Search Results

Search found 26947 results on 1078 pages for 'util linux'.

Page 738/1078 | < Previous Page | 734 735 736 737 738 739 740 741 742 743 744 745  | Next Page >

  • SWT Drag and Drop support for Text widget

    - by bryantsai
    I've written an application recently using SWT. In one of its dialog box, I have a few widgets, one of which is Text, which is designed to support DND with other widgets. I've first added DND support for the 2 Tree widgets on the same dialog box (both drag source and drop target). Before I added DND support for that Text widget, I noticed that on Linux platform (gtk), SWT Text widget automatically get drag and drop support. That is, I can already drag from the other Tree widgets and drop on this Text (at any position to inserted there), as well as selecting and dragging any text from this Text to other Tree or Text widget. However, this is only working on Linux platform but not on Windows. The same program, if running on Windows, will not have any DND support for that Text widget (Tree widgets of course have DND support since I specifically write for them). So here's what I want to achieve on Windows as well: drop text at any position in Text widget. before dropping and while hovering, able to see the caret position clearly where the intended position to drop. caret position should move along with the mouse cursor. support multi-line in Text widget SOLUTION: DropTarget target = new DropTarget(sytledText, DND.DROP_MOVE | DND.DROP_COPY); target.setTransfer(new Transfer[] { TextTransfer.getInstance() }); target.addDropListener(new StyleTextDropTargetEffect(sytledText)); Use StyledText instead of Text widget Use StyledTextDropTargetEffect (or extend it) and add it as dr op listener

    Read the article

  • a question on webpage data scraping using Java

    - by Gemma
    Hi there. I am now trying to implement a simple HTML webpage scraper using Java.Now I have a small problem. Suppose I have the following HTML fragment. <div id="sr-h-left" class="sr-comp"> <a class="link-gray-underline" id="compare_header" rel="nofollow" href="javascript:i18nCompareProd('/serv/main/buyer/ProductCompare.jsp?nxtg=41980a1c051f-0942A6ADCF43B802'); " Compare Showing 1 - 30 of 1,439 matches, The data I am interested is the integer 1.439 shown at the bottom.I am just wondering how can I get that integer out of the HTML. I am now considering using a regular expression,and then use the java.util.Pattern to help get the data out,but still not very clear about the process. I would be grateful if you guys could give me some hint or idea on this data scraping. Thanks a lot.

    Read the article

  • how to use an array list ?

    - by soad El-hayek
    salam 3lekom i need to know if i store my data in an Araaylist and i need to get the value that i've stroed in it for example : if i've an array list like this ArrayList A = new ArrayList(); A = {"Soad", "mahran"}; and i want to get each String lonly how can i do it ? I've tried to do it like this package arraylist; import java.util.ArrayList; public class Main { public static void main(String[] args) { ArrayList S = new ArrayList(); String A = "soad "; S.add(A); S.add("A"); String F = S.toString(); System.out.println(F); String [] W = F.split(","); for(int i=0 ; i<W.length ; i++) { System.out.println(W[i]); } } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • input file cannot be found

    - by Eric Smith
    I am just messing around with reading input files with java until I got stumped at the most basic of steps... finding the input file! The input.txt file is in the same directory as my class file that is calling it yet eclipse still gives me an error that it cant be found: "Exception in thread "main" java.lang.Error: Unresolved compilation problem: Unhandled exception type FileNotFoundException" My code: package pa; import java.util.Scanner; public class Project { public static void main(String[] args) { java.io.File file = new java.io.File("input.txt"); System.out.println(file.getAbsolutePath()); Scanner input = new Scanner(file); } } input.txt is in the same package, same folder and everything. I'm confused :(

    Read the article

  • In terminal, merging multiple folders into one.

    - by Josh Pinter
    I have a backup directory created by WDBackup (western digital external HD backup util) that contains a directory for each day that it backed up and the incremental contents of just what was backed up. So the hierarchy looks like this: 20100101 My Documents Letter1.doc My Music Best Songs Every First Songs.mp3 My song.mp3 # modified 20100101 20100102 My Documents Important Docs Taxes.doc My Music My Song.mp3 # modified 20100102 ...etc... Only what has changed is backed up and the first backup that was ever made contains all the files selected for backup. What I'm trying to do now is incrementally copy, while keeping the folder structure, from oldest to newest, each of these dated folders into a 'merged' folder so that it overrides the older content and keeps the new stuff. As an example, if just using these two example folders, the final merged folder would look like this: Merged My Documents Important Docs Taxes.doc Letter1.doc My Music Best Songs Every First Songs.mp3 My Song.mp3 # modified 20100102 Hope that makes sense. Thanks, Josh

    Read the article

  • git crlf configuration in mixed environment

    - by Jonas Byström
    I'm running a mixed environment, and keep a central, bare repository where I pull and push most of my stuff. This centralized repository runs on Linux, and I check out to Windows XP/7, Mac and Linux. In all repositories I put the following line in my .git/config: [core] autocrlf = true I don't have the flag safecrlf=true anywhere. First time when I modify stuff on my one Windows machine (XP) there is no problem and when I look at the diff, it looks fine. But when I do the same on the other Windows machine (7), all lines are shown as changed but local line endings are \r\n as expected (when checked in a hex editor). The same applies to a MacOSX can. Sometimes I get the feeling that the different systems wrestle on line endings, but I can't be sure (I'm loosing track of all the times I change specific files). I didn't use to have the autocrlf set, but set the flag many months back. Could that be causing my current problems? Do I need to clone everything again to loose some old baggage? Or are there other things that needs configuring too? I tried git checkout -- . about a million times, but with no success.

    Read the article

  • How to implement blocking request-reply using Java concurrency primitives?

    - by Uri
    My system consists of a "proxy" class that receives "request" packets, marshals them and sends them over the network to a server, which unmarshals them, processes, and returns some "response packet". My "submit" method on the proxy side should block until a reply is received to the request (packets have ids for identification and referencing purposes) or until a timeout is reached. If I was building this in early versions of Java, I would likely implement in my proxy a collection of "pending messages ids", where I would submit a message, and wait() on the corresponding id (with a timeout). When a reply was received, the handling thread would notify() on the corresponding id. Is there a better way to achieve this using an existing library class, perhaps in java.util.concurrency? If I went with the solution described above, what is the correct way to deal with the potential race condition where a reply arrives before wait() is invoked?

    Read the article

  • How to use LocalValueBean in jsp page.

    - by Himanshu
    I have set certain bean label and bean value in one of my dao class.. I have created a list of LocalValueBean objects and passed it as a list to jsp.. now here at jsp i need to print the label seperately and on hover to the label i need to show the value.. i need to exttract or to say get those values in jsp directly... i have also imported the org.apache.struts.util.LabelValueBean in my jsp but still its not working.. please let me know if you any ideas...

    Read the article

  • How to write to an XML file inside a jar file?

    - by cancelledout
    Hi Java programmers. I badly need your help. I have a JavaFX/Java ME application. I'm trying to modify an XML file inside my project's folder (soon to be packaged jar file). The path of the file I want to write: /parseExample/service1.xml Sadly, my application is a JavaFx/JavaME so it doesn't contain the library java.util.jar. So I can't use the jar classes. Are there other ways to do that?

    Read the article

  • How can I launch a system command via Javascript in Google Chrome?

    - by kvsn
    I want to execute a local program on my computer via Javascript in Chrome. In Firefox, it can be done as follows (after setting 'signed.applets.codebase_principal_support' to true in about:config): function run_cmd(cmd, args) { netscape.security.PrivilegeManager.enablePrivilege("UniversalXPConnect"); var file = Components.classes["@mozilla.org/file/local;1"] .createInstance(Components.interfaces.nsILocalFile); file.initWithPath(cmd); var process = Components.classes["@mozilla.org/process/util;1"] .createInstance(Components.interfaces.nsIProcess); process.init(file); process.run(false, args, args.length); } What's the equivalent code for Chrome?

    Read the article

  • Help me with the simplest program for "Trusted" application

    - by idazuwaika
    Hi, I hope anyone from the large community here can help me write the simplest "Trusted" program that I can expand from. I'm using Ubuntu Linux 9.04, with TPM emulator 0.60 from Mario Strasser (http://tpm-emulator.berlios.de/). I have installed the emulator and Trousers, and can successfully run programs from tpm-tools after running tpmd and tcsd daemons. I hope to start developing my application, but I have problems compiling the code below. #include <trousers/tss.h> #include <trousers/trousers.h> #include <stdio.h> TSS_HCONTEXT hContext; int main() { Tspi_Context_Create(&hContext); Tspi_Context_Close(hContext); return 0; } After trying to compile with g++ tpm.cpp -o tpmexe I receive errors undefined reference to 'Tspi_Context_Create' undefined reference to 'Tspi_Context_Close' What do I have to #include to successfully compile this? Is there anything that I miss? I'm familiar with C, but not exactly so with Linux/Unix programming environment. ps: I am a part time student in Master in Information Security programme. My involvement with programming has been largely for academic purposes.

    Read the article

  • How to determine values saved on the stack?

    - by Brian
    I'm doing some experimenting and would like to be able to see what is saved on the stack during a system call (the saved state of the user land process). According to http://lxr.linux.no/#linux+v2.6.30.1/arch/x86/kernel/entry_32.S it shows that the various values of registers are saved at those particular offsets to the stack pointer. Here is the code I have been trying to use to examine what is saved on the stack (this is in a custom system call I have created): asm("movl 0x1C(%esp), %ecx"); asm("movl %%ecx, %0" : "=r" (value)); where value is an unsigned long. As of right now, this value is not what is expected (it is showing a 0 is saved for the user value of ds). Am I correctly accessing the offset of the stack pointer? Another possibility might be could I use a debugger such as GDB to examine the stack contents while in the kernel? I don't have much extensive use with debugging and am not sure of how to debug code inside the kernel. Any help is much appreciated.

    Read the article

  • Copying a java text file into a String.

    - by Deepak Konidena
    Hi, I run into the following errors when i try to store a large file into a string. Exception in thread "main" java.lang.OutOfMemoryError: Java heap space at java.util.Arrays.copyOf(Arrays.java:2882) at java.lang.AbstractStringBuilder.expandCapacity(AbstractStringBuilder.java:100) at java.lang.AbstractStringBuilder.append(AbstractStringBuilder.java:515) at java.lang.StringBuffer.append(StringBuffer.java:306) at rdr2str.ReaderToString.main(ReaderToString.java:52) As is evident, i am running out of heap space. Basically my pgm looks like something like this. FileReader fr = new FileReader(<filepath>); sb = new StringBuffer(); char[] b = new char[BLKSIZ]; while ((n = fr.read(b)) > 0) sb.append(b, 0, n); fileString = sb.toString(); Can someone suggest me why i am running into heap space error? Thanks.

    Read the article

  • Stuck with the first record while parsing an XML in Java

    - by Ritwik G
    I am parsing the following XML : <table ID="customer"> <T><C_CUSTKEY>1</C_CUSTKEY><C_NAME>Customer#000000001</C_NAME><C_ADDRESS>IVhzIApeRb ot,c,E</C_ADDRESS><C_NATIONKEY>15</C_NATIONKEY><C_PHONE>25-989-741-2988</C_PHONE><C_ACCTBAL>711.56</C_ACCTBAL><C_MKTSEGMENT>BUILDING</C_MKTSEGMENT><C_COMMENT>regular, regular platelets are fluffily according to the even attainments. blithely iron</C_COMMENT></T> <T><C_CUSTKEY>2</C_CUSTKEY><C_NAME>Customer#000000002</C_NAME><C_ADDRESS>XSTf4,NCwDVaWNe6tEgvwfmRchLXak</C_ADDRESS><C_NATIONKEY>13</C_NATIONKEY><C_PHONE>23-768-687-3665</C_PHONE><C_ACCTBAL>121.65</C_ACCTBAL><C_MKTSEGMENT>AUTOMOBILE</C_MKTSEGMENT><C_COMMENT>furiously special deposits solve slyly. furiously even foxes wake alongside of the furiously ironic ideas. pending</C_COMMENT></T> <T><C_CUSTKEY>3</C_CUSTKEY><C_NAME>Customer#000000003</C_NAME><C_ADDRESS>MG9kdTD2WBHm</C_ADDRESS><C_NATIONKEY>1</C_NATIONKEY><C_PHONE>11-719-748-3364</C_PHONE><C_ACCTBAL>7498.12</C_ACCTBAL><C_MKTSEGMENT>AUTOMOBILE</C_MKTSEGMENT><C_COMMENT>special packages wake. slyly reg</C_COMMENT></T> <T><C_CUSTKEY>4</C_CUSTKEY><C_NAME>Customer#000000004</C_NAME><C_ADDRESS>XxVSJsLAGtn</C_ADDRESS><C_NATIONKEY>4</C_NATIONKEY><C_PHONE>14-128-190-5944</C_PHONE><C_ACCTBAL>2866.83</C_ACCTBAL><C_MKTSEGMENT>MACHINERY</C_MKTSEGMENT><C_COMMENT>slyly final accounts sublate carefully. slyly ironic asymptotes nod across the quickly regular pack</C_COMMENT></T> <T><C_CUSTKEY>5</C_CUSTKEY><C_NAME>Customer#000000005</C_NAME><C_ADDRESS>KvpyuHCplrB84WgAiGV6sYpZq7Tj</C_ADDRESS><C_NATIONKEY>3</C_NATIONKEY><C_PHONE>13-750-942-6364</C_PHONE><C_ACCTBAL>794.47</C_ACCTBAL><C_MKTSEGMENT>HOUSEHOLD</C_MKTSEGMENT><C_COMMENT>blithely final instructions haggle; stealthy sauternes nod; carefully regu</C_COMMENT></T> </table> with the following java code: package xmlparserformining; import java.util.List; import java.util.Iterator; import org.dom4j.Document; import org.dom4j.DocumentException; import org.dom4j.Node; import org.dom4j.io.SAXReader; public class XmlParserForMining { public static Document getDocument( final String xmlFileName ) { Document document = null; SAXReader reader = new SAXReader(); try { document = reader.read( xmlFileName ); } catch (DocumentException e) { e.printStackTrace(); } return document; } public static void main(String[] args) { String xmlFileName = "/home/r/javaCodez/parsing in java/customer.xml"; String xPath = "//table/T/C_ADDRESS"; Document document = getDocument( xmlFileName ); List<Node> nodes = document.selectNodes( xPath ); System.out.println(nodes.size()); for (Node node : nodes) { String customer_address = node.valueOf(xPath); System.out.println( "Customer address: " + customer_address); } } } However, instead of getting all the various customer records, I am getting the following output: 1500 Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E and so on .. What is wrong here? Why is it printing only the first record ?

    Read the article

  • Extjs - Getting more from the server

    - by fatnjazzy
    Hi, Is it possible to get every data from the server? for example, i want to get the columns items from the server Via Ajax/Proxy by sending json string? thanks var grid = new Ext.grid.GridPanel({ store: store, columns: [ {id:'company',header: 'Company', width: 160, sortable: true, dataIndex: 'company'}, {header: 'Price', width: 75, sortable: true, renderer: 'usMoney', dataIndex: 'price'}, {header: 'Change', width: 75, sortable: true, renderer: change, dataIndex: 'change'}, {header: '% Change', width: 75, sortable: true, renderer: pctChange, dataIndex: 'pctChange'}, {header: 'Last Updated', width: 85, sortable: true, renderer: Ext.util.Format.dateRenderer('m/d/Y'), dataIndex: 'lastChange'} ], stripeRows: true, autoExpandColumn: 'company', height: 350, width: 600, title: 'Array Grid', stateful: true, stateId: 'grid' });

    Read the article

  • How do implement a breadth first traversal?

    - by not looking for answer
    //This is what I have. I thought pre-order was the same and mixed it up with depth first! import java.util.LinkedList; import java.util.Queue; public class Exercise25_1 { public static void main(String[] args) { BinaryTree tree = new BinaryTree(new Integer[] {10, 5, 15, 12, 4, 8 }); System.out.print("\nInorder: "); tree.inorder(); System.out.print("\nPreorder: "); tree.preorder(); System.out.print("\nPostorder: "); tree.postorder(); //call the breadth method to test it System.out.print("\nBreadthFirst:"); tree.breadth(); } } class BinaryTree { private TreeNode root; /** Create a default binary tree */ public BinaryTree() { } /** Create a binary tree from an array of objects */ public BinaryTree(Object[] objects) { for (int i = 0; i < objects.length; i++) { insert(objects[i]); } } /** Search element o in this binary tree */ public boolean search(Object o) { return search(o, root); } public boolean search(Object o, TreeNode root) { if (root == null) { return false; } if (root.element.equals(o)) { return true; } else { return search(o, root.left) || search(o, root.right); } } /** Return the number of nodes in this binary tree */ public int size() { return size(root); } public int size(TreeNode root) { if (root == null) { return 0; } else { return 1 + size(root.left) + size(root.right); } } /** Return the depth of this binary tree. Depth is the * number of the nodes in the longest path of the tree */ public int depth() { return depth(root); } public int depth(TreeNode root) { if (root == null) { return 0; } else { return 1 + Math.max(depth(root.left), depth(root.right)); } } /** Insert element o into the binary tree * Return true if the element is inserted successfully */ public boolean insert(Object o) { if (root == null) { root = new TreeNode(o); // Create a new root } else { // Locate the parent node TreeNode parent = null; TreeNode current = root; while (current != null) { if (((Comparable)o).compareTo(current.element) < 0) { parent = current; current = current.left; } else if (((Comparable)o).compareTo(current.element) > 0) { parent = current; current = current.right; } else { return false; // Duplicate node not inserted } } // Create the new node and attach it to the parent node if (((Comparable)o).compareTo(parent.element) < 0) { parent.left = new TreeNode(o); } else { parent.right = new TreeNode(o); } } return true; // Element inserted } public void breadth() { breadth(root); } // Implement this method to produce a breadth first // search traversal public void breadth(TreeNode root){ if (root == null) return; System.out.print(root.element + " "); breadth(root.left); breadth(root.right); } /** Inorder traversal */ public void inorder() { inorder(root); } /** Inorder traversal from a subtree */ private void inorder(TreeNode root) { if (root == null) { return; } inorder(root.left); System.out.print(root.element + " "); inorder(root.right); } /** Postorder traversal */ public void postorder() { postorder(root); } /** Postorder traversal from a subtree */ private void postorder(TreeNode root) { if (root == null) { return; } postorder(root.left); postorder(root.right); System.out.print(root.element + " "); } /** Preorder traversal */ public void preorder() { preorder(root); } /** Preorder traversal from a subtree */ private void preorder(TreeNode root) { if (root == null) { return; } System.out.print(root.element + " "); preorder(root.left); preorder(root.right); } /** Inner class tree node */ private class TreeNode { Object element; TreeNode left; TreeNode right; public TreeNode(Object o) { element = o; } } }

    Read the article

  • grails date from params in controller

    - by nils petersohn
    y is it so hard to extract the date from the view via the params in a grails controller? i don't want to extract the date by hand like this: instance.dateX = parseDate(params["dateX_value"])//parseDate is from my helper class i just want to use instance.properties = params you know :) in the model the type is java.util.Date and in the params is all the information (dateX_month, dateX_day, ...) i searched on the net and found nothing on this :( i hoped that grails 1.3.0 could help but still the same thing. i can't and will not belief that extracting the date by hand is nessesary!

    Read the article

  • Qt4Dotnet on Mac OS X

    - by Tony
    Hello everyone. I'm using Qt4Dotnet project in order to port application originally written in C# on Linux and Mac. Port to Linux hasn't taken much efforts and works fine. But Mac (10.4 Tiger) is a bit more stubborn. The problem is: when I try to start my application it throws an exception. Exception states that com.trolltech.qt.QtJambi_LibraryInitializer is unable to find all necessary ibraries. QtJambi library initializer uses java.library.path VM environment variable. This variable includes current working directory. I put all necessary libraries in a working directory. When I try to run the application from MonoDevelop IDE, initializer is able to load one library, but the other libraries are 'missing': An exception was thrown by the type initializer for com.trolltech.qt.QtJambi_LibraryInitializer --- java.lang.RuntimeException: Loading library failed, progress so far: No 'qtjambi-deployment.xml' found in classpath, loading libraries via 'java.library.path' Loading library: 'libQtCore.4.dylib'... - using 'java.library.path' - ok, path was: /Users/chin/test/bin/Debug/libQtCore.4.dylib Loading library: 'libqtjambi.jnilib'... - using 'java.library.path' Both libQtCore.4.dylib and libqtjambi.jnilib are in the same directory. When I try to run it from the command prompt, the initializer is unable to load even libQtCore.4.dylib. I'm using Qt4Dotnet v4.5.0 (currently the latest) with QtJambi v4.5.2 libraries. This might be the source of the problem, but I'm neither able to compile Qt4Dotnet v4.5.2 by myself nor to find QtJambi v4.5.0 libraries. Project's page states that some sort of patch should be applied to QtJambi's source code in order to be compatible with Mono framework, but this patch hasn't been released yet. Without this patch application crashes in a strange manner (other than library seek fault). I must note that original QtJambi loads all necessary libraries perfectly, so it might be issues of IKVM compiler used to translate QtJambi into .Net library. Any suggestions how can I overcome this problem?

    Read the article

  • "You have already activated" message even when using bundle exec

    - by juanpastas
    I am installing gems in my Gemfile in shared path as Capistrano does by default, and when I run: bundle exec rake assets:precompile RAILS_ENV=production I get: You have already activated rake 0.9.2.2, but your Gemfile requires rake 10.0.4. Using bundle exec may solve this. See that: cat Gemfile.lock | grep rake returns: rake (>= 0.8.7) rake (10.0.4) This is my gem environment output: - RUBYGEMS VERSION: 1.8.24 - RUBY VERSION: 1.9.3 (2013-06-27 patchlevel 448) [x86_64-linux] - INSTALLATION DIRECTORY: /home/bitnami/my_app/shared/bundle/ruby/1.9.1/ - RUBY EXECUTABLE: /opt/bitnami/ruby/bin/ruby - EXECUTABLE DIRECTORY: /home/bitnami/my_app/shared/bundle/ruby/1.9.1/bin - RUBYGEMS PLATFORMS: - ruby - x86_64-linux - GEM PATHS: - /home/bitnami/my_app/shared/bundle/ruby/1.9.1/ - GEM CONFIGURATION: - :update_sources => true - :verbose => true - :benchmark => false - :backtrace => false - :bulk_threshold => 1000 - "gemhome" => "/home/bitnami/my_app/shared/bundle/ruby/1.9.1/" - "gempath" => ["/home/bitnami/my_app/shared/bundle/ruby/1.9.1/"] - REMOTE SOURCES: - http://rubygems.org/ Update which -a rake /opt/bitnami/rvm/bin/rake /opt/bitnami/ruby/bin/rake Update 2 I tried giving full path to rake, but same problem

    Read the article

  • Creating a simple command line interface (CLI) using a python server (TCP sock) and few scripts

    - by VN44CA
    I have a Linux box and I want to be able to telnet into it (port 77557) and run few required commands without having to access to the whole Linux box. So, I have a server listening on that port, and echos the entered command on the screen. (for now) Telnet 192.168.1.100 77557 Trying 192.168.1.100... Connected to 192.168.1.100. Escape character is '^]'. hello<br /> You typed: "hello"<br /> NOW: I want to create lot of commands that each take some args and have error codes. Anyone has done this before? It would be great if I can have the server upon initialization go through each directory and execute the init.py file and in turn, the init.py file of each command call into a main template lib API (e.g. RegisterMe()) and register themselves with the server as function call backs. At least this is how I would do it in C/C++. But I want the best Pythonic way of doing this. /cmd/ /cmd/myreboot/ /cmd/myreboot/ini.py (note underscore don't show for some reason) /cmd/mylist/ /cmd/mylist/init.py ... etc IN: /cmd/myreboot/_ini_.py: from myMainCommand import RegisterMe RegisterMe(name="reboot",args=Arglist, usage="Use this to reboot the box", desc="blabla") So, repeating this creates a list of commands and when you enter the command in the telnet session, then the server goes through the list, matches the command and passed the args to that command and the command does the job and print the success or failure to stdout. Thx

    Read the article

  • Cross compiling from MinGW on Fedora 12 to Windows - console window?

    - by elcuco
    After reading this article http://lukast.mediablog.sk/log/?p=155 I decided to use mingw on linux to compile windows applications. This means I can compile, test, debug and release directly from Linux. I hacked this build script which will cross compile the application and even package it in a ZIP file. Note that I am using out of source builds for QMake (did you even know this is supported? wow...). Also note that the script will pull the needed DLLs automagically. Here is the script for you all internets to use and abuse: #! /bin/sh set -x set -e VERSION=0.1 PRO_FILE=blabla.pro BUILD_DIR=mingw_build DIST_DIR=blabla-$VERSION-win32 # clean up old shite rm -fr $BUILD_DIR mkdir $BUILD_DIR cd $BUILD_DIR # start building QMAKESPEC=fedora-win32-cross qmake-qt4 QT_LIBINFIX=4 config=\"release\ quiet\" ../$PRO_FILE #qmake-qt4 -spec fedora-win32-cross make DLLS=`i686-pc-mingw32-objdump -p release/*.exe | grep dll | awk '{print $3}'` for i in $DLLS mingwm10.dll ; do f=/usr/i686-pc-mingw32/sys-root/mingw/bin/$i if [ ! -f $f ]; then continue; fi cp -av $f release done mkdir -p $DIST_DIR mv release/*.exe $DIST_DIR mv release/*.dll $DIST_DIR zip -r ../$DIST_DIR.zip $DIST_DIR The compiled binary works on the Windows7 machine I tested. Now to the questions: When I execute the application on Windows, the theme is not the Windows7 theme. I assume I am missing a style module, I am not really sure yet. The application gets a console window for some reason. The second point (the console window) is critical. How can I remove this background window? Please note that the extra config lines are not working for me, what am I missing there?

    Read the article

  • java.io in debian

    - by Stig
    Hello, i try to compile a java program but in the import section of the code fails: import java.net.; import java.io.; import java.util.; import java.text.; import java.awt.; //import java.awt.image.; import java.awt.event.; //import java.awt.image.renderable.; import javax.swing.; import javax.swing.border.; //import javax.swing.border.EtchedBorder; //import javax.media.jai.; //import javax.media.jai.operator.; //import com.sun.media.jai.codec.; //import java.lang.reflect.; how can i fix the problem in a linux debian machine?. Thanks

    Read the article

  • Comparing two java objects on fly (data type not known)

    - by Narendra
    Hi All, I need to compare different data objects. Can any one tell me how can i do this. I don't know what are the data types i will get priorly. If i need to use any util from apache commons then please give reference to it. At present I am using .equals() for comparing equality of objects .It is working fine when I am comparing quality for two strings. If i am comparing java.sql.date data type then it is showing unequal even though both contains same values. Can any one suggest me on this regard. Thanks, Narendra

    Read the article

  • Cryptography: best practices for keys in memory?

    - by Johan
    Background: I got some data encrypted with AES (ie symmetric crypto) in a database. A server side application, running on a (assumed) secure and isolated Linux box, uses this data. It reads the encrypted data from the DB, and writes back encrypted data, only dealing with the unencrypted data in memory. So, in order to do this, the app is required to have the key stored in memory. The question is, is there any good best practices for this? Securing the key in memory. A few ideas: Keeping it in unswappable memory (for linux: setting SHM_LOCK with shmctl(2)?) Splitting the key over multiple memory locations. Encrypting the key. With what, and how to keep the...key key.. secure? Loading the key from file each time its required (slow and if the evildoer can read our memory, he can probably read our files too) Some scenarios on why the key might leak: evildoer getting hold of mem dump/core dump; bad bounds checking in code leading to information leakage; The first one seems like a good and pretty simple thing to do, but how about the rest? Other ideas? Any standard specifications/best practices? Thanks for any input!

    Read the article

< Previous Page | 734 735 736 737 738 739 740 741 742 743 744 745  | Next Page >