 'OpenTextFile', @FileID OUT, @FileName, 8, 1 IF @OLEResult <> 0 PRINT 'OpenTextFile.Failed' It appears this is no longer supported in sql server 2008 r2. How should I export to text files in sql server 2008 r2? Link claiming this is no longer supported: http://social.msdn.microsoft.com/Forums/en/transactsql/thread/f8512bec-915c-44a2-ba9d-e679f98ba313

    Read the article

  • Converting PDF portfolios to plain text (pdftotext?)

    - by Andrea
    I am trying to convert a large number of PDFs (~15000) to plain text using pdftotext. This is working pretty well except for a few of the PDFs (~600) which, I guess, are "PDF portfolios." When I run these PDFs through pdftotext, it just outputs: For the best experience, open this PDF portfolio in Acrobat 9 or Adobe Reader 9, or later. Get Adobe Reader Now! If I do open these PDFs in Adobe Reader, they look like two or more PDFs inside a single file. Has anyone encountered this issue before? Is there any tool I can use to convert these PDFs automatically? (Either directly to text or at least to regular PDFs that pdftotext can then understand.)

    Read the article

  • Replace special text with sed?

    - by user143822
    I'm using CMD on Windows Xp to replace special text with Sed. I'm using this command for replace special characters like $ or * : sed -i "s/\*/123/g;" 1.txt But how command must i use to replace this strings with ciao! in my text files? Is possible? \\ \\\ "" sed.exe -i "s/{\*)(//123/ sed -i "s/\\/123/g;" 1.txt the previous command does not work because i have \, " and other special strings that sed use to make regex.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Create text file named after a cell containing other cell data

    - by user143041
    I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

    Read the article

  • How to put text in same row but different column if a certain text is present in the same row?

    - by melai
    How can I put text in the same row but different column if a certain text is present in the same row? Issue Area Correction Done Process changed bin Process skip lap converted to global Security done global migration Process changed bin How can I code this in a macro? For example: If the correction done is in the cell, the Issue should be Process automatically. If the word global is present the Issue should be Security. I have 500 rows and I want to have the code until row 500.

    Read the article

  • Why does Chrome show overlapping text?

    - by dog44wgm
    In Chrome, news articles at: http://www.theprovince.com with a leading photo and caption show the caption text overlapped with the body text. I have an image but as a new user here I'm not allowed to upload it. It happens at that site almost always, here's an example from today: http://www.theprovince.com/sports/Canucks+Blackhawks+collision+Titanic+proportions/5721421/story.html It rarely happens elsewhere. The same link works fine in Internet Explorer so I'm guessing it's a Chrome issue. It's been like this for many months, I read the site almost everyday. I click on "Print this Article" to get a proper look at it, but it's annoying, hope someone has the answer. Thanks in advance.

    Read the article

  • Format text to 5 chars from a number

    - by Wheelersg
    In Access, I used a query to sum some numbers and appended the answer to another table(table2). Now I need to export the number as a text with 5 positions but can't seem to get it to hard code all 5 positions. I have it formatted as text, field length 5, custom foramt "00000" (also tried @@@@@). Example: 3 + 3 + 1 = 7. THen append the 7 to table2. It always shows as 7. I need it to shows as 00007.

    Read the article

  • ASP.NET Podcast Show #148 - ASP.NET WebForms to build a Mobile Web Application

    - by Wallym
    Check the podcast site for the original url. This is the video and source code for an ASP.NET WebForms app that I wrote that is optimized for the iPhone and mobile environments.  Subscribe to everything. Subscribe to WMV. Subscribe to M4V for iPhone/iPad. Subscribe to MP3. Download WMV. Download M4V for iPhone/iPad. Download MP3. Link to iWebKit. Source Code: <%@ Page Title="MapSplore" Language="C#" MasterPageFile="iPhoneMaster.master" AutoEventWireup="true" CodeFile="Default.aspx.cs" Inherits="AT_iPhone_Default" %> <asp:Content ID="Content1" ContentPlaceHolderID="head" Runat="Server"></asp:Content><asp:Content ID="Content2" ContentPlaceHolderID="Content" Runat="Server" ClientIDMode="Static">    <asp:ScriptManager ID="sm" runat="server"         EnablePartialRendering="true" EnableHistory="false" EnableCdn="true" />    <script type="text/javascript" src="http://maps.google.com/maps/api/js?sensor=true"></script>    <script  language="javascript"  type="text/javascript">    <!--    Sys.WebForms.PageRequestManager.getInstance().add_endRequest(endRequestHandle);    function endRequestHandle(sender, Args) {        setupMapDiv();        setupPlaceIveBeen();    }    function setupPlaceIveBeen() {        var mapPlaceIveBeen = document.getElementById('divPlaceIveBeen');        if (mapPlaceIveBeen != null) {            var PlaceLat = document.getElementById('<%=hdPlaceIveBeenLatitude.ClientID %>').value;            var PlaceLon = document.getElementById('<%=hdPlaceIveBeenLongitude.ClientID %>').value;            var PlaceTitle = document.getElementById('<%=lblPlaceIveBeenName.ClientID %>').innerHTML;            var latlng = new google.maps.LatLng(PlaceLat, PlaceLon);            var myOptions = {                zoom: 14,                center: latlng,                mapTypeId: google.maps.MapTypeId.ROADMAP            };            var map = new google.maps.Map(mapPlaceIveBeen, myOptions);            var marker = new google.maps.Marker({                position: new google.maps.LatLng(PlaceLat, PlaceLon),                map: map,                title: PlaceTitle,                clickable: false            });        }    }    function setupMapDiv() {        var mapdiv = document.getElementById('divImHere');        if (mapdiv != null) {            var PlaceLat = document.getElementById('<%=hdPlaceLat.ClientID %>').value;            var PlaceLon = document.getElementById('<%=hdPlaceLon.ClientID %>').value;            var PlaceTitle = document.getElementById('<%=hdPlaceTitle.ClientID %>').value;            var latlng = new google.maps.LatLng(PlaceLat, PlaceLon);            var myOptions = {                zoom: 14,                center: latlng,                mapTypeId: google.maps.MapTypeId.ROADMAP            };            var map = new google.maps.Map(mapdiv, myOptions);            var marker = new google.maps.Marker({                position: new google.maps.LatLng(PlaceLat, PlaceLon),                map: map,                title: PlaceTitle,                clickable: false            });        }     }    -->    </script>    <asp:HiddenField ID="Latitude" runat="server" />    <asp:HiddenField ID="Longitude" runat="server" />    <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1/jquery.min.js%22%3E%3C/script>    <script language="javascript" type="text/javascript">        $(document).ready(function () {            GetLocation();            setupMapDiv();            setupPlaceIveBeen();        });        function GetLocation() {            if (navigator.geolocation != null) {                navigator.geolocation.getCurrentPosition(getData);            }            else {                var mess = document.getElementById('<%=Message.ClientID %>');                mess.innerHTML = "Sorry, your browser does not support geolocation. " +                    "Try the latest version of Safari on the iPhone, Android browser, or the latest version of FireFox.";            }        }        function UpdateLocation_Click() {            GetLocation();        }        function getData(position) {            var latitude = position.coords.latitude;            var longitude = position.coords.longitude;            var hdLat = document.getElementById('<%=Latitude.ClientID %>');            var hdLon = document.getElementById('<%=Longitude.ClientID %>');            hdLat.value = latitude;            hdLon.value = longitude;        }    </script>    <asp:Label ID="Message" runat="server" />    <asp:UpdatePanel ID="upl" runat="server">        <ContentTemplate>    <asp:Panel ID="pnlStart" runat="server" Visible="true">    <div id="topbar">        <div id="title">MapSplore</div>    </div>    <div id="content">        <ul class="pageitem">            <li class="menu">                <asp:LinkButton ID="lbLocalDeals" runat="server" onclick="lbLocalDeals_Click">                <asp:Image ID="imLocalDeals" runat="server" ImageUrl="~/Images/ArtFavor_Money_Bag_Icon.png" Height="30" />                <span class="name">Local Deals.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbLocalPlaces" runat="server" onclick="lbLocalPlaces_Click">                <asp:Image ID="imLocalPlaces" runat="server" ImageUrl="~/Images/Andy_Houses_on_the_horizon_-_Starburst_remix.png" Height="30" />                <span class="name">Local Places.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbWhereIveBeen" runat="server" onclick="lbWhereIveBeen_Click">                <asp:Image ID="imImHere" runat="server" ImageUrl="~/Images/ryanlerch_flagpole.png" Height="30" />                <span class="name">I've been here.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbMyStats" runat="server">                <asp:Image ID="imMyStats" runat="server" ImageUrl="~/Images/Anonymous_Spreadsheet.png" Height="30" />                <span class="name">My Stats.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbAddAPlace" runat="server" onclick="lbAddAPlace_Click">                <asp:Image ID="imAddAPlace" runat="server" ImageUrl="~/Images/jean_victor_balin_add.png" Height="30" />                <span class="name">Add a Place.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="button">                <input type="button" value="Update Your Current Location" onclick="UpdateLocation_Click()">                </li>        </ul>    </div>    </asp:Panel>    <div>    <asp:Panel ID="pnlCoupons" runat="server" Visible="false">        <div id="topbar">        <div id="title">MapSplore</div>        <div id="leftbutton">            <asp:LinkButton runat="server" Text="Return"                 ID="ReturnFromDeals" OnClick="ReturnFromDeals_Click" /></div></div>    <div class="content">    <asp:ListView ID="lvCoupons" runat="server">        <LayoutTemplate>            <ul class="pageitem" runat="server">                <asp:PlaceHolder ID="itemPlaceholder" runat="server" />            </ul>        </LayoutTemplate>        <ItemTemplate>            <li class="menu">                <asp:LinkButton ID="lbBusiness" runat="server" Text='<%#Eval("Place.Name") %>' OnClick="lbBusiness_Click">                    <span class="comment">                    <asp:Label ID="lblAddress" runat="server" Text='<%#Eval("Place.Address1") %>' />                    <asp:Label ID="lblDis" runat="server" Text='<%# Convert.ToString(Convert.ToInt32(Eval("Place.Distance"))) + " meters" %>' CssClass="smallText" />                    <asp:HiddenField ID="hdPlaceId" runat="server" Value='<%#Eval("PlaceId") %>' />                    <asp:HiddenField ID="hdGeoPromotionId" runat="server" Value='<%#Eval("GeoPromotionId") %>' />                    </span>                    <span class="arrow"></span>                </asp:LinkButton></li></ItemTemplate></asp:ListView><asp:GridView ID="gvCoupons" runat="server" AutoGenerateColumns="false">            <HeaderStyle BackColor="Silver" />            <AlternatingRowStyle BackColor="Wheat" />            <Columns>                <asp:TemplateField AccessibleHeaderText="Business" HeaderText="Business">                    <ItemTemplate>                        <asp:Image ID="imPlaceType" runat="server" Text='<%#Eval("Type") %>' ImageUrl='<%#Eval("Image") %>' />                        <asp:LinkButton ID="lbBusiness" runat="server" Text='<%#Eval("Name") %>' OnClick="lbBusiness_Click" />                        <asp:LinkButton ID="lblAddress" runat="server" Text='<%#Eval("Address1") %>' CssClass="smallText" />                        <asp:Label ID="lblDis" runat="server" Text='<%# Convert.ToString(Convert.ToInt32(Eval("Distance"))) + " meters" %>' CssClass="smallText" />                        <asp:HiddenField ID="hdPlaceId" runat="server" Value='<%#Eval("PlaceId") %>' />                        <asp:HiddenField ID="hdGeoPromotionId" runat="server" Value='<%#Eval("GeoPromotionId") %>' />                        <asp:Label ID="lblInfo" runat="server" Visible="false" />                    </ItemTemplate>                </asp:TemplateField>            </Columns>        </asp:GridView>    </div>    </asp:Panel>    <asp:Panel ID="pnlPlaces" runat="server" Visible="false">    <div id="topbar">        <div id="title">            MapSplore</div><div id="leftbutton">            <asp:LinkButton runat="server" Text="Return"                 ID="ReturnFromPlaces" OnClick="ReturnFromPlaces_Click" /></div></div>        <div id="content">        <asp:ListView ID="lvPlaces" runat="server">            <LayoutTemplate>                <ul id="ulPlaces" class="pageitem" runat="server">                    <asp:PlaceHolder ID="itemPlaceholder" runat="server" />                    <li class="menu">                        <asp:LinkButton ID="lbNotListed" runat="server" CssClass="name"                            OnClick="lbNotListed_Click">                            Place not listed                            <span class="arrow"></span>                            </asp:LinkButton>                    </li>                </ul>            </LayoutTemplate>            <ItemTemplate>            <li class="menu">                <asp:LinkButton ID="lbImHere" runat="server" CssClass="name"                     OnClick="lbImHere_Click">                <%#DisplayName(Eval("Name")) %>&nbsp;                <%# Convert.ToString(Convert.ToInt32(Eval("Distance"))) + " meters" %>                <asp:HiddenField ID="hdPlaceId" runat="server" Value='<%#Eval("PlaceId") %>' />                <span class="arrow"></span>                </asp:LinkButton></li></ItemTemplate></asp:ListView>    </div>    </asp:Panel>    <asp:Panel ID="pnlImHereNow" runat="server" Visible="false">        <div id="topbar">        <div id="title">            MapSplore</div><div id="leftbutton">            <asp:LinkButton runat="server" Text="Places"                 ID="lbImHereNowReturn" OnClick="lbImHereNowReturn_Click" /></div></div>            <div id="rightbutton">            <asp:LinkButton runat="server" Text="Beginning"                ID="lbBackToBeginning" OnClick="lbBackToBeginning_Click" />            </div>        <div id="content">        <ul class="pageitem">        <asp:HiddenField ID="hdPlaceId" runat="server" />        <asp:HiddenField ID="hdPlaceLat" runat="server" />        <asp:HiddenField ID="hdPlaceLon" runat="server" />        <asp:HiddenField ID="hdPlaceTitle" runat="server" />        <asp:Button ID="btnImHereNow" runat="server"             Text="I'm here" OnClick="btnImHereNow_Click" />             <asp:Label ID="lblPlaceTitle" runat="server" /><br />        <asp:TextBox ID="txtWhatsHappening" runat="server" TextMode="MultiLine" Rows="2" style="width:300px" /><br />        <div id="divImHere" style="width:300px; height:300px"></div>        </div>        </ul>    </asp:Panel>    <asp:Panel runat="server" ID="pnlIveBeenHere" Visible="false">        <div id="topbar">        <div id="title">            Where I've been</div><div id="leftbutton">            <asp:LinkButton ID="lbIveBeenHereBack" runat="server" Text="Back" OnClick="lbIveBeenHereBack_Click" /></div></div>        <div id="content">        <asp:ListView ID="lvWhereIveBeen" runat="server">            <LayoutTemplate>                <ul id="ulWhereIveBeen" class="pageitem" runat="server">                    <asp:PlaceHolder ID="itemPlaceholder" runat="server" />                </ul>            </LayoutTemplate>            <ItemTemplate>            <li class="menu" runat="server">                <asp:LinkButton ID="lbPlaceIveBeen" runat="server" OnClick="lbPlaceIveBeen_Click" CssClass="name">                    <asp:Label ID="lblPlace" runat="server" Text='<%#Eval("PlaceName") %>' /> at                    <asp:Label ID="lblTime" runat="server" Text='<%#Eval("ATTime") %>' CssClass="content" />                    <asp:HiddenField ID="hdATID" runat="server" Value='<%#Eval("ATID") %>' />                    <span class="arrow"></span>                </asp:LinkButton>            </li>            </ItemTemplate>        </asp:ListView>        </div>        </asp:Panel>    <asp:Panel runat="server" ID="pnlPlaceIveBeen" Visible="false">        <div id="topbar">        <div id="title">            I've been here        </div>        <div id="leftbutton">            <asp:LinkButton ID="lbPlaceIveBeenBack" runat="server" Text="Back" OnClick="lbPlaceIveBeenBack_Click" />        </div>        <div id="rightbutton">            <asp:LinkButton ID="lbPlaceIveBeenBeginning" runat="server" Text="Beginning" OnClick="lbPlaceIveBeenBeginning_Click" />        </div>        </div>        <div id="content">            <ul class="pageitem">            <li>            <asp:HiddenField ID="hdPlaceIveBeenPlaceId" runat="server" />            <asp:HiddenField ID="hdPlaceIveBeenLatitude" runat="server" />            <asp:HiddenField ID="hdPlaceIveBeenLongitude" runat="server" />            <asp:Label ID="lblPlaceIveBeenName" runat="server" /><br />            <asp:Label ID="lblPlaceIveBeenAddress" runat="server" /><br />            <asp:Label ID="lblPlaceIveBeenCity" runat="server" />,             <asp:Label ID="lblPlaceIveBeenState" runat="server" />            <asp:Label ID="lblPlaceIveBeenZipCode" runat="server" /><br />            <asp:Label ID="lblPlaceIveBeenCountry" runat="server" /><br />            <div id="divPlaceIveBeen" style="width:300px; height:300px"></div>            </li>            </ul>        </div>                </asp:Panel>         <asp:Panel ID="pnlAddPlace" runat="server" Visible="false">                <div id="topbar"><div id="title">MapSplore</div><div id="leftbutton"><asp:LinkButton ID="lbAddPlaceReturn" runat="server" Text="Back" OnClick="lbAddPlaceReturn_Click" /></div><div id="rightnav"></div></div><div id="content">    <ul class="pageitem">        <li id="liPlaceAddMessage" runat="server" visible="false">        <asp:Label ID="PlaceAddMessage" runat="server" />        </li>        <li class="bigfield">        <asp:TextBox ID="txtPlaceName" runat="server" placeholder="Name of Establishment" />        </li>        <li class="bigfield">        <asp:TextBox ID="txtAddress1" runat="server" placeholder="Address 1" />        </li>        <li class="bigfield">        <asp:TextBox ID="txtCity" runat="server" placeholder="City" />        </li>        <li class="select">        <asp:DropDownList ID="ddlProvince" runat="server" placeholder="Select State" />          <span class="arrow"></span>              </li>        <li class="bigfield">        <asp:TextBox ID="txtZipCode" runat="server" placeholder="Zip Code" />        </li>        <li class="select">        <asp:DropDownList ID="ddlCountry" runat="server"             onselectedindexchanged="ddlCountry_SelectedIndexChanged" />        <span class="arrow"></span>        </li>        <li class="bigfield">        <asp:TextBox ID="txtPhoneNumber" runat="server" placeholder="Phone Number" />        </li>        <li class="checkbox">            <span class="name">You Here Now:</span> <asp:CheckBox ID="cbYouHereNow" runat="server" Checked="true" />        </li>        <li class="button">        <asp:Button ID="btnAdd" runat="server" Text="Add Place"             onclick="btnAdd_Click" />        </li>    </ul></div>        </asp:Panel>        <asp:Panel ID="pnlImHere" runat="server" Visible="false">            <asp:TextBox ID="txtImHere" runat="server"                 TextMode="MultiLine" Rows="3" Columns="40" /><br />            <asp:DropDownList ID="ddlPlace" runat="server" /><br />            <asp:Button ID="btnHere" runat="server" Text="Tell Everyone I'm Here"                 onclick="btnHere_Click" /><br />        </asp:Panel>     </div>    </ContentTemplate>    </asp:UpdatePanel> </asp:Content> Code Behind .cs file: using System;using System.Collections.Generic;using System.Linq;using System.Web;using System.Web.Security;using System.Web.UI;using System.Web.UI.HtmlControls;using System.Web.UI.WebControls;using LocationDataModel; public partial class AT_iPhone_Default : ViewStatePage{    private iPhoneDevice ipd;     protected void Page_Load(object sender, EventArgs e)    {        LocationDataEntities lde = new LocationDataEntities();        if (!Page.IsPostBack)        {            var Countries = from c in lde.Countries select c;            foreach (Country co in Countries)            {                ddlCountry.Items.Add(new ListItem(co.Name, co.CountryId.ToString()));            }            ddlCountry_SelectedIndexChanged(ddlCountry, null);            if (AppleIPhone.IsIPad())                ipd = iPhoneDevice.iPad;            if (AppleIPhone.IsIPhone())                ipd = iPhoneDevice.iPhone;            if (AppleIPhone.IsIPodTouch())                ipd = iPhoneDevice.iPodTouch;        }    }    protected void btnPlaces_Click(object sender, EventArgs e)    {    }    protected void btnAdd_Click(object sender, EventArgs e)    {        bool blImHere = cbYouHereNow.Checked;        string Place = txtPlaceName.Text,            Address1 = txtAddress1.Text,            City = txtCity.Text,            ZipCode = txtZipCode.Text,            PhoneNumber = txtPhoneNumber.Text,            ProvinceId = ddlProvince.SelectedItem.Value,            CountryId = ddlCountry.SelectedItem.Value;        int iProvinceId, iCountryId;        double dLatitude, dLongitude;        DataAccess da = new DataAccess();        if ((!String.IsNullOrEmpty(ProvinceId)) &&            (!String.IsNullOrEmpty(CountryId)))        {            iProvinceId = Convert.ToInt32(ProvinceId);            iCountryId = Convert.ToInt32(CountryId);            if (blImHere)            {                dLatitude = Convert.ToDouble(Latitude.Value);                dLongitude = Convert.ToDouble(Longitude.Value);                da.StorePlace(Place, Address1, String.Empty, City,                    iProvinceId, ZipCode, iCountryId, PhoneNumber,                    dLatitude, dLongitude);            }            else            {                da.StorePlace(Place, Address1, String.Empty, City,                    iProvinceId, ZipCode, iCountryId, PhoneNumber);            }            liPlaceAddMessage.Visible = true;            PlaceAddMessage.Text = "Awesome, your place has been added. Add Another!";            txtPlaceName.Text = String.Empty;            txtAddress1.Text = String.Empty;            txtCity.Text = String.Empty;            ddlProvince.SelectedIndex = -1;            txtZipCode.Text = String.Empty;            txtPhoneNumber.Text = String.Empty;        }        else        {            liPlaceAddMessage.Visible = true;            PlaceAddMessage.Text = "Please select a State and a Country.";        }    }    protected void ddlCountry_SelectedIndexChanged(object sender, EventArgs e)    {        string CountryId = ddlCountry.SelectedItem.Value;        if (!String.IsNullOrEmpty(CountryId))        {            int iCountryId = Convert.ToInt32(CountryId);            LocationDataModel.LocationDataEntities lde = new LocationDataModel.LocationDataEntities();            var prov = from p in lde.Provinces where p.CountryId == iCountryId                        orderby p.ProvinceName select p;                        ddlProvince.Items.Add(String.Empty);            foreach (Province pr in prov)            {                ddlProvince.Items.Add(new ListItem(pr.ProvinceName, pr.ProvinceId.ToString()));            }        }        else        {            ddlProvince.Items.Clear();        }    }    protected void btnImHere_Click(object sender, EventArgs e)    {        int i = 0;        DataAccess da = new DataAccess();        double Lat = Convert.ToDouble(Latitude.Value),            Lon = Convert.ToDouble(Longitude.Value);        List<Place> lp = da.NearByLocations(Lat, Lon);        foreach (Place p in lp)        {            ListItem li = new ListItem(p.Name, p.PlaceId.ToString());            if (i == 0)            {                li.Selected = true;            }            ddlPlace.Items.Add(li);            i++;        }        pnlAddPlace.Visible = false;        pnlImHere.Visible = true;    }    protected void lbImHere_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        ListViewItem lvi = (ListViewItem)(((LinkButton)sender).Parent);        HiddenField hd = (HiddenField)lvi.FindControl("hdPlaceId");        long PlaceId = Convert.ToInt64(hd.Value);        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        Place pl = da.GetPlace(PlaceId);        pnlImHereNow.Visible = true;        pnlPlaces.Visible = false;        hdPlaceId.Value = PlaceId.ToString();        hdPlaceLat.Value = pl.Latitude.ToString();        hdPlaceLon.Value = pl.Longitude.ToString();        hdPlaceTitle.Value = pl.Name;        lblPlaceTitle.Text = pl.Name;    }    protected void btnHere_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        string WhatsH = txtImHere.Text;        long PlaceId = Convert.ToInt64(ddlPlace.SelectedValue);        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        da.StoreUserAT(UserName, PlaceId, WhatsH,            dLatitude, dLongitude);    }    protected void btnLocalCoupons_Click(object sender, EventArgs e)    {        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();     }    protected void lbBusiness_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        GridViewRow gvr = (GridViewRow)(((LinkButton)sender).Parent.Parent);        HiddenField hd = (HiddenField)gvr.FindControl("hdPlaceId");        string sPlaceId = hd.Value;        Int64 PlaceId;        if (!String.IsNullOrEmpty(sPlaceId))        {            PlaceId = Convert.ToInt64(sPlaceId);        }    }    protected void lbLocalDeals_Click(object sender, EventArgs e)    {        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        pnlCoupons.Visible = true;        pnlStart.Visible = false;        List<GeoPromotion> lgp = da.NearByDeals(dLatitude, dLongitude);        lvCoupons.DataSource = lgp;        lvCoupons.DataBind();    }    protected void lbLocalPlaces_Click(object sender, EventArgs e)    {        DataAccess da = new DataAccess();        double Lat = Convert.ToDouble(Latitude.Value);        double Lon = Convert.ToDouble(Longitude.Value);        List<LocationDataModel.Place> places = da.NearByLocations(Lat, Lon);        lvPlaces.DataSource = places;        lvPlaces.SelectedIndex = -1;        lvPlaces.DataBind();        pnlPlaces.Visible = true;        pnlStart.Visible = false;    }    protected void ReturnFromPlaces_Click(object sender, EventArgs e)    {        pnlPlaces.Visible = false;        pnlStart.Visible = true;    }    protected void ReturnFromDeals_Click(object sender, EventArgs e)    {        pnlCoupons.Visible = false;        pnlStart.Visible = true;    }    protected void btnImHereNow_Click(object sender, EventArgs e)    {        long PlaceId = Convert.ToInt32(hdPlaceId.Value);        string UserName = Membership.GetUser().UserName;        string WhatsHappening = txtWhatsHappening.Text;        double UserLat = Convert.ToDouble(Latitude.Value);        double UserLon = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        da.StoreUserAT(UserName, PlaceId, WhatsHappening,             UserLat, UserLon);    }    protected void lbImHereNowReturn_Click(object sender, EventArgs e)    {        pnlImHereNow.Visible = false;        pnlPlaces.Visible = true;    }    protected void lbBackToBeginning_Click(object sender, EventArgs e)    {        pnlStart.Visible = true;        pnlImHereNow.Visible = false;    }    protected void lbWhereIveBeen_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        pnlStart.Visible = false;        pnlIveBeenHere.Visible = true;        DataAccess da = new DataAccess();        lvWhereIveBeen.DataSource = da.UserATs(UserName, 0, 15);        lvWhereIveBeen.DataBind();    }    protected void lbIveBeenHereBack_Click(object sender, EventArgs e)    {        pnlIveBeenHere.Visible = false;        pnlStart.Visible = true;    }     protected void lbPlaceIveBeen_Click(object sender, EventArgs e)    {        LinkButton lb = (LinkButton)sender;        ListViewItem lvi = (ListViewItem)lb.Parent.Parent;        HiddenField hdATID = (HiddenField)lvi.FindControl("hdATID");        Int64 ATID = Convert.ToInt64(hdATID.Value);        DataAccess da = new DataAccess();        pnlIveBeenHere.Visible = false;        pnlPlaceIveBeen.Visible = true;        var plac = da.GetPlaceViaATID(ATID);        hdPlaceIveBeenPlaceId.Value = plac.PlaceId.ToString();        hdPlaceIveBeenLatitude.Value = plac.Latitude.ToString();        hdPlaceIveBeenLongitude.Value = plac.Longitude.ToString();        lblPlaceIveBeenName.Text = plac.Name;        lblPlaceIveBeenAddress.Text = plac.Address1;        lblPlaceIveBeenCity.Text = plac.City;        lblPlaceIveBeenState.Text = plac.Province.ProvinceName;        lblPlaceIveBeenZipCode.Text = plac.ZipCode;        lblPlaceIveBeenCountry.Text = plac.Country.Name;    }     protected void lbNotListed_Click(object sender, EventArgs e)    {        SetupAddPoint();        pnlPlaces.Visible = false;    }     protected void lbAddAPlace_Click(object sender, EventArgs e)    {        SetupAddPoint();    }     private void SetupAddPoint()    {        double lat = Convert.ToDouble(Latitude.Value);        double lon = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        var zip = da.WhereAmIAt(lat, lon);        if (zip.Count > 0)        {            var z0 = zip[0];            txtCity.Text = z0.City;            txtZipCode.Text = z0.ZipCode;            ddlProvince.ClearSelection();            if (z0.ProvinceId.HasValue == true)            {                foreach (ListItem li in ddlProvince.Items)                {                    if (li.Value == z0.ProvinceId.Value.ToString())                    {                        li.Selected = true;                        break;                    }                }            }        }        pnlAddPlace.Visible = true;        pnlStart.Visible = false;    }    protected void lbAddPlaceReturn_Click(object sender, EventArgs e)    {        pnlAddPlace.Visible = false;        pnlStart.Visible = true;        liPlaceAddMessage.Visible = false;        PlaceAddMessage.Text = String.Empty;    }    protected void lbPlaceIveBeenBack_Click(object sender, EventArgs e)    {        pnlIveBeenHere.Visible = true;        pnlPlaceIveBeen.Visible = false;            }    protected void lbPlaceIveBeenBeginning_Click(object sender, EventArgs e)    {        pnlPlaceIveBeen.Visible = false;        pnlStart.Visible = true;    }    protected string DisplayName(object val)    {        string strVal = Convert.ToString(val);         if (AppleIPhone.IsIPad())        {            ipd = iPhoneDevice.iPad;        }        if (AppleIPhone.IsIPhone())        {            ipd = iPhoneDevice.iPhone;        }        if (AppleIPhone.IsIPodTouch())        {            ipd = iPhoneDevice.iPodTouch;        }        return (iPhoneHelper.DisplayContentOnMenu(strVal, ipd));    }} iPhoneHelper.cs file: using System;using System.Collections.Generic;using System.Linq;using System.Web; public enum iPhoneDevice{    iPhone, iPodTouch, iPad}/// <summary>/// Summary description for iPhoneHelper/// </summary>/// public class iPhoneHelper{ public iPhoneHelper() {  //  // TODO: Add constructor logic here  // } // This code is stupid in retrospect. Use css to solve this problem      public static string DisplayContentOnMenu(string val, iPhoneDevice ipd)    {        string Return = val;        string Elipsis = "...";        int iPadMaxLength = 30;        int iPhoneMaxLength = 15;        if (ipd == iPhoneDevice.iPad)        {            if (Return.Length > iPadMaxLength)            {                Return = Return.Substring(0, iPadMaxLength - Elipsis.Length) + Elipsis;            }        }        else        {            if (Return.Length > iPhoneMaxLength)            {                Return = Return.Substring(0, iPhoneMaxLength - Elipsis.Length) + Elipsis;            }        }        return (Return);    }}  Source code for the ViewStatePage: using System;using System.Data;using System.Data.SqlClient;using System.Configuration;using System.Web;using System.Web.Security;using System.Web.UI;using System.Web.UI.WebControls;using System.Web.UI.WebControls.WebParts;using System.Web.UI.HtmlControls; /// <summary>/// Summary description for BasePage/// </summary>#region Base class for a page.public class ViewStatePage : System.Web.UI.Page{     PageStatePersisterToDatabase myPageStatePersister;        public ViewStatePage()        : base()    {        myPageStatePersister = new PageStatePersisterToDatabase(this);    }     protected override PageStatePersister PageStatePersister    {        get        {            return myPageStatePersister;        }    } }#endregion #region This class will override the page persistence to store page state in a database.public class PageStatePersisterToDatabase : PageStatePersister{    private string ViewStateKeyField = "__VIEWSTATE_KEY";    private string _exNoConnectionStringFound = "No Database Configuration information is in the web.config.";     public PageStatePersisterToDatabase(Page page)        : base(page)    {    }     public override void Load()    {         // Get the cache key from the web form data        System.Int64 key = Convert.ToInt64(Page.Request.Params[ViewStateKeyField]);         Pair state = this.LoadState(key);         // Abort if cache object is not of type Pair        if (state == null)            throw new ApplicationException("Missing valid " + ViewStateKeyField);         // Set view state and control state        ViewState = state.First;        ControlState = state.Second;    }     public override void Save()    {         // No processing needed if no states available        if (ViewState == null && ControlState != null)            return;         System.Int64 key;        IStateFormatter formatter = this.StateFormatter;        Pair statePair = new Pair(ViewState, ControlState);         // Serialize the statePair object to a string.        string serializedState = formatter.Serialize(statePair);         // Save the ViewState and get a unique identifier back.        key = SaveState(serializedState);         // Register hidden field to store cache key in        // Page.ClientScript does not work properly with Atlas.        //Page.ClientScript.RegisterHiddenField(ViewStateKeyField, key.ToString());        ScriptManager.RegisterHiddenField(this.Page, ViewStateKeyField, key.ToString());    }     private System.Int64 SaveState(string PageState)    {        System.Int64 i64Key = 0;        string strConn = String.Empty,            strProvider = String.Empty;         string strSql = "insert into tblPageState ( SerializedState ) values ( '" + SqlEscape(PageState) + "');select scope_identity();";        SqlConnection sqlCn;        SqlCommand sqlCm;        try        {            GetDBConnectionString(ref strConn, ref strProvider);            sqlCn = new SqlConnection(strConn);            sqlCm = new SqlCommand(strSql, sqlCn);            sqlCn.Open();            i64Key = Convert.ToInt64(sqlCm.ExecuteScalar());            if (sqlCn.State != ConnectionState.Closed)            {                sqlCn.Close();            }            sqlCn.Dispose();            sqlCm.Dispose();        }        finally        {            sqlCn = null;            sqlCm = null;        }        return i64Key;    }     private Pair LoadState(System.Int64 iKey)    {        string strConn = String.Empty,            strProvider = String.Empty,            SerializedState = String.Empty,            strMinutesInPast = GetMinutesInPastToDelete();        Pair PageState;        string strSql = "select SerializedState from tblPageState where tblPageStateID=" + iKey.ToString() + ";" +            "delete from tblPageState where DateUpdated<DateAdd(mi, " + strMinutesInPast + ", getdate());";        SqlConnection sqlCn;        SqlCommand sqlCm;        try        {            GetDBConnectionString(ref strConn, ref strProvider);            sqlCn = new SqlConnection(strConn);            sqlCm = new SqlCommand(strSql, sqlCn);             sqlCn.Open();            SerializedState = Convert.ToString(sqlCm.ExecuteScalar());            IStateFormatter formatter = this.StateFormatter;             if ((null == SerializedState) ||                (String.Empty == SerializedState))            {                throw (new ApplicationException("No ViewState records were returned."));            }             // Deserilize returns the Pair object that is serialized in            // the Save method.            PageState = (Pair)formatter.Deserialize(SerializedState);             if (sqlCn.State != ConnectionState.Closed)            {                sqlCn.Close();            }            sqlCn.Dispose();            sqlCm.Dispose();        }        finally        {            sqlCn = null;            sqlCm = null;        }        return PageState;    }     private string SqlEscape(string Val)    {        string ReturnVal = String.Empty;        if (null != Val)        {            ReturnVal = Val.Replace("'", "''");        }        return (ReturnVal);    }    private void GetDBConnectionString(ref string ConnectionStringValue, ref string ProviderNameValue)    {        if (System.Configuration.ConfigurationManager.ConnectionStrings.Count > 0)        {            ConnectionStringValue = System.Configuration.ConfigurationManager.ConnectionStrings["ApplicationServices"].ConnectionString;            ProviderNameValue = System.Configuration.ConfigurationManager.ConnectionStrings["ApplicationServices"].ProviderName;        }        else        {            throw new ConfigurationErrorsException(_exNoConnectionStringFound);        }    }    private string GetMinutesInPastToDelete()    {        string strReturn = "-60";        if (null != System.Configuration.ConfigurationManager.AppSettings["MinutesInPastToDeletePageState"])        {            strReturn = System.Configuration.ConfigurationManager.AppSettings["MinutesInPastToDeletePageState"].ToString();        }        return (strReturn);    }}#endregion AppleiPhone.cs file: using System;using System.Collections.Generic;using System.Linq;using System.Web; /// <summary>/// Summary description for AppleIPhone/// </summary>public class AppleIPhone{ public AppleIPhone() {  //  // TODO: Add constructor logic here  // }     static public bool IsIPhoneOS()    {        return (IsIPad() || IsIPhone() || IsIPodTouch());    }     static public bool IsIPhone()    {        return IsTest("iPhone");    }     static public bool IsIPodTouch()    {        return IsTest("iPod");    }     static public bool IsIPad()    {        return IsTest("iPad");    }     static private bool IsTest(string Agent)    {        bool bl = false;        string ua = HttpContext.Current.Request.UserAgent.ToLower();        try        {            bl = ua.Contains(Agent.ToLower());        }        catch { }        return (bl);        }} Master page .cs: using System;using System.Collections.Generic;using System.Linq;using System.Web;using System.Web.UI;using System.Web.UI.HtmlControls;using System.Web.UI.WebControls; public partial class MasterPages_iPhoneMaster : System.Web.UI.MasterPage{    protected void Page_Load(object sender, EventArgs e)    {            HtmlHead head = Page.Header;            HtmlMeta meta = new HtmlMeta();            if (AppleIPhone.IsIPad() == true)            {                meta.Content = "width=400,user-scalable=no";                head.Controls.Add(meta);             }            else            {                meta.Content = "width=device-width, user-scalable=no";                meta.Attributes.Add("name", "viewport");            }            meta.Attributes.Add("name", "viewport");            head.Controls.Add(meta);            HtmlLink cssLink = new HtmlLink();            HtmlGenericControl script = new HtmlGenericControl("script");            script.Attributes.Add("type", "text/javascript");            script.Attributes.Add("src", ResolveUrl("~/Scripts/iWebKit/javascript/functions.js"));            head.Controls.Add(script);            cssLink.Attributes.Add("rel", "stylesheet");            cssLink.Attributes.Add("href", ResolveUrl("~/Scripts/iWebKit/css/style.css") );            cssLink.Attributes.Add("type", "text/css");            head.Controls.Add(cssLink);            HtmlGenericControl jsLink = new HtmlGenericControl("script");            //jsLink.Attributes.Add("type", "text/javascript");            //jsLink.Attributes.Add("src", ResolveUrl("~/Scripts/jquery-1.4.1.min.js") );            //head.Controls.Add(jsLink);            HtmlLink appleIcon = new HtmlLink();            appleIcon.Attributes.Add("rel", "apple-touch-icon");            appleIcon.Attributes.Add("href", ResolveUrl("~/apple-touch-icon.png"));            HtmlMeta appleMobileWebAppStatusBarStyle = new HtmlMeta();            appleMobileWebAppStatusBarStyle.Attributes.Add("name", "apple-mobile-web-app-status-bar-style");            appleMobileWebAppStatusBarStyle.Attributes.Add("content", "black");            head.Controls.Add(appleMobileWebAppStatusBarStyle);    }     internal string FindPath(string Location)    {        string Url = Server.MapPath(Location);        return (Url);    }}

    Read the article

  • Convertion of tiff image in Python script - OCR using tesseract

    - by PYTHON TEAM
    I want to convert a tiff image file to text document. My code perfectly as I expected to convert tiff images with usual font but its not working for french script font . My tiff image file contains text. The font of text is in french script format.I here is my code import Image import subprocess import util import errors tesseract_exe_name = 'tesseract' # Name of executable to be called at command line scratch_image_name = "temp.bmp" # This file must be .bmp or other Tesseract-compatible format scratch_text_name_root = "temp" # Leave out the .txt extension cleanup_scratch_flag = True # Temporary files cleaned up after OCR operation def call_tesseract(input_filename, output_filename): """Calls external tesseract.exe on input file (restrictions on types), outputting output_filename+'txt'""" args = [tesseract_exe_name, input_filename, output_filename] proc = subprocess.Popen(args) retcode = proc.wait() if retcode!=0: errors.check_for_errors() def image_to_string(im, cleanup = cleanup_scratch_flag): """Converts im to file, applies tesseract, and fetches resulting text. If cleanup=True, delete scratch files after operation.""" try: util.image_to_scratch(im, scratch_image_name) call_tesseract(scratch_image_name, scratch_text_name_root) text = util.retrieve_text(scratch_text_name_root) finally: if cleanup: util.perform_cleanup(scratch_image_name, scratch_text_name_root) return text def image_file_to_string(filename, cleanup = cleanup_scratch_flag, graceful_errors=True): If cleanup=True, delete scratch files after operation.""" try: try: call_tesseract(filename, scratch_text_name_root) text = util.retrieve_text(scratch_text_name_root) except errors.Tesser_General_Exception: if graceful_errors: im = Image.open(filename) text = image_to_string(im, cleanup) else: raise finally: if cleanup: util.perform_cleanup(scratch_image_name, scratch_text_name_root) return text if __name__=='__main__': im = Image.open("/home/oomsys/phototest.tif") text = image_to_string(im) print text try: text = image_file_to_string('fnord.tif', graceful_errors=False) except errors.Tesser_General_Exception, value: print "fnord.tif is incompatible filetype. Try graceful_errors=True" print value text = image_file_to_string('fnord.tif', graceful_errors=True) print "fnord.tif contents:", text text = image_file_to_string('fonts_test.png', graceful_errors=True) print text

    Read the article

  • wxWidgets in Code::Blocks

    - by Vlad
    Hello all, I'm trying to compile the minimal sample from the "Cross-Platform GUI Programming with wxWidgets" book but the following compile errors: ||=== minimal, Debug ===| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0x918)||undefined reference to `__Unwind_Resume' | C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0x931)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0xa96)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0xada)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0xb1e)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_datacmn.o):datacmn.cpp:(.eh_frame+0x11)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x63a)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x696)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x6f2)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x74a)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x7a2)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0x88f)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0x927)||undefined reference to `__Unwind_Resume' | C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0x9bf)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0xb8b)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0xc87)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xbc0)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xc59)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xcf5)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xda6)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xdce)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x1ff)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x257)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x2af)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x2fc)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x36d)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0x4a8)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0x73a)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0x813)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0xc06)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0xd3e)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0x970)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0xa80)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0xb8c)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0xc78)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0xd4f)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x2ef)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x32b)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x43d)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x586)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x601)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_app.o):app.cpp:(.text+0x1da)||undefined reference to `__Unwind_Resume'| ||More errors follow but not being shown.| ||Edit the max errors limit in compiler options...| ||=== Build finished: 50 errors, 0 warnings ===| Here's the code sample from the book: #include "wx/wx.h" #include "mondrian.xpm" // Declare the application class class MyApp : public wxApp { public: // Called on application startup virtual bool OnInit(); }; // Declare our main frame class class MyFrame : public wxFrame { public: // Constructor MyFrame(const wxString& title); // Event handlers void OnQuit(wxCommandEvent& event); void OnAbout(wxCommandEvent& event); private: // This class handles events DECLARE_EVENT_TABLE() }; // Implements MyApp& GetApp() DECLARE_APP(MyApp) // Give wxWidgets the means to create a MyApp object IMPLEMENT_APP(MyApp) // Initialize the application bool MyApp::OnInit() { // Create the main application window MyFrame *frame = new MyFrame(wxT("Minimal wxWidgets App")); // Show it frame->Show(true); // Start the event loop return true; } // Event table for MyFrame BEGIN_EVENT_TABLE(MyFrame, wxFrame) EVT_MENU(wxID_ABOUT, MyFrame::OnAbout) EVT_MENU(wxID_EXIT, MyFrame::OnQuit) END_EVENT_TABLE() void MyFrame::OnAbout(wxCommandEvent& event) { wxString msg; msg.Printf(wxT("Hello and welcome to %s"), wxVERSION_STRING); wxMessageBox(msg, wxT("About Minimal"), wxOK | wxICON_INFORMATION, this); } void MyFrame::OnQuit(wxCommandEvent& event) { // Destroy the frame Close(); } MyFrame::MyFrame(const wxString& title) : wxFrame(NULL, wxID_ANY, title) { // Set the frame icon SetIcon(wxIcon(mondrian_xpm)); // Create a menu bar wxMenu *fileMenu = new wxMenu; // The “About” item should be in the help menu wxMenu *helpMenu = new wxMenu; helpMenu->Append(wxID_ABOUT, wxT("&About...\tF1"), wxT("Show about dialog")); fileMenu->Append(wxID_EXIT, wxT("E&xit\tAlt-X"), wxT("Quit this program")); // Now append the freshly created menu to the menu bar... wxMenuBar *menuBar = new wxMenuBar(); menuBar->Append(fileMenu, wxT("&File")); menuBar->Append(helpMenu, wxT("&Help")); // ... and attach this menu bar to the frame SetMenuBar(menuBar); // Create a status bar just for fun CreateStatusBar(2); SetStatusText(wxT("Welcome to wxWidgets!")); } So what's happenning? Thanks! P.S.: I installed wxWidgets through wxPack wich afaik comes with everything precomplied and i also added the wxWidgets directory to Global variables-base in Code::Blocks so everything should be correctly set, right?

    Read the article

  • How do i select the preceding nodes of a text node starting from a specific node and not the root no

    - by Rachel
    How do i select the preceding nodes of a text node starting from a specific node whose id i know instead of getting the text nodes from the root node? When i invoke the below piece from a template match of text node, I get all the preceding text nodes from the root. I want to modify the above piece of code to select only the text nodes that appear after the node having a specific id say 123. i.e something like //*[@id='123'] <xsl:template match="text()[. is $text-to-split]"> <xsl:variable name="split-index" as="xsd:integer" select="$index - sum(preceding::text()/string-length(.))"/> <xsl:value-of select="substring(., 1, $split-index - 1)"/> <xsl:copy-of select="$new"/> <xsl:value-of select="substring(., $split-index)"/> </xsl:template> <xsl:variable name="text-to-split" as="text()?" select="descendant::text()[sum((preceding::text(), .)/string-length(.)) ge $index][1]"/> How do i include the condition in places where i use preceding::text inorder to select preceding text nodes relative to the specific node's id which i know?

    Read the article

  • Understanding Microsoft Word Formatting Behavior. Does anyone?

    - by deemer
    This isn't a question about how to do something (well, not directly), but rather an inquiry to see if anyone understands why MS Word behaves the way it does with respect to formatting from a design perspective. This is also admittedly a rant about Word. This is a question that has plagued me, well, every time I open a document in Word, and covers a lot of individual topics, so I'll restrict the discussion here to two concrete behaviors that baffle me. 1) Backspacing over whitespace changes the format of preceding text. This seems to most often occur when the preceding text is a header or list number. The strangest thing about this is the new format of the changed text usually doesn't appear anywhere else in the document. 2) Numbered lists count almost at random. I am working on a document today where the list numbers count as follows: 1, 2, 2, 3, 3. The lettering in the sublists go like this 1: a, 2: a, 2: b c d, 3: e f g, 3: a. Clicking on each number or letter highlights the other numbers or letters that Word thinks it is related to, which are scattered around the document pretty heavily. Attempts to renumber the list have so far proven fruitless, as Word seems to maintain these associations through clipboard copies, etc. Why could this even happen?

    Read the article

  • Write file at a specific value and line

    - by user2828891
    I want to write data at a specified value in a text file from a text box. Here is a example: item_begin etcitem 3344 item_type=etcitem is first line and item_begin weapon 3343 item_type=weapon is second. Well i want to replace item_type=weapon at second line with item_type=armor. Here is code so far: var data2 = File.WriteAllLines("itemdata.txt") .Where(x => x.Contains("3343")) .Take(1) .SelectMany(x => x.Split('\t')) .Select(x => x.Split('=')) .Where(x => x.Length > 1) .ToDictionary(x => x[0].Trim(), x => x[1]); But returns error at WriteAllLines. Here is the readline part code: var data = File.ReadLines("itemdata.txt") .Where(x => x.Contains("3343")) .Take(1) .SelectMany(x => x.Split('\t')) .Select(x => x.Split('=')) .Where(x => x.Length > 1) .ToDictionary(x => x[0].Trim(), x => x[1]); //call values textitem_type.Text = data["item_type"]; And want to write the same value I change on textitem_type.Text after read. I used this to reaplace but replaces all values with same name from line and returns me in text only 1 line. Code: private void button2_Click(object sender, EventArgs e) { var data = File .ReadLines("itemdata.txt") .Where(x => x.Contains(itemSrchtxt.Text)) .Take(1) .SelectMany(x => x.Split('\t')) .Select(x => x.Split('=')) .Where(x => x.Length > 1) .ToDictionary(x => x[0].Trim(), x => x[1]); StreamReader reader = new StreamReader(Directory.GetCurrentDirectory() + @"\itemdata.txt"); string content = reader.ReadLine(); reader.Close(); content = Regex.Replace(content, data["item_type"], textitem_type.Text); StreamWriter write = new StreamWriter(Directory.GetCurrentDirectory() + @"\itemdata.txt"); write.WriteLine(content); write.Close(); }

    Read the article

  • Disabling text selection in DocumentViewer

    - by bjutus
    Hello! Simple question. How do you disable the text selection of DocumentViewer in WPF? This is the feature where an XPS document is displayed by the viewer and then text can be highlighted via mouse. The highlighted text can also be copied but I have already disabled this. I just don't know how to disable the highlighting. Thanks!

    Read the article

  • WPF: TextBox expanding with surrounding Grid but not with text

    - by haagel
    I have a problem with a TextBox in an application... A window has a Grid with two columns. The left column contains a control with a constant width but with a height that adapts. The right column contains a TextBox that takes up all remaining space in the Grid (and thereby in the Window). The Grid is given a minimal width and height and is wrapped within a ScrollViewer. If the user resizes the window to be smaller than the minimal widht/height of the Grid, scrollbars are displayed. This is exactly how I want it to be. However, a problem occurs when the user starts typing text. If the text is to long to fit in one line in the TextBox, I want the text to wrap. Therefore I set TextWrapping="Wrap" on the TextBox. But since the TextBox has an automatic width and is wrapped in a ScrollViewer (its actually the whole Grid that is wrapped), the TextBox just keeps expanding to the right. I do want the TextBox to expand if the window is expanded, but I don't want the TextBox to expand by the text. Rather the text should wrap inside the available TextBox. If the text don't fit within the TextBox height, a scrollbar should be displayed within the TextBox. Is there a way to accomplish this? Below is some code that shows my problem. <Window x:Class="AdaptingTextBoxes.MainWindow" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="MainWindow" Height="300" Width="400" Background="DarkCyan"> <Grid Margin="10" Name="LayoutRoot"> <ScrollViewer HorizontalScrollBarVisibility="Auto" VerticalScrollBarVisibility="Auto"> <Grid MinWidth="300" MinHeight="200"> <Grid.ColumnDefinitions> <ColumnDefinition Width="auto" /> <ColumnDefinition Width="*" /> </Grid.ColumnDefinitions> <Button Grid.Column="0" Margin="0,0,10,0" Content="Button" Width="100" /> <TextBox Grid.Column="1" AcceptsReturn="True" TextWrapping="Wrap" ScrollViewer.HorizontalScrollBarVisibility="Disabled" ScrollViewer.VerticalScrollBarVisibility="Auto" /> </Grid> </ScrollViewer> </Grid> </Window>

    Read the article

  • Using VTD-XML to modify element text only

    - by Algorist
    Hi, I want to achieve below thing in vtd-xml xml modifier class. Original xml <xml> <element attr1='1' attr2='2' attr3='3'>text</element> </xml> int p = vn.getText() xm.updateToken(p, "new text"); But the code here is not modifying the text to new text. Any idea how to achieve this? Other option is to call xm.remove() and then add tag. But, I am not able to retain the attributes. Thank you Bala

    Read the article

  • flex combobox backspace or delete key does not delete highlighted text

    - by crazy horse
    Context: I am implementing a flex auto-suggest combobox - as the user types in each character: Consider the string 'Stackoverflow' and user input = 'st' 1) the data provider is filtered to show all items starting with 'st' 2) text is set to auto-suggest string such that the un-typed part is highlighted. So for instance, the combobox text may contain st'ackoverflow', where 'ackoverflow' is highlighted using setSelectedIndex() Issue: When I hit back-space or delete, and check the 'this.text' value, I expect that the last un-highlighted character ('t' in the above case) gets deleted and the data provider is filtered to show all items starting with 's'. However the text property contains 'st', as before Question: what am I missing? What else can I try out?

    Read the article

  • [Android] How to search and Highlight Text within an EditText

    - by marc
    I've searched high and low for something that seems to be a simple task. Forgive me, I am coming to Android from other programming languages and am new to this platform and Java. What I want to do is create a dialog pop-up where a user enters text to search for and the code would take that text and search for it within all the text in an EditText control and if it's found, highlight it. I've done this before, for example in VB and it went something similar to this pseudo code: grab the text from the (EditText) assign it to a string search the length of that string (character by character) for the substring, if it's found return the position (index) of the substring within the string. if found, start the (EditText).setSelection highlight beginning on the returned position for the length of Does this make sense? I just want to search a EditText for and when found, scroll to it and it'll be highlighted. Maybe there's something in Android/Java equivalent to what I need here? Any help / pointers would be greatly appreciated

    Read the article

  • Delphi TBytesField - How to see the text properly - Source is HIT OLEDB AS400

    - by myitanalyst
    We are connecting to a multi-member AS400 iSeries table via HIT OLEDB and HIT ODBC. You connect to this table via an alias to access a specific multi-member. We create the alias on the AS400 this way: CREATE ALIAS aliasname FOR table(membername) We can then query each member of the table this way: SELECT * FROM aliasname We are testing this in Delphi6 first, but will move it to D2010 later We are using HIT OLEDB for the AS400. We are pulling down records from a table and the field is being seen as a tBytesField. I have also tried ODBC driver and it sees as tBytesField as well. Directly on the AS400 I can query the data and see readable text. I can use the iSeries Navigation tool and see readable text as well. However when I bring it down to the Delphi client via the HIT OLEDB or HIT ODBC and try to view via asString then I just see unreadable text.. something like this: ñðð@ðõñððððñ÷@õôððõñòøóóöøñðÂÁÕÒ@ÖÆ@ÁÔÅÙÉÃÁ@@@@@@@@ÂÈÙÉâãæÁðòñè@ÔK@k@ÉÕÃK@@@@@@@@@ç I jumbled up the text above, but that is the character types that show up. When I did a test in D2010 the text looks like japanse or chinese characters, but if I display as AnsiString then it looks like what it does in Delphi 6. I am thinking this may have something to do with code pages or character sets, but I have no experience in this are so it is new to me if it is related. When I look at the Coded Character Set on the AS400 it is set to 65535. What do I need to do to make this text readable? We do have a third party component (Delphi400) that makes things behave in a more native AS400 manner. When I use its AS400 connection and AS400 query components it shows the field as a tStringField and displays just fine. BUT we are phasing out this product (for a number of reasons) and would really like the OLEDB with the ADO components work. Just for clarification the HIT OLEDB with tADOQuery do have some fields showing as tStringFields for many of the other tables we use... not sure why it is showing as a tBytesField in this case. I am not an AS400 expert, but looking at the field definititions on the AS400 the ones showing up as tBytesField look the same as the ones showing up as tStringFields... but there must be a difference. Maybe due to being a multi-member? So... does anyone have any guidance on how to get the correct string data that is readable? If you need more info please ask. Greg

    Read the article

  • RadioButton text alignment

    - by melling
    For some reason the text on each of my RadioButtons is raised, almost to the level of a superscript (ok maybe half way there). How do I set the text to align so that if I could draw a line through the center of the button and have it intersect with the center point of the text? * Button1 * Button2

    Read the article

< Previous Page | 67 68 69 70 71 72 73 74 75 76 77 78  | Next Page >