Search Results

Search found 19539 results on 782 pages for 'pretty print'.

Page 768/782 | < Previous Page | 764 765 766 767 768 769 770 771 772 773 774 775  | Next Page >

  • improving conversions to binary and back in C#

    - by Saad Imran.
    I'm trying to write a general purpose socket server for a game I'm working on. I know I could very well use already built servers like SmartFox and Photon, but I wan't to go through the pain of creating one myself for learning purposes. I've come up with a BSON inspired protocol to convert the the basic data types, their arrays, and a special GSObject to binary and arrange them in a way so that it can be put back together into object form on the client end. At the core, the conversion methods utilize the .Net BitConverter class to convert the basic data types to binary. Anyways, the problem is performance, if I loop 50,000 times and convert my GSObject to binary each time it takes about 5500ms (the resulting byte[] is just 192 bytes per conversion). I think think this would be way too slow for an MMO that sends 5-10 position updates per second with a 1000 concurrent users. Yes, I know it's unlikely that a game will have a 1000 users on at the same time, but like I said earlier this is supposed to be a learning process for me, I want to go out of my way and build something that scales well and can handle at least a few thousand users. So yea, if anyone's aware of other conversion techniques or sees where I'm loosing performance I would appreciate the help. GSBitConverter.cs This is the main conversion class, it adds extension methods to main datatypes to convert to the binary format. It uses the BitConverter class to convert the base types. I've shown only the code to convert integer and integer arrays, but the rest of the method are pretty much replicas of those two, they just overload the type. public static class GSBitConverter { public static byte[] ToGSBinary(this short value) { return BitConverter.GetBytes(value); } public static byte[] ToGSBinary(this IEnumerable<short> value) { List<byte> bytes = new List<byte>(); short length = (short)value.Count(); bytes.AddRange(length.ToGSBinary()); for (int i = 0; i < length; i++) bytes.AddRange(value.ElementAt(i).ToGSBinary()); return bytes.ToArray(); } public static byte[] ToGSBinary(this bool value); public static byte[] ToGSBinary(this IEnumerable<bool> value); public static byte[] ToGSBinary(this IEnumerable<byte> value); public static byte[] ToGSBinary(this int value); public static byte[] ToGSBinary(this IEnumerable<int> value); public static byte[] ToGSBinary(this long value); public static byte[] ToGSBinary(this IEnumerable<long> value); public static byte[] ToGSBinary(this float value); public static byte[] ToGSBinary(this IEnumerable<float> value); public static byte[] ToGSBinary(this double value); public static byte[] ToGSBinary(this IEnumerable<double> value); public static byte[] ToGSBinary(this string value); public static byte[] ToGSBinary(this IEnumerable<string> value); public static string GetHexDump(this IEnumerable<byte> value); } Program.cs Here's the the object that I'm converting to binary in a loop. class Program { static void Main(string[] args) { GSObject obj = new GSObject(); obj.AttachShort("smallInt", 15); obj.AttachInt("medInt", 120700); obj.AttachLong("bigInt", 10900800700); obj.AttachDouble("doubleVal", Math.PI); obj.AttachStringArray("muppetNames", new string[] { "Kermit", "Fozzy", "Piggy", "Animal", "Gonzo" }); GSObject apple = new GSObject(); apple.AttachString("name", "Apple"); apple.AttachString("color", "red"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)1.5); GSObject lemon = new GSObject(); apple.AttachString("name", "Lemon"); apple.AttachString("color", "yellow"); apple.AttachBool("inStock", false); apple.AttachFloat("price", (float)0.8); GSObject apricoat = new GSObject(); apple.AttachString("name", "Apricoat"); apple.AttachString("color", "orange"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)1.9); GSObject kiwi = new GSObject(); apple.AttachString("name", "Kiwi"); apple.AttachString("color", "green"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)2.3); GSArray fruits = new GSArray(); fruits.AddGSObject(apple); fruits.AddGSObject(lemon); fruits.AddGSObject(apricoat); fruits.AddGSObject(kiwi); obj.AttachGSArray("fruits", fruits); Stopwatch w1 = Stopwatch.StartNew(); for (int i = 0; i < 50000; i++) { byte[] b = obj.ToGSBinary(); } w1.Stop(); Console.WriteLine(BitConverter.IsLittleEndian ? "Little Endian" : "Big Endian"); Console.WriteLine(w1.ElapsedMilliseconds + "ms"); } Here's the code for some of my other classes that are used in the code above. Most of it is repetitive. GSObject GSArray GSWrappedObject

    Read the article

  • "The usage of semaphores is subtly wrong"

    - by Hoonose
    This past semester I was taking an OS practicum in C, in which the first project involved making a threads package, then writing a multiple producer-consumer program to demonstrate the functionality. However, after getting grading feedback, I lost points for "The usage of semaphores is subtly wrong" and "The program assumes preemption (e.g. uses yield to change control)" (We started with a non-preemptive threads package then added preemption later. Note that the comment and example contradict each other. I believe it doesn't assume either, and would work in both environments). This has been bugging me for a long time - the course staff was kind of overwhelmed, so I couldn't ask them what's wrong with this over the semester. I've spent a long time thinking about this and I can't see the issues. If anyone could take a look and point out the error, or reassure me that there actually isn't a problem, I'd really appreciate it. I believe the syntax should be pretty standard in terms of the thread package functions (minithreads and semaphores), but let me know if anything is confusing. #include <stdio.h> #include <stdlib.h> #include "minithread.h" #include "synch.h" #define BUFFER_SIZE 16 #define MAXCOUNT 100 int buffer[BUFFER_SIZE]; int size, head, tail; int count = 1; int out = 0; int toadd = 0; int toremove = 0; semaphore_t empty; semaphore_t full; semaphore_t count_lock; // Semaphore to keep a lock on the // global variables for maintaining the counts /* Method to handle the working of a student * The ID of a student is the corresponding minithread_id */ int student(int total_burgers) { int n, i; semaphore_P(count_lock); while ((out+toremove) < arg) { n = genintrand(BUFFER_SIZE); n = (n <= total_burgers - (out + toremove)) ? n : total_burgers - (out + toremove); printf("Student %d wants to get %d burgers ...\n", minithread_id(), n); toremove += n; semaphore_V(count_lock); for (i=0; i<n; i++) { semaphore_P(empty); out = buffer[tail]; printf("Student %d is taking burger %d.\n", minithread_id(), out); tail = (tail + 1) % BUFFER_SIZE; size--; toremove--; semaphore_V(full); } semaphore_P(count_lock); } semaphore_V(count_lock); printf("Student %d is done.\n", minithread_id()); return 0; } /* Method to handle the working of a cook * The ID of a cook is the corresponding minithread_id */ int cook(int total_burgers) { int n, i; printf("Creating Cook %d\n",minithread_id()); semaphore_P(count_lock); while ((count+toadd) <= arg) { n = genintrand(BUFFER_SIZE); n = (n <= total_burgers - (count + toadd) + 1) ? n : total_burgers - (count + toadd) + 1; printf("Cook %d wants to put %d burgers into the burger stack ...\n", minithread_id(),n); toadd += n; semaphore_V(count_lock); for (i=0; i<n; i++) { semaphore_P(full); printf("Cook %d is putting burger %d into the burger stack.\n", minithread_id(), count); buffer[head] = count++; head = (head + 1) % BUFFER_SIZE; size++; toadd--; semaphore_V(empty); } semaphore_P(count_lock); } semaphore_V(count_lock); printf("Cook %d is done.\n", minithread_id()); return 0; } /* Method to create our multiple producers and consumers * and start their respective threads by fork */ void starter(int* c){ int i; for (i=0;i<c[2];i++){ minithread_fork(cook, c[0]); } for (i=0;i<c[1];i++){ minithread_fork(student, c[0]); } } /* The arguments are passed as command line parameters * argv[1] is the no of students * argv[2] is the no of cooks */ void main(int argc, char *argv[]) { int pass_args[3]; pass_args[0] = MAXCOUNT; pass_args[1] = atoi(argv[1]); pass_args[2] = atoi(argv[2]); size = head = tail = 0; empty = semaphore_create(); semaphore_initialize(empty, 0); full = semaphore_create(); semaphore_initialize(full, BUFFER_SIZE); count_lock = semaphore_create(); semaphore_initialize(count_lock, 1); minithread_system_initialize(starter, pass_args); }

    Read the article

  • Qt drag & drop button; drop not detecting

    - by Thomas Verbeke
    I'm creating a 2D game in QT and i'm trying to implement a drag & drop into my program. For some reason the drop is not registered: qDebug should print a message on dropping but this doesn't happen. #include "dialog.h" #include "ui_dialog.h" #include "world.h" #include <vector> Dialog::Dialog(QWidget *parent) : QDialog(parent), ui(new Ui::Dialog) { ui->setupUi(this); scene = new QGraphicsScene(this); ui->graphicsView->setScene(scene); MySquare *item; QGraphicsRectItem *enemyItem; World *myWorld = new World(); std::vector<Tile*> tiles = myWorld->createWorld(":/texture.jpg"); int count = 0; foreach (Tile *tile, tiles){ count++; item = new MySquare(tile->getXPos()*4,tile->getYPos()*4,4,4); item->setBrush(QColor(tile->getValue()*255,tile->getValue()*255,tile->getValue()*255)); item->setAcceptDrops(true); scene->addItem(item); } player = new MySquare(10,20,10,10); player->setAcceptDrops(true); scene->addItem(player); //drag & drop part QPushButton *pushButton = new QPushButton("Click Me",this); connect(pushButton,SIGNAL(pressed()),this,SLOT(makeDrag())); setAcceptDrops(true); } void Dialog::makeDrag() { QDrag *dr = new QDrag(this); // The data to be transferred by the drag and drop operation is contained in a QMimeData object QMimeData *data = new QMimeData; data->setText("This is a test"); // Assign ownership of the QMimeData object to the QDrag object. dr->setMimeData(data); // Start the drag and drop operation dr->start(); } mysquare.cpp #include "mysquare.h" MySquare::MySquare(int _x,int _y, int _w, int _h) { isPlayer=false; Pressed=false; setFlag(ItemIsMovable); setFlag(ItemIsFocusable); setAcceptDrops(true); color=Qt::red; color_pressed = Qt::green; x = _x; y = _y; w = _w; h = _h; } QRectF MySquare::boundingRect() const { return QRectF(x,y,w,h); } void MySquare::paint(QPainter *painter, const QStyleOptionGraphicsItem *option, QWidget *widget) { QRectF rec = boundingRect(); QBrush brush(color); if (Pressed){ brush.setColor(color); } else { brush.setColor(color_pressed); } painter->fillRect(rec,brush); painter->drawRect(rec); } void MySquare::mousePressEvent(QGraphicsSceneMouseEvent *event) { Pressed=true; update(); QGraphicsItem::mousePressEvent(event); qDebug() << "mouse Pressed"; } void MySquare::mouseReleaseEvent(QGraphicsSceneMouseEvent *event) { Pressed=false; update(); QGraphicsItem::mousePressEvent(event); qDebug() << "mouse Released"; } void MySquare::keyPressEvent(QKeyEvent *event){ int x = pos().x(); int y = pos().y(); //key handling QGraphicsItem::keyPressEvent(event); } void MySquare::dropEvent(QDropEvent *event) { qDebug("dropEvent - square"); // Unpack dropped data and handle it the way you want qDebug("Contents: %s", event->mimeData()->text().toLatin1().data()); } void MySquare::dragMoveEvent(QDragMoveEvent *event){ qDebug("dragMoveEvent - square "); event->accept(); } void MySquare::dragEnterEvent(QDragEnterEvent *event){ event->setAccepted(true); qDebug("dragEnterEvent - square"); event->acceptProposedAction(); } void MySquare::setBrush(QColor _color){ color = _color; color_pressed = _color; update(); //repaint } edit; there is no problem with qDebug() i'm just using it to test them i'm inside the drag events..which i'm not

    Read the article

  • Factorising program not working. Help required.

    - by Ender
    I am working on a factorisation problem using Fermat's Factorization and for small numbers it is working well. I've been able to calculate the factors (getting the answers from Wolfram Alpha) for small numbers, like the one on the Wikipedia page (5959). Just when I thought I had the problem licked I soon realised that my program was not working when it came to larger numbers. The program follows through the examples from the Wikipedia page, printing out the values a, b, a2 and b2; the results printed for large numbers are not correct. I've followed the pseudocode provided on the Wikipedia page, but am struggling to understand where to go next. Along with the Wikipedia page I have been following this guide. Once again, as my Math knowledge is pretty poor I cannot follow what I need to do next. The code I am using so far is as follows: import java.math.BigInteger; /** * * @author AlexT */ public class Fermat { private BigInteger a, b; private BigInteger b2; private static final BigInteger TWO = BigInteger.valueOf(2); public void fermat(BigInteger N) { // floor(sqrt(N)) BigInteger tmp = getIntSqrt(N); // a <- ceil(sqrt(N)) a = tmp.add(BigInteger.ONE); // b2 <- a*a-N b2 = (a.multiply(a)).subtract(N); final int bitLength = N.bitLength(); BigInteger root = BigInteger.ONE.shiftLeft(bitLength / 2); root = root.add(b2.divide(root)).divide(TWO); // while b2 not square root while(!(isSqrt(b2, root))) { // a <- a + 1 a = a.add(BigInteger.ONE); // b2 <- (a * a) - N b2 = (a.multiply(a)).subtract(N); root = root.add(b2.divide(root)).divide(TWO); } b = getIntSqrt(b2); BigInteger a2 = a.pow(2); // Wrong BigInteger sum = (a.subtract(b)).multiply((a.add(b))); //if(sum.compareTo(N) == 0) { System.out.println("A: " + a + "\nB: " + b); System.out.println("A^2: " + a2 + "\nB^2: " + b2); //} } /** * Is the number provided a perfect Square Root? * @param n * @param root * @return */ private static boolean isSqrt(BigInteger n, BigInteger root) { final BigInteger lowerBound = root.pow(2); final BigInteger upperBound = root.add(BigInteger.ONE).pow(2); return lowerBound.compareTo(n) <= 0 && n.compareTo(upperBound) < 0; } public BigInteger getIntSqrt(BigInteger x) { // It returns s where s^2 < x < (s+1)^2 BigInteger s; // final result BigInteger currentRes = BigInteger.valueOf(0); // init value is 0 BigInteger currentSum = BigInteger.valueOf(0); // init value is 0 BigInteger sum = BigInteger.valueOf(0); String xS = x.toString(); // change input x to a string xS int lengthOfxS = xS.length(); int currentTwoBits; int i=0; // index if(lengthOfxS % 2 != 0) {// if odd length, add a dummy bit xS = "0".concat(xS); // add 0 to the front of string xS lengthOfxS++; } while(i < lengthOfxS){ // go through xS two by two, left to right currentTwoBits = Integer.valueOf(xS.substring(i,i+2)); i += 2; // sum = currentSum*100 + currentTwoBits sum = currentSum.multiply(BigInteger.valueOf(100)); sum = sum.add(BigInteger.valueOf(currentTwoBits)); // subtraction loop do { currentSum = sum; // remember the value before subtract // in next 3 lines, we work out // currentRes = sum - 2*currentRes - 1 sum = sum.subtract(currentRes); // currentRes++ currentRes = currentRes.add(BigInteger.valueOf(1)); sum = sum.subtract(currentRes); } while(sum.compareTo(BigInteger.valueOf(0)) >= 0); // the loop stops when sum < 0 // go one step back currentRes = currentRes.subtract(BigInteger.valueOf(1)); currentRes = currentRes.multiply(BigInteger.valueOf(10)); } s = currentRes.divide(BigInteger.valueOf(10)); // go one step back return s; } /** * @param args the command line arguments */ public static void main(String[] args) { Fermat fermat = new Fermat(); //Works //fermat.fermat(new BigInteger("5959")); // Doesn't Work fermat.fermat(new BigInteger("90283")); } } If anyone can help me out with this problem I'll be eternally grateful.

    Read the article

  • Confusion testing fftw3 - poisson equation 2d test

    - by user3699736
    I am having trouble explaining/understanding the following phenomenon: To test fftw3 i am using the 2d poisson test case: laplacian(f(x,y)) = - g(x,y) with periodic boundary conditions. After applying the fourier transform to the equation we obtain : F(kx,ky) = G(kx,ky) /(kx² + ky²) (1) if i take g(x,y) = sin (x) + sin(y) , (x,y) \in [0,2 \pi] i have immediately f(x,y) = g(x,y) which is what i am trying to obtain with the fft : i compute G from g with a forward Fourier transform From this i can compute the Fourier transform of f with (1). Finally, i compute f with the backward Fourier transform (without forgetting to normalize by 1/(nx*ny)). In practice, the results are pretty bad? (For instance, the amplitude for N = 256 is twice the amplitude obtained with N = 512) Even worse, if i try g(x,y) = sin(x)*sin(y) , the curve has not even the same form of the solution. (note that i must change the equation; i divide by two the laplacian in this case : (1) becomes F(kx,ky) = 2*G(kx,ky)/(kx²+ky²) Here is the code: /* * fftw test -- double precision */ #include <iostream> #include <stdio.h> #include <stdlib.h> #include <math.h> #include <fftw3.h> using namespace std; int main() { int N = 128; int i, j ; double pi = 3.14159265359; double *X, *Y ; X = (double*) malloc(N*sizeof(double)); Y = (double*) malloc(N*sizeof(double)); fftw_complex *out1, *in2, *out2, *in1; fftw_plan p1, p2; double L = 2.*pi; double dx = L/((N - 1)*1.0); in1 = (fftw_complex*) fftw_malloc(sizeof(fftw_complex)*(N*N) ); out2 = (fftw_complex*) fftw_malloc(sizeof(fftw_complex)*(N*N) ); out1 = (fftw_complex*) fftw_malloc(sizeof(fftw_complex)*(N*N) ); in2 = (fftw_complex*) fftw_malloc(sizeof(fftw_complex)*(N*N) ); p1 = fftw_plan_dft_2d(N, N, in1, out1, FFTW_FORWARD,FFTW_MEASURE ); p2 = fftw_plan_dft_2d(N, N, in2, out2, FFTW_BACKWARD,FFTW_MEASURE); for(i = 0; i < N; i++){ X[i] = -pi + (i*1.0)*2.*pi/((N - 1)*1.0) ; for(j = 0; j < N; j++){ Y[j] = -pi + (j*1.0)*2.*pi/((N - 1)*1.0) ; in1[i*N + j][0] = sin(X[i]) + sin(Y[j]) ; // row major ordering //in1[i*N + j][0] = sin(X[i]) * sin(Y[j]) ; // 2nd test case in1[i*N + j][1] = 0 ; } } fftw_execute(p1); // FFT forward for ( i = 0; i < N; i++){ // f = g / ( kx² + ky² ) for( j = 0; j < N; j++){ in2[i*N + j][0] = out1[i*N + j][0]/ (i*i+j*j+1e-16); in2[i*N + j][1] = out1[i*N + j][1]/ (i*i+j*j+1e-16); //in2[i*N + j][0] = 2*out1[i*N + j][0]/ (i*i+j*j+1e-16); // 2nd test case //in2[i*N + j][1] = 2*out1[i*N + j][1]/ (i*i+j*j+1e-16); } } fftw_execute(p2); //FFT backward // checking the results computed double erl1 = 0.; for ( i = 0; i < N; i++) { for( j = 0; j < N; j++){ erl1 += fabs( in1[i*N + j][0] - out2[i*N + j][0]/N/N )*dx*dx; cout<< i <<" "<< j<<" "<< sin(X[i])+sin(Y[j])<<" "<< out2[i*N+j][0]/N/N <<" "<< endl; // > output } } cout<< erl1 << endl ; // L1 error fftw_destroy_plan(p1); fftw_destroy_plan(p2); fftw_free(out1); fftw_free(out2); fftw_free(in1); fftw_free(in2); return 0; } I can't find any (more) mistakes in my code (i installed the fftw3 library last week) and i don't see a problem with the maths either but i don't think it's the fft's fault. Hence my predicament. I am all out of ideas and all out of google as well. Any help solving this puzzle would be greatly appreciated. note : compiling : g++ test.cpp -lfftw3 -lm executing : ./a.out output and i use gnuplot in order to plot the curves : (in gnuplot ) splot "output" u 1:2:4 ( for the computed solution )

    Read the article

  • javascript robot

    - by sarah
    hey guys! I need help making this robot game in javascript (notepad++) please HELP! I'm really confused by the functions <html> <head><title>Robot Invasion 2199</title></head> <body style="text-align:center" onload="newGame();"> <h2>Robot Invasion 2199</h2> <div style="text-align:center; background:white; margin-right: auto; margin-left:auto;"> <div style=""> <div style="width: auto; border:solid thin red; text-align:center; margin:10px auto 10px auto; padding:1ex 0ex;font-family: monospace" id="scene"></pre> </div> <div><span id="status"></span></div> <form style="text-align:center"> PUT THE CONTROL PANEL HERE!!! </form> </div> <script type="text/javascript"> // GENERAL SUGGESTIONS ABOUT WRITING THIS PROGRAM: // You should test your program before you've finished writing all of the // functions. The newGame, startLevel, and update functions should be your // first priority since they're all involved in displaying the initial state // of the game board. // // Next, work on putting together the control panel for the game so that you // can begin to interact with it. Your next goal should be to get the move // function working so that everything else can be testable. Note that all nine // of the movement buttons (including the pass button) should call the move // function when they are clicked, just with different parameters. // // All the remaining functions can be completed in pretty much any order, and // you'll see the game gradually improve as you write the functions. // // Just remember to keep your cool when writing this program. There are a // bunch of functions to write, but as long as you stay focused on the function // you're writing, each individual part is not that hard. // These variables specify the number of rows and columns in the game board. // Use these variables instead of hard coding the number of rows and columns // in your loops, etc. // i.e. Write: // for(i = 0; i < NUM_ROWS; i++) ... // not: // for(i = 0; i < 15; i++) ... var NUM_ROWS = 15; var NUM_COLS = 25; // Scene is arguably the most important variable in this whole program. It // should be set up as a two-dimensional array (with NUM_ROWS rows and // NUM_COLS columns). This represents the game board, with the scene[i][j] // representing what's in row i, column j. In particular, the entries should // be: // // "." for empty space // "R" for a robot // "S" for a scrap pile // "H" for the hero var scene; // These variables represent the row and column of the hero's location, // respectively. These are more of a conveniece so you don't have to search // for the "H" in the scene array when you need to know where the hero is. var heroRow; var heroCol; // These variables keep track of various aspects of the gameplay. // score is just the number of robots destroyed. // screwdrivers is the number of sonic screwdriver charges left. // fastTeleports is the number of fast teleports remaining. // level is the current level number. // Be sure to reset all of these when a new game starts, and update them at the // appropriate times. var score; var screwdrivers; var fastTeleports; var level; // This function should use a sonic screwdriver if there are still charges // left. The sonic screwdriver turns any robot that is in one of the eight // squares immediately adjacent to the hero into scrap. If there are no charges // left, then this function should instead pop up a dialog box with the message // "Out of sonic screwdrivers!". As with any function that alters the game's // state, this function should call the update function when it has finished. // // Your "Sonic Screwdriver" button should call this function directly. function screwdriver() { // WRITE THIS FUNCTION } // This function should move the hero to a randomly selected location if there // are still fast teleports left. This function MUST NOT move the hero on to // a square that is already occupied by a robot or a scrap pile, although it // can move the hero next to a robot. The number of fast teleports should also // be decreased by one. If there are no fast teleports left, this function // should just pop up a message box saying so. As with any function that alters // the game's state, this function should call the update function when it has // finished. // // HINT: Have a loop that keeps trying random spots until a valid one is found. // HINT: Use the validPosition function to tell if a spot is valid // // Your "Fast Teleport" button s

    Read the article

  • PHP: Strange behaviour while calling custom php functions

    - by baltusaj
    I am facing a strange behavior while coding in PHP with Flex. Let me explain the situation: I have two funcions lets say: populateTable() //puts some data in a table made with flex createXML() //creates an xml file which is used by Fusion Charts to create a chart Now, if i call populateTable() alone, the table gets populated with data but if i call it with createXML(), the table doesn't get populated but createXML() does it's work i.e. creates an xml file. Even if i run following code, only xml file gets generated but table remains empty whereas i called populateTable() before createXML(). Any idea what may be going wrong? MXML Part <mx:HTTPService id="userRequest" url="request.php" method="POST" resultFormat="e4x"> <mx:request xmlns=""> <getResult>send</getResult> </mx:request> and <mx:DataGrid id="dgUserRequest" dataProvider="{userRequest.lastResult.user}" x="28.5" y="36" width="525" height="250" > <mx:columns> <mx:DataGridColumn headerText="No." dataField="no" /> <mx:DataGridColumn headerText="Name" dataField="name"/> <mx:DataGridColumn headerText="Age" dataField="age"/> </mx:columns> PHP Part <?php //-------------------------------------------------------------------------- function initialize($username,$password,$database) //-------------------------------------------------------------------------- { # Connect to the database $link = mysql_connect("localhost", $username,$password); if (!$link) { die('Could not connected to the database : ' . mysql_error()); } # Select the database $db_selected = mysql_select_db($database, $link); if (!$db_selected) { die ('Could not select the DB : ' . mysql_error()); } // populateTable(); createXML(); # Close database connection } //-------------------------------------------------------------------------- populateTable() //-------------------------------------------------------------------------- { if($_POST['getResult'] == 'send') { $Result = mysql_query("SELECT * FROM session" ); $Return = "<Users>"; $no = 1; while ( $row = mysql_fetch_object( $Result ) ) { $Return .= "<user><no>".$no."</no><name>".$row->name."</name><age>".$row->age."</age><salary>". $row->salary."</salary></session>"; $no=$no+1; $Return .= "</Users>"; mysql_free_result( $Result ); print ($Return); } //-------------------------------------------------------------------------- createXML() //-------------------------------------------------------------------------- { $users=array ( "0"=>array("",0), "1"=>array("Obama",0), "2"=>array("Zardari",0), "3"=>array("Imran Khan",0), "4"=>array("Ahmadenijad",0) ); $selectedUsers=array(1,4); //this means only obama and ahmadenijad are selected and the xml file will contain info related to them only //Extracting salaries of selected users $size=count($users); for($i = 0; $i<$size; $i++) { //initialize temp which will calculate total throughput for each protocol separately $salary = 0; $result = mysql_query("SELECT salary FROM userInfo where name='$users[$selectedUsers[$i]][0]'"); $row = mysql_fetch_array($result)) $salary = $row['salary']; } $users[$selectedUsers[$i]][1]=$salary; } //creating XML string $chartContent = "<chart caption=\"Users Vs Salaries\" formatNumberScale=\"0\" pieSliceDepth=\"30\" startingAngle=\"125\">"; for($i=0;$i<$size;$i++) { $chartContent .= "<set label=\"".$users[$selectedUsers[$i]][0]."\" value=\"".$users[$selectedUsers[$i]][1]."\"/>"; } $chartContent .= "<styles>" . "<definition>" . "<style type=\"font\" name=\"CaptionFont\" size=\"16\" color=\"666666\"/>" . "<style type=\"font\" name=\"SubCaptionFont\" bold=\"0\"/>" . "</definition>" . "<application>" . "<apply toObject=\"caption\" styles=\"CaptionFont\"/>" . "<apply toObject=\"SubCaption\" styles=\"SubCaptionFont\"/>" . "</application>" . "</styles>" . "</chart>"; $file_handle = fopen('ChartData.xml','w'); fwrite($file_handle,$chartContent); fclose($file_handle); } initialize("root","","hiddenpeak"); ?>

    Read the article

  • Dynamic object property populator (without reflection)

    - by grenade
    I want to populate an object's properties without using reflection in a manner similar to the DynamicBuilder on CodeProject. The CodeProject example is tailored for populating entities using a DataReader or DataRecord. I use this in several DALs to good effect. Now I want to modify it to use a dictionary or other data agnostic object so that I can use it in non DAL code --places I currently use reflection. I know almost nothing about OpCodes and IL. I just know that it works well and is faster than reflection. I have tried to modify the CodeProject example and because of my ignorance with IL, I have gotten stuck on two lines. One of them deals with dbnulls and I'm pretty sure I can just lose it, but I don't know if the lines preceding and following it are related and which of them will also need to go. The other, I think, is the one that pulled the value out of the datarecord before and now needs to pull it out of the dictionary. I think I can replace the "getValueMethod" with my "property.Value" but I'm not sure. I'm open to alternative/better ways of skinning this cat too. Here's the code so far (the commented out lines are the ones I'm stuck on): using System; using System.Collections.Generic; using System.Reflection; using System.Reflection.Emit; public class Populator<T> { private delegate T Load(Dictionary<string, object> properties); private Load _handler; private Populator() { } public T Build(Dictionary<string, object> properties) { return _handler(properties); } public static Populator<T> CreateBuilder(Dictionary<string, object> properties) { //private static readonly MethodInfo getValueMethod = typeof(IDataRecord).GetMethod("get_Item", new [] { typeof(int) }); //private static readonly MethodInfo isDBNullMethod = typeof(IDataRecord).GetMethod("IsDBNull", new [] { typeof(int) }); Populator<T> dynamicBuilder = new Populator<T>(); DynamicMethod method = new DynamicMethod("Create", typeof(T), new[] { typeof(Dictionary<string, object>) }, typeof(T), true); ILGenerator generator = method.GetILGenerator(); LocalBuilder result = generator.DeclareLocal(typeof(T)); generator.Emit(OpCodes.Newobj, typeof(T).GetConstructor(Type.EmptyTypes)); generator.Emit(OpCodes.Stloc, result); int i = 0; foreach (var property in properties) { PropertyInfo propertyInfo = typeof(T).GetProperty(property.Key, BindingFlags.Public | BindingFlags.Instance | BindingFlags.IgnoreCase | BindingFlags.FlattenHierarchy | BindingFlags.Default); Label endIfLabel = generator.DefineLabel(); if (propertyInfo != null && propertyInfo.GetSetMethod() != null) { generator.Emit(OpCodes.Ldarg_0); generator.Emit(OpCodes.Ldc_I4, i); //generator.Emit(OpCodes.Callvirt, isDBNullMethod); generator.Emit(OpCodes.Brtrue, endIfLabel); generator.Emit(OpCodes.Ldloc, result); generator.Emit(OpCodes.Ldarg_0); generator.Emit(OpCodes.Ldc_I4, i); //generator.Emit(OpCodes.Callvirt, getValueMethod); generator.Emit(OpCodes.Unbox_Any, property.Value.GetType()); generator.Emit(OpCodes.Callvirt, propertyInfo.GetSetMethod()); generator.MarkLabel(endIfLabel); } i++; } generator.Emit(OpCodes.Ldloc, result); generator.Emit(OpCodes.Ret); dynamicBuilder._handler = (Load)method.CreateDelegate(typeof(Load)); return dynamicBuilder; } } EDIT: Using Marc Gravell's PropertyDescriptor implementation (with HyperDescriptor) the code is simplified a hundred-fold. I now have the following test: using System; using System.Collections.Generic; using System.ComponentModel; using Hyper.ComponentModel; namespace Test { class Person { public int Id { get; set; } public string Name { get; set; } } class Program { static void Main() { HyperTypeDescriptionProvider.Add(typeof(Person)); var properties = new Dictionary<string, object> { { "Id", 10 }, { "Name", "Fred Flintstone" } }; Person person = new Person(); DynamicUpdate(person, properties); Console.WriteLine("Id: {0}; Name: {1}", person.Id, person.Name); Console.ReadKey(); } public static void DynamicUpdate<T>(T entity, Dictionary<string, object> properties) { foreach (PropertyDescriptor propertyDescriptor in TypeDescriptor.GetProperties(typeof(T))) if (properties.ContainsKey(propertyDescriptor.Name)) propertyDescriptor.SetValue(entity, properties[propertyDescriptor.Name]); } } } Any comments on performance considerations for both TypeDescriptor.GetProperties() & PropertyDescriptor.SetValue() are welcome...

    Read the article

  • Cobol: science and fiction

    - by user847
    There are a few threads about the relevance of the Cobol programming language on this forum, e.g. this thread links to a collection of them. What I am interested in here is a frequently repeated claim based on a study by Gartner from 1997: that there were around 200 billion lines of code in active use at that time! I would like to ask some questions to verify or falsify a couple of related points. My goal is to understand if this statement has any truth to it or if it is totally unrealistic. I apologize in advance for being a little verbose in presenting my line of thought and my own opinion on the things I am not sure about, but I think it might help to put things in context and thus highlight any wrong assumptions and conclusions I have made. Sometimes, the "200 billion lines" number is accompanied by the added claim that this corresponded to 80% of all programming code in any language in active use. Other times, the 80% merely refer to so-called "business code" (or some other vague phrase hinting that the reader is not to count mainstream software, embedded systems or anything else where Cobol is practically non-existent). In the following I assume that the code does not include double-counting of multiple installations of the same software (since that is cheating!). In particular in the time prior to the y2k problem, it has been noted that a lot of Cobol code is already 20 to 30 years old. That would mean it was written in the late 60ies and 70ies. At that time, the market leader was IBM with the IBM/370 mainframe. IBM has put up a historical announcement on his website quoting prices and availability. According to the sheet, prices are about one million dollars for machines with up to half a megabyte of memory. Question 1: How many mainframes have actually been sold? I have not found any numbers for those times; the latest numbers are for the year 2000, again by Gartner. :^( I would guess that the actual number is in the hundreds or the low thousands; if the market size was 50 billion in 2000 and the market has grown exponentially like any other technology, it might have been merely a few billions back in 1970. Since the IBM/370 was sold for twenty years, twenty times a few thousand will result in a couple of ten-thousands of machines (and that is pretty optimistic)! Question 2: How large were the programs in lines of code? I don't know how many bytes of machine code result from one line of source code on that architecture. But since the IBM/370 was a 32-bit machine, any address access must have used 4 bytes plus instruction (2, maybe 3 bytes for that?). If you count in operating system and data for the program, how many lines of code would have fit into the main memory of half a megabyte? Question 3: Was there no standard software? Did every single machine sold run a unique hand-coded system without any standard software? Seriously, even if every machine was programmed from scratch without any reuse of legacy code (wait ... didn't that violate one of the claims we started from to begin with???) we might have O(50,000 l.o.c./machine) * O(20,000 machines) = O(1,000,000,000 l.o.c.). That is still far, far, far away from 200 billion! Am I missing something obvious here? Question 4: How many programmers did we need to write 200 billion lines of code? I am really not sure about this one, but if we take an average of 10 l.o.c. per day, we would need 55 million man-years to achieve this! In the time-frame of 20 to 30 years this would mean that there must have existed two to three million programmers constantly writing, testing, debugging and documenting code. That would be about as many programmers as we have in China today, wouldn't it? Question 5: What about the competition? So far, I have come up with two things here: 1) IBM had their own programming language, PL/I. Above I have assumed that the majority of code has been written exclusively using Cobol. However, all other things being equal I wonder if IBM marketing had really pushed their own development off the market in favor of Cobol on their machines. Was there really no relevant code base of PL/I? 2) Sometimes (also on this board in the thread quoted above) I come across the claim that the "200 billion lines of code" are simply invisible to anybody outside of "governments, banks ..." (and whatnot). Actually, the DoD had funded their own language in order to increase cost effectiveness and reduce the proliferation of programming language. This lead to their use of Ada. Would they really worry about having so many different programming languages if they had predominantly used Cobol? If there was any language running on "government and military" systems outside the perception of mainstream computing, wouldn't that language be Ada? I hope someone can point out any flaws in my assumptions and/or conclusions and shed some light on whether the above claim has any truth to it or not.

    Read the article

  • Exception - Illegal Block size during decryption(Android)

    - by Vamsi
    I am writing an application which encrypts and decrypts the user notes based on the user set password. i used the following algorithms for encryption/decryption 1. PBEWithSHA256And256BitAES-CBC-BC 2. PBEWithMD5And128BitAES-CBC-OpenSSL e_Cipher = Cipher.getInstance(PBEWithSHA256And256BitAES-CBC-BC); d_Cipher = Cipher.getInstance(PBEWithSHA256And256BitAES-CBC-BC); e_Cipher.init() d_Cipher.init() encryption is working well, but when trying to decrypt it gives Exception - Illegal Block size after encryption i am converting the cipherText to HEX and storing it in a sqlite database. i am retrieving correct values from the sqlite database during decyption but when calling d_Cipher.dofinal() it throws the Exception. I thought i missed to specify the padding and tried to check what are the other available cipher algorithms but i was unable to found. so request you to please give the some knowledge on what are the cipher algorithms and padding that are supported by Android? if the algorithm which i used can be used for padding, how should i specify the padding mechanism? I am pretty new to Encryption so tried a couple of algorithms which are available in BouncyCastle.java but unsuccessful. As requested here is the code public class CryptoHelper { private static final String TAG = "CryptoHelper"; //private static final String PBEWithSHA256And256BitAES = "PBEWithSHA256And256BitAES-CBC-BC"; //private static final String PBEWithSHA256And256BitAES = "PBEWithMD5And128BitAES-CBC-OpenSSL"; private static final String PBEWithSHA256And256BitAES = "PBEWithMD5And128BitAES-CBC-OpenSSLPBEWITHSHA1AND3-KEYTRIPLEDES-CB"; private static final String randomAlgorithm = "SHA1PRNG"; public static final int SALT_LENGTH = 8; public static final int SALT_GEN_ITER_COUNT = 20; private final static String HEX = "0123456789ABCDEF"; private Cipher e_Cipher; private Cipher d_Cipher; private SecretKey secretKey; private byte salt[]; public CryptoHelper(String password) throws InvalidKeyException, NoSuchAlgorithmException, NoSuchPaddingException, InvalidAlgorithmParameterException, InvalidKeySpecException { char[] cPassword = password.toCharArray(); PBEKeySpec pbeKeySpec = new PBEKeySpec(cPassword); PBEParameterSpec pbeParamSpec = new PBEParameterSpec(salt, SALT_GEN_ITER_COUNT); SecretKeyFactory keyFac = SecretKeyFactory.getInstance(PBEWithSHA256And256BitAES); secretKey = keyFac.generateSecret(pbeKeySpec); SecureRandom saltGen = SecureRandom.getInstance(randomAlgorithm); this.salt = new byte[SALT_LENGTH]; saltGen.nextBytes(this.salt); e_Cipher = Cipher.getInstance(PBEWithSHA256And256BitAES); d_Cipher = Cipher.getInstance(PBEWithSHA256And256BitAES); e_Cipher.init(Cipher.ENCRYPT_MODE, secretKey, pbeParamSpec); d_Cipher.init(Cipher.DECRYPT_MODE, secretKey, pbeParamSpec); } public String encrypt(String cleartext) throws IllegalBlockSizeException, BadPaddingException { byte[] encrypted = e_Cipher.doFinal(cleartext.getBytes()); return convertByteArrayToHex(encrypted); } public String decrypt(String cipherString) throws IllegalBlockSizeException { byte[] plainText = decrypt(convertStringtobyte(cipherString)); return(new String(plainText)); } public byte[] decrypt(byte[] ciphertext) throws IllegalBlockSizeException { byte[] retVal = {(byte)0x00}; try { retVal = d_Cipher.doFinal(ciphertext); } catch (BadPaddingException e) { Log.e(TAG, e.toString()); } return retVal; } public String convertByteArrayToHex(byte[] buf) { if (buf == null) return ""; StringBuffer result = new StringBuffer(2*buf.length); for (int i = 0; i < buf.length; i++) { appendHex(result, buf[i]); } return result.toString(); } private static void appendHex(StringBuffer sb, byte b) { sb.append(HEX.charAt((b>>4)&0x0f)).append(HEX.charAt(b&0x0f)); } private static byte[] convertStringtobyte(String hexString) { int len = hexString.length()/2; byte[] result = new byte[len]; for (int i = 0; i < len; i++) { result[i] = Integer.valueOf(hexString.substring(2*i, 2*i+2), 16).byteValue(); } return result; } public byte[] getSalt() { return salt; } public SecretKey getSecretKey() { return secretKey; } public static SecretKey createSecretKey(char[] password) throws NoSuchAlgorithmException, InvalidKeySpecException { PBEKeySpec pbeKeySpec = new PBEKeySpec(password); SecretKeyFactory keyFac = SecretKeyFactory.getInstance(PBEWithSHA256And256BitAES); return keyFac.generateSecret(pbeKeySpec); } } I will call mCryptoHelper.decrypt(String str) then this results in Illegal block size exception My Env: Android 1.6 on Eclipse

    Read the article

  • Why can't my main class see the array in my calender class

    - by Rocky Celltick Eadie
    This is a homework problem. I'm already 5 days late and can't figure out what I'm doing wrong.. this is my 1st semester in Java and my first post on this site Here is the assignment.. Create a class called Calendar. The class should contain a variable called events that is a String array. The array should be created to hold 5 elements. Use a constant value to specify the array size. Do not hard code the array size. Initialize the array in the class constructor so that each element contains the string “ – No event planned – “. The class should contain a method called CreateEvent. This method should accept a String argument that contains a one-word user event and an integer argument that represents the day of the week. Monday should be represented by the number 1 and Friday should be represented by the number 5. Populate the events array with the event info passed into the method. Although the user will input one-word events, each event string should prepend the following string to each event: event_dayAppoinment: (where event_day is the day of the week) For example, if the user enters 1 and “doctor” , the first array element should read: Monday Appointment: doctor If the user enters 2 and “PTA” , the second array element should read: Tuesday Appointment: PTA Write a driver program (in a separate class) that creates and calls your Calendar class. Then use a loop to gather user input. Ask for the day (as an integer) and then ask for the event (as a one word string). Pass the integer and string to the Calendar object’s CreateEvent method. The user should be able enter 0 – 5 events. If the user enters -1, the loop should exit and your application should print out all the events in a tabular format. Your program should not allow the user to enter invalid values for the day of the week. Any input other than 1 – 5 or -1 for the day of the week would be considered invalid. Notes: When obtaining an integer from the user, you will need to use the nextInt() method on your Scanner object. When obtaining a string from a user, you will need to use the next() method on your Scanner object. Here is my code so far.. //DRIVER CLASS /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin class driver public class driver { /** * @paramargs the command line arguments */ //begin main method public static void main(String[] args) { //initiates scanner Scanner userInput = new Scanner (System.in); //declare variables int dayOfWeek; String userEvent; //creates object for calender class calendercalenderObject = new calender(); //user prompt System.out.println("Enter day of week for your event in the following format:"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //user prompt System.out.println("Please type in the name of your event"); //collect user input userEvent = userInput.next(); //begin while loop while (dayOfWeek != -1) { //test for valid day of week if ((dayOfWeek>=1) && (dayOfWeek<=5)){ //calls createEvent method in calender class and passes 2 variables calenderObject.createEvent(userEvent,dayOfWeek); } else { //error message System.out.println("You have entered an invalid number"); //user prompts System.out.println("Press -1 to quit or enter another day"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //end data validity test } //end while loop } //prints array to screen int i=0; for (i=0;i<events.length;i++){ System.out.println(events[i]); } //end main method } } /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin calender class public class calender { //creates events array String[] events = new String[5]; //begin calender class constructor public calender() { //Initializes array String[] events = {"-No event planned-","-No event planned-","-No event planned-","-No event planned-","-No event planned-"}; //end calender class constructor } //begin createEvent method public String[] createEvent (String userEvent, int dayOfWeek){ //Start switch test switch (dayOfWeek){ case 1: events[0] = ("Monday Appoinment:") + userEvent; break; case 2: events[1] = ("Tuesday Appoinment:") + userEvent; break; case 3: events[2] = ("WednsdayAppoinment:") + userEvent; break; case 4: events[3] = ("Thursday Appoinment:") + userEvent; break; case 5: events[4] = ("Friday Appoinment:") + userEvent; break; default: break; //End switch test } //returns events array return events; //end create event method } //end calender class }

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • $_GET loading content before head tag instead of in specified div.

    - by s32ialx
    NOT EDITING BELOW BUT THANKS TO SOME REALLY NICE PEOPLE I CAN'T POST AN IMAGE ANYMORE BECAUSE I HAD a 15 Rep but NOW ONLY A 5 becuase my question wasn't what they wanted help with they gave me a neg rep. The problem is that the content loads it displays UNDER the div i placed #CONTENT# inside so the styles are being ignored and it's posting #CONTENT# outside the divs at positions 0,0 any suggestions? Found out whats happening by using "View Source" seems that it's putting all of the #CONTENT#, content that's being loaded in front of the <head> tag. Like this <doctype...> <div class="home"> \ blah blah #CONTENT# bot being loaded in correct specified area </div> / <head> <script src=""></script> </head> <body> <div class="header"></div> <div class="contents"> #CONTENT# < where content SHOULD load </div> <div class="footer"></div> </body> so anyone got a fix? OK so a better description I'll add relevant screen-shots Whats happening is /* file.class.php */ <?php $file = new file(); class file{ var $path = "templates/clean"; var $ext = "tpl"; function loadfile($filename){ return file_get_contents($this->path . "/" . $filename . "." . $this->ext); } function setcontent($content,$newcontent,$vartoreplace='#CONTENT#'){ $val = str_replace($vartoreplace,$newcontent,$content); return $val; } function p($content) { $v = $content; $v = str_replace('#CONTENT#','',$v); print $v; } } if(!isset($_GET['page'])){ // if not, lets load our index page(you can change home.php to whatever you want: include("main.txt"); // else $_GET['page'] was set so lets do stuff: } else { // lets first check if the file exists: if(file_exists($_GET['page'].'.txt')){ // and lets include that then: include($_GET['page'].'.txt'); // sorry mate, could not find it: } else { echo 'Sorry, could not find <strong>' . $_GET['page'] .'.txt</strong>'; } } ?> is calling for a file_get_contents at the bottom which I use in /* index.php */ <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <?php include('classes/file.class.php'); // load the templates $header = $file->loadfile('header'); $body = $file->loadfile('body'); $footer = $file->loadfile('footer'); // fill body.tpl #CONTENT# slot with $content $body = $file->setcontent($body, $content); // cleanup and output the full page $file->p($header . $body . $footer); ?> and loads into /* body.tpl */ <div id="bodys"> <div id="bodt"></div> <div id="bodm"> <div id="contents"> #CONTENT# </div> </div> <div id="bodb"></div> </div> but the issue is as follows the $content loads properly img tags etc <h2> tags etc but CSS styling is TOTALY ignored for position width z-index etc. and as follows here's the screen-shot My Firefox Showing The Problem In Action REPOSTED DUE TO PEOPLE NOT HELPING AND JUST BEING ARROGANT AND GIVING NEGATIVE VOTES and not even saying a word. DO NOT COMMENT UNLESS YOU PLAN TO HELP god I'm a beginner and with you people giving me bad reviews this won't make me help you out when the chance comes.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why is .NET faster than C++ in this case?

    - by acidzombie24
    -edit- I LOVE SLaks comment. "The amount of misinformation in these answers is staggering." :D Calm down guys. Pretty much all of you were wrong. I DID make optimizations. It turns out whatever optimizations I made wasn't good enough. I ran the code in GCC using gettimeofday (I'll paste code below) and used g++ -O2 file.cpp and got slightly faster results then C#. Maybe MS didn't create the optimizations needed in this specific case but after downloading and installing mingw I was tested and found the speed to be near identical. Justicle Seems to be right. I could have sworn I use clock on my PC and used that to count and found it was slower but problem solved. C++ speed isn't almost twice as slower in the MS compiler. When my friend informed me of this I couldn't believe it. So I took his code and put some timers onto it. Instead of Boo I used C#. I constantly got faster results in C#. Why? The .NET version was nearly half the time no matter what number I used. C++ version: #include <iostream> #include <stdio.h> #include <intrin.h> #include <windows.h> using namespace std; int fib(int n) { if (n < 2) return n; return fib(n - 1) + fib(n - 2); } int main() { __int64 time = 0xFFFFFFFF; while (1) { int n; //cin >> n; n = 41; if (n < 0) break; __int64 start = __rdtsc(); int res = fib(n); __int64 end = __rdtsc(); cout << res << endl; cout << (float)(end-start)/1000000<<endl; break; } return 0; } C# version: using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Runtime.InteropServices; using System.ComponentModel; using System.Threading; using System.IO; using System.Diagnostics; namespace fibCSTest { class Program { static int fib(int n) { if (n < 2)return n; return fib(n - 1) + fib(n - 2); } static void Main(string[] args) { //var sw = new Stopwatch(); //var timer = new PAB.HiPerfTimer(); var timer = new Stopwatch(); while (true) { int n; //cin >> n; n = 41; if (n < 0) break; timer.Start(); int res = fib(n); timer.Stop(); Console.WriteLine(res); Console.WriteLine(timer.ElapsedMilliseconds); break; } } } } GCC version: #include <iostream> #include <stdio.h> #include <sys/time.h> using namespace std; int fib(int n) { if (n < 2) return n; return fib(n - 1) + fib(n - 2); } int main() { timeval start, end; while (1) { int n; //cin >> n; n = 41; if (n < 0) break; gettimeofday(&start, 0); int res = fib(n); gettimeofday(&end, 0); int sec = end.tv_sec - start.tv_sec; int usec = end.tv_usec - start.tv_usec; cout << res << endl; cout << sec << " " << usec <<endl; break; } return 0; }

    Read the article

  • a program similar to ls with some modifications

    - by Bond
    Hi, here is a simple puzzle I wanted to discuss. A C program to take directory name as command line argument and print last 3 directories and 3 files in all subdirectories without using api 'system' inside it. suppose directory bond0 contains bond1, di2, bond3, bond4, bond5 and my_file1, my_file2, my_file3, my_file4, my_file5, my_file6 and bond1 contains bond6 my_file7 my_file8 my_file9 my_file10 program should output - bond3, bond4, bond5, my_file4, my_file5, my_file6, bond6, my_file8, my_file9, my_file10 My code for the above problem is here #include<dirent.h> #include<unistd.h> #include<string.h> #include<sys/stat.h> #include<stdlib.h> #include<stdio.h> char *directs[20], *files[20]; int i = 0; int j = 0; int count = 0; void printdir(char *); int count_dirs(char *); int count_files(char *); int main() { char startdir[20]; printf("Scanning user directories\n"); scanf("%s", startdir); printdir(startdir); } void printdir(char *dir) { printf("printdir called %d directory is %s\n", ++count, dir); DIR *dp = opendir(dir); int nDirs, nFiles, nD, nF; nDirs = 0; nFiles = 0; nD = 0; nF = 0; if (dp) { struct dirent *entry = 0; struct stat statBuf; nDirs = count_dirs(dir); nFiles = count_files(dir); printf("The no of subdirectories in %s is %d \n", dir, nDirs); printf("The no of files in %s is %d \n", dir, nFiles); while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { } if (S_ISDIR(statBuf.st_mode)) { nD++; if ((nDirs - nD) < 3) { printf("The directory is %s\n",entry->d_name); } } else { nF++; if ((nFiles - nF) < 3) { printf("The files are %s\n", entry->d_name); } //if } //else free(filepath); } //if(filepath) } //while while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } printf("In second while loop *entry=%s\n",entry->d_name); char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { } if (S_ISDIR(statBuf.st_mode)) { printdir(entry->d_name); } } //else free(filepath); } //2nd while closedir(dp); } else { fprintf(stderr, "Error, cannot open directory %s\n", dir); } } //printdir int count_dirs(char *dir) { DIR *dp = opendir(dir); int nD; nD = 0; if (dp) { struct dirent *entry = 0; struct stat statBuf; while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { fprintf(stderr, "File Not found? %s\n", filepath); } if (S_ISDIR(statBuf.st_mode)) { nD++; } else { continue; } free(filepath); } } closedir(dp); } else { fprintf(stderr, "Error, cannot open directory %s\n", dir); } return nD; } int count_files(char *dir) { DIR *dp = opendir(dir); int nF; nF = 0; if (dp) { struct dirent *entry = 0; struct stat statBuf; while ((entry = readdir(dp)) != 0) { if (strcmp(entry->d_name, ".") == 0 || strcmp(entry->d_name, "..") == 0) { continue; } char *filepath = malloc(strlen(dir) + strlen(entry->d_name) + 2); if (filepath) { sprintf(filepath, "%s/%s", dir, entry->d_name); if (lstat(filepath, &statBuf) != 0) { fprintf(stderr, "File Not found? %s\n", filepath); } if (S_ISDIR(statBuf.st_mode)) { continue; } else { nF++; } free(filepath); } } closedir(dp); } else { fprintf(stderr, "Error, cannot open file %s\n", dir); } return nF; } The above code I wrote is a bit not functioning correctly can some one help me to understand the error which is coming.So that I improve it further.There seems to be some small glitch which is not clear to me right now.

    Read the article

  • New hire expectations... (Am I being unreasonable?)

    - by user295841
    I work for a very small custom software shop. We currently consist me and my boss. My boss is an old FoxPro DOS developer and OOP makes him uncomfortable. He is planning on taking a back seat in the next few years to hopefully enjoy a “partial retirement”. I will be taking over the day to day operations and we are now desperately looking for more help. We tried Monster.com, Dice.com, and others a few years ago when we started our search. We had no success. We have tried outsourcing overseas (total disaster), hiring kids right out of college (mostly a disaster but that’s where I came from), interns (good for them, not so good for us) and hiring laid off “experienced” developers (there was a reason they were laid off). I have heard hiring practices discussed on podcasts, blogs, etc... and have tried a few. The “Fizz Buzz” test was a good one. One kid looked physically ill before he finally gave up. I think my problem is that I have grown so much as a developer since I started here that I now have a high standard. I hear/read very intelligent people podcasts and blogs and I know that there are lots of people out there that can do the job. I don’t want to settle for less than a “good” developer. Perhaps my expectations are unreasonable. I expect any good developer (entry level or experienced) to be billable (at least paying their own wage) in under one month. I expect any good developer to be able to be productive (at least dangerous) in any language or technology with only a few days of research/training. I expect any good developer to be able to take a project from initial customer request to completion with little or no help from others. Am I being unreasonable? What constitutes a valuable developer? What should be expected of an entry level developer? What should be expected of an experienced developer? I realize that everyone is different but there has to be some sort of expectations standard, right? I have been giving the test project below to potential canidates to weed them out. Good idea? Too much? Too little? Please let me know what you think. Thanks. Project ID: T00001 Description: Order Entry System Deadline: 1 Week Scope The scope of this project is to develop a fully function order entry system. Screen/Form design must be user friendly and promote efficient data entry and modification. User experience (Navigation, Screen/Form layouts, Look and Feel…) is at the developer’s discretion. System may be developed using any technologies that conform to the technical and system requirements. Deliverables Complete source code Database setup instructions (Scripts or restorable backup) Application installation instructions (Installer or installation procedure) Any necessary documentation Technical Requirements Server Platform – Windows XP / Windows Server 2003 / SBS Client Platform – Windows XP Web Browser (If applicable) – IE 8 Database – At developer’s discretion (Must be a relational SQL database.) Language – At developer’s discretion All data must be normalized. (+) All data must maintain referential integrity. (++) All data must be indexed for optimal performance. System must handle concurrency. System Requirements Customer Maintenance Customer records must have unique ID. Customer data will include Name, Address, Phone, etc. User must be able to perform all CRUD (Create, Read, Update, and Delete) operations on the Customer table. User must be able to enter a specific Customer ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a customer to edit. Validation must be performed prior to database commit. Customer record cannot be deleted if the customer has an order in the system. (++) Inventory Maintenance Part records must have unique ID. Part data will include Description, Price, UOM (Unit of Measure), etc. User must be able to perform all CRUD operations on the part table. User must be able to enter a specific Part ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a part to edit. Validation must be performed prior to database commit. Part record cannot be deleted if the part has been used in an order. (++) Order Entry Order records must have a unique auto-incrementing key (Order Number). Order data must be split into a header/detail structure. (+) Order can contain an infinite number of detail records. Order header data will include Order Number, Customer ID (++), Order Date, Order Status (Open/Closed), etc. Order detail data will include Part Number (++), Quantity, Price, etc. User must be able to perform all CRUD operations on the order tables. User must be able to enter a specific Order Number to edit. User must be able to pull up a sortable/queryable search grid/utility to find an order to edit. User must be able to print an order form from within the order entry form. Validation must be performed prior to database commit. Reports Customer Listing – All Customers in the system. Inventory Listing – All parts in the system. Open Order Listing – All open orders in system. Customer Order Listing – All orders for specific customer. All reports must include sorts and filter functions where applicable. Ex. Customer Listing by range of Customer IDs. Open Order Listing by date range.

    Read the article

  • Saving in mongoDb with Mongoose, unexpected elements saved

    - by guiomie
    When I write in my mongoDB with mongoose the operation is treated with success, my document is saved, but there is also all kind of weird other sutff written down. It seems to be mongoose code. What could cause this? I add stuff in a specific array with: resultReference.ref[arrayLocation].allEvents.push(theEvent); {id: 11, allEvents: [] } is the structure of a ref element, and I push theEvent in the allEvents array. I then resultReference.save() I use express, mongoose and mongoHQ for database. I tried on a local mongo server, and this annoyance is still there. I've print in my console the document to write before save() and non of this weird code is there. { id 11 allEvents [ 0 { _events { maxListeners 0 } _doc { _id {"$oid": "4eb87834f54944e263000003"} title "Test" allDay false start 2011-11-10 13:00:00 UTC end 2011-11-10 15:00:00 UTC url "/test/4eb87834f54944e263000002" color "#99CCFF" ref "4eb87834f54944e263000002" } _activePaths { paths { title "modify" allDay "modify" start "modify" end "modify" url "modify" color "modify" ref "modify" } states { init { } modify { title true allDay true start true end true url true color true ref true } require { } } stateNames [ 0 "require" 1 "modify" 2 "init" ] } _saveError null _validationError null isNew true _pres { save [ 0 function (next) { // we keep the error semaphore to make sure we don't // call `save` unnecessarily (we only need 1 error) var subdocs = 0 , error = false , self = this; var arrays = this._activePaths .map('init', 'modify', function (i) { return self.getValue(i); }) .filter(function (val) { return (val && val instanceof DocumentArray && val.length); }); if (!arrays.length) return next(); arrays.forEach(function (array) { subdocs += array.length; array.forEach(function (value) { if (!error) value.save(function (err) { if (!error) { if (err) { error = true; next(err); } else --subdocs || next(); } }); }); }); } 1 "function checkForExistingErrors(next) { if (self._saveError){ next(self._saveError); self._saveError = null; } else { next(); } }" 2 "function validation(next) { return self.validate.call(self, next); }" ] } _posts { save [ ] } save function () { var self = this , hookArgs // arguments eventually passed to the hook - are mutable , lastArg = arguments[arguments.length-1] , pres = this._pres[name] , posts = this._posts[name] , _total = pres.length , _current = -1 , _asyncsLeft = proto[name].numAsyncPres , _next = function () { if (arguments[0] instanceof Error) { return handleError(arguments[0]); } var _args = Array.prototype.slice.call(arguments) , currPre , preArgs; if (_args.length && !(arguments[0] === null && typeof lastArg === 'function')) hookArgs = _args; if (++_current < _total) { currPre = pres[_current] if (currPre.isAsync && currPre.length < 2) throw new Error("Your pre must have next and done arguments -- e.g., function (next, done, ...)"); if (currPre.length < 1) throw new Error("Your pre must have a next argument -- e.g., function (next, ...)"); preArgs = (currPre.isAsync ? [once(_next), once(_asyncsDone)] : [once(_next)]).concat(hookArgs); return currPre.apply(self, preArgs); } else if (!proto[name].numAsyncPres) { return _done.apply(self, hookArgs); } } , _done = function () { var args_ = Array.prototype.slice.call(arguments) , ret, total_, current_, next_, done_, postArgs; if (_current === _total) { ret = fn.apply(self, args_); total_ = posts.length; current_ = -1; next_ = function () { if (arguments[0] instanceof Error) { return handleError(arguments[0]); } var args_ = Array.prototype.slice.call(arguments, 1) , currPost , postArgs; if (args_.length) hookArgs = args_; if (++current_ < total_) { currPost = posts[current_] if (currPost.length < 1) throw new Error("Your post must have a next argument -- e.g., function (next, ...)"); postArgs = [once(next_)].concat(hookArgs); return currPost.apply(self, postArgs); } }; if (total_) return next_(); return ret; } }; if (_asyncsLeft) { function _asyncsDone (err) { if (err && err instanceof Error) { return handleError(err); } --_asyncsLeft || _done.apply(self, hookArgs); } } function handleError (err) { if ('function' == typeof lastArg) return lastArg(err); if (errorCb) return errorCb.call(self, err); throw err; } return _next.apply(this, arguments); } errors null } ] } ]

    Read the article

  • Ruby number_to_currency displays a totally wrong number!

    - by SueP
    Greetings! I’m an old Delphi programmer making the leap to the Mac, Ruby, Rails, and web programming in general. I’m signed up for the Advanced Rails workshop at the end of the month. In the meantime, I’ve been working on porting a mission-critical (of course) app from Delphi to RAILS. It feels like I’ve spent most of the past year with my head buried in a book or podcast. Right now, I’ve hit a major issue and I’m tearing my hair out. I literally don’t know where to go with this, I desperately don’t want to deploy with this bug, and I’m feeling a bit frantic. (The company database is currently running on an ancient XP box that’s looking rustier by the day.) So, I set up a test database that shows the problem. I’m running: OS/X 10.6.3 Rails 2.3.5 ruby 1.8.7 (2009-06-08 patchlevel 173) [universal-darwin10.0] MySQL 5.1.38-log via socket MySQL Client Version 5.1.8 ActiveRecord::Schema.define(:version => 20100406222528) do create_table “money”, :force => true do |t| t.decimal “amount_due”, :precision => 10, :scale => 2, :default => 0.0 t.decimal “balance”, :precision => 10, :scale => 2, :default => 0.0 t.text “memofield” t.datetime “created_at” t.datetime “updated_at” end The index view is right out of the generator, slightly modified to add the formatting that's breaking on me. Listing money <table> <tr> <th>Amount</th> <th>Amount to_s </th> <th>Balance to $</th> <th>Balance with_precision </th> <th>Memofield</th> </tr> <% @money.each do |money| %> <tr> <td><%=h money.amount_due %></td> <td><%=h money.amount_due.to_s(‘F’) %></td> <td><%=h number_to_currency(money.balance) %></td> <td><%=h number_with_precision(money.balance, :precision => 2) %></td> <td><%=h money.memofield %></td> <td><%= link_to ‘Show’, money %></td> <td><%= link_to ‘Edit’, edit_money_path(money) %></td> <td><%= link_to ‘Destroy’, money, :confirm => ‘Are you sure?’, :method => :delete %></td> </tr> *<% end %> *</table> <%= link_to ‘New money’, new_money_path %> This seemed to work pretty well. Then I started testing with production data and hit a major problem with number_to_currency. The number in the database is: 10542.28, I verified it with the MySQL Query Browser. RAILS will display this as 10542.28 unless I call number_to_currency, then that number is displayed as: $15422.80 The error seems to happen with any number between 10,000.00 and 10,999.99 So far, I haven’t seen it outside of that range, but I obviously haven’t tested everything. I guess my workaround is to remove number_to_currency, but that leaves the views looking really sloppy and unprofessional. The formatting is messed up, things don’t line up properly and I can’t force the display to 2 decimal places. I’m seriously hoping there is an easy fix for this. I can’t imagine this being a widespread problem. It would affect so many people that someone would have fixed it! But I don’t know where to go from here. I’d desperately like some help. (Later – number_with_precision fails the same way number_to_currency does.) Sue Petersen

    Read the article

  • How to make my robot move in a rectangular path along the black tape?

    - by Sahat
    I am working on a robot, it's part of the summer robotics workshop in our college. We are using C-STAMP micro controllers by A-WIT. I was able to make it move, turn left, turn right, move backward. I have even managed to make it go along the black tape using a contrast sensor. I send the robot at 30-45 degrees toward the black tape on the table and it aligns itself and starts to move along the black tape. It jerks a little, probably due to my programming logic below, it's running a while loop and constantly checking if statements, so it ends up trying to turn left and right every few milliseconds, which explains the jerking part. But it's okay, it works, not as smooth as I want it to work but it works! Problem is that I can't make my robot go into a rectangular path of the black tape. As soon as it reaches the corner it just keeps going straight instead of making a left/right turn. Here's my attempt. The following code is just part of the code. My 2 sensors are located right underneath the robot, next to the front wheel, almost at the floor level. It has "index" value ranging from 0 to 8. I believe it's 8 when you have a lot of light coming into the sensor , and 0 when it's nearly pitch black. So when the robot moves into the black-tape-zone, the index value drops, and based on that I have an if-statement telling my robot to either turn left or right. To avoid confusion I didn't post the entire source code, but only the logical part responsible for the movement of my robot along the black tape. while(1) { // don't worry about these. // 10 and 9 represent Sensor's PIN location on the motherboard V = ANALOGIN(10, 1, 0, 0, 0); V2 = ANALOGIN(9, 1, 0, 0, 0); // i got this "formula" from the example in my Manual. // V stands for voltage of the sensor. // it gives me the index value of the sensor. 0 = darkest, 8 = lightest. index = ((-(V - 5) / 5) * 8 + 0.5); index2 = ((-(V2 - 5) / 5) * 8 + 0.5); // i've tweaked the position of the sensors so index > 7 is just right number. // the robot will move anywhere on the table just fine with index > 7. // as soon as it drops to or below 7 (i.e. finds black tape), the robot will // either turn left or right and then go forward. // lp & rp represent left-wheel pin and right-wheel pin, 1 means run forever. // if i change it from 1 to 100, it will go forward for 100ms. if (index > 7 && index2 > 7) goForward(lp, rp, 1); if (index <= 7) { turnLeft(lp, rp, 1); goForward(lp, rp, 1); // this is the tricky part. i've added this code last minute // trying to make my robot turn, but i didn't work. if (index > 4) { turnLeft(lp, rp, 1); goForward(lp, rp, 1); } } else if (index2 <= 7) { turnRight(lp, rp, 1); goForward(lp, rp, 1); // this is also the last minute addition. it's same code as above // but it's for the 2nd sensor. if (index2 > 4) { turnRight(lp, rp, 1); goForward(lp, rp, 1); } } I've spent the entire day trying to figure it out. I've pretty much exhausted all avenues. Asking for the solution on stackoverflow is my very last option now. Thanks in advance! If you have any questions about the code, let me know, but comments should be self-explanatory.

    Read the article

  • OpenGL + cgFX Alpha Blending failure

    - by dopplex
    I have a shader that needs to additively blend to its output render target. While it had been fully implemented and working, I recently refactored and have done something that is causing the alpha blending to not work anymore. I'm pretty sure that the problem is somewhere in my calls to either OpenGL or cgfx - but I'm currently at a loss for where exactly the problem is, as everything looks like it is set up properly for alpha blending to occur. No OpenGL or cg framework errors are showing up, either. For some context, what I'm doing here is taking a buffer which contains screen position and luminance values for each pixel, copying it to a PBO, and using it as the vertex buffer for drawing GL_POINTS. Everything except for the alpha blending appears to be working as expected. I've confirmed both that the input vertex buffer has the correct values, and that my vertex and fragment shaders are outputting the points to the correct locations and with the correct luminance values. The way that I've arrived at the conclusion that the Alpha blending was broken is by making my vertex shader output every point to the same screen location and then setting the pixel shader to always output a value of float4(0.5) for that pixel. Invariably, the end color (dumped afterwards) ends up being float4(0.5). The confusing part is that as far as I can tell, everything is properly set for alpha blending to occur. The cgfx pass has the two following state assignments (among others - I'll put a full listing at the end): BlendEnable = true; BlendFunc = int2(One, One); This ought to be enough, since I am calling cgSetPassState() - and indeed, when I use glGets to check the values of GL_BLEND_SRC, GL_BLEND_DEST, GL_BLEND, and GL_BLEND_EQUATION they all look appropriate (GL_ONE, GL_ONE, GL_TRUE, and GL_FUNC_ADD). This check was done immediately after the draw call. I've been looking around to see if there's anything other than blending being enabled and the blending function being correctly set that would cause alpha blending not to occur, but without any luck. I considered that I could be doing something wrong with GL, but GL is telling me that blending is enabled. I doubt it's cgFX related (as otherwise the GL state wouldn't even be thinking it was enabled) but it still fails if I explicitly use GL calls to set the blend mode and enable it. Here's the trimmed down code for starting the cgfx pass and the draw call: CGtechnique renderTechnique = Filter->curTechnique; TEXUNITCHECK; CGpass pass = cgGetFirstPass(renderTechnique); TEXUNITCHECK; while (pass) { cgSetPassState(pass); cgUpdatePassParameters(pass); //drawFSPointQuadBuff((void*)PointQuad); drawFSPointQuadBuff((void*)LumPointBuffer); TEXUNITCHECK; cgResetPassState(pass); pass = cgGetNextPass(pass); }; and the function with the draw call: void drawFSPointQuadBuff(void* args) { PointBuffer* pointBuffer = (PointBuffer*)args; FBOERRCHECK; glClear(GL_COLOR_BUFFER_BIT); GLERRCHECK; glPointSize(1.0); GLERRCHECK; glEnableClientState(GL_VERTEX_ARRAY); GLERRCHECK; glEnable(GL_POINT_SMOOTH); if (pointBuffer-BufferObject) { glBindBufferARB(GL_ARRAY_BUFFER_ARB, (unsigned int)pointBuffer-BufData); glVertexPointer(pointBuffer-numComp, GL_FLOAT, 0, 0); } else { glVertexPointer(pointBuffer-numComp, GL_FLOAT, 0, pointBuffer-BufData); }; GLERRCHECK; glDrawArrays(GL_POINTS, 0, pointBuffer-numElem); GLboolean testBool; glGetBooleanv(GL_BLEND, &testBool); int iblendColor, iblendDest, iblendEquation, iblendSrc; glGetIntegerv(GL_BLEND_SRC, &iblendSrc); glGetIntegerv(GL_BLEND_DST, &iblendDest); glGetIntegerv(GL_BLEND_EQUATION, &iblendEquation); if (iblendEquation == GL_FUNC_ADD) { cerr << "Correct func" << endl; }; GLERRCHECK; if (pointBuffer-BufferObject) { glBindBufferARB(GL_ARRAY_BUFFER_ARB,0); } GLERRCHECK; glDisableClientState(GL_VERTEX_ARRAY); GLERRCHECK; }; Finally, here is the full state setting of the shader: AlphaTestEnable = false; DepthTestEnable = false; DepthMask = false; ColorMask = true; CullFaceEnable = false; BlendEnable = true; BlendFunc = int2(One, One); FragmentProgram = compile glslf std_PS(); VertexProgram = compile glslv bilatGridVS2();

    Read the article

  • Work time in fullcalendar [Solution]

    - by Zozo
    Full calendar have no included options to work-time feature (selecting first and last rows in agenda view for any day - where in example company is not working). I managed something like that: viewDisplay: function(view){ $.ajax({ url: 'index.php?r=calendar/Default/worktime', dataType: 'json', success: function(data){ if(view.name=='agendaWeek') selectWorkTime(data, 30, 0, 24, false); else if(view.name=='agendaDay') selectDayWorkTime(data, 30, 0, 24, view, false); } }); } Where index.php?r=calendar/Default/worktime is php file returning json. It looks like that: $arr = array( 'mon' => array('8:00', '17:00'), 'tue' => array('9:00', '15:00'), 'wed' => array('9:30', '19:00'), 'thu' => array('6:00', '14:00'), 'fri' => array('0:00', '24:00'), 'sat' => array('9:00', '14:00'), 'sun' => array() ); foreach ($arr as &$day){ foreach($day as &$hour){ $tmp = explode(':', $hour); $hour = $tmp[0] * 3600 + $tmp[1] * 60; } } print json_encode($arr); and at the end, some functions using for counting and selecting work-time: function selectDayWorkTime(timeArray, slotMinutes, minTime, maxTime, viewObject, showAtHolidays){ var dayname; $('.fc-content').find('.fc-view-agendaWeek').find('.fc-agenda-body') .children('.fc-work-time').remove(); $('.fc-content').find('.fc-view-agendaDay') .find('.fc-work-time-day').removeClass('fc-work-time-day'); switch(viewObject.start.getDay()){ case 1: dayname='mon'; break; case 2: dayname='tue'; break; case 3: dayname='wed'; break; case 4: dayname='thu'; break; case 5: dayname='fri'; break; case 6: dayname='sat'; break; case 0: dayname='sun'; break; } for(var day in timeArray){ if(day == dayname){ if($('.fc-content').find('.fc-view-agendaDay').find('.fc-'+day).attr('class').search('fc-holiday') == -1 || showAtHolidays){ var startBefore = 0; var endBefore = timeArray[day][0] / (60 * slotMinutes) - (minTime * 60) / slotMinutes; var startAfter = timeArray[day][1] / (60 * slotMinutes) - (minTime * 60) / slotMinutes; var endAfter = (maxTime - minTime) * 60 / slotMinutes - 1; for(startBefore; startBefore < endBefore; startBefore++){ $('.fc-view-agendaDay').find('.fc-slot'+startBefore).find('div').addClass('fc-work-time-day'); } for(startAfter; startAfter <= endAfter; startAfter++){ $('.fc-view-agendaDay').find('.fc-slot'+startAfter).find('div').addClass('fc-work-time-day'); } } } } } function selectWorkTime(timeArray, slotMinutes, minTime, maxTime, showAtHolidays){ for(var day in timeArray){ var startBefore = 0; var endBefore = timeArray[day][0] / (60 * slotMinutes) - (minTime * 60) / slotMinutes; var startAfter = timeArray[day][1] / (60 * slotMinutes) - (minTime * 60) / slotMinutes; var endAfter = (maxTime - minTime) * 60 / slotMinutes - 1; if(startBefore > endBefore) endBefore = startBefore; if(startAfter > endAfter) startAfter = endAfter; try{ selectCell(startBefore, endBefore, 'fc-'+day, 'fc-work-time', false, showAtHolidays); selectCell(startAfter, endAfter, 'fc-'+day, 'fc-work-time', true, showAtHolidays); } catch(e){ continue; } } } function selectCell(startRowNo, endRowNo, collClass, cellClass, closeGap, showAtHolidays){ $('.fc-content').find('.fc-view-agendaWeek').find('.fc-agenda-body') .children('.'+cellClass+''+startRowNo+''+collClass).remove(); $('.fc-content').find('.fc-view-agendaDay') .find('.fc-work-time-day').removeClass('fc-work-time-day'); if($('.fc-content').find('.fc-view-agendaWeek').find('.'+collClass).attr('class').search('fc-holiday') == -1 || showAtHolidays){ var width = $('.fc-content').find('.fc-view-agendaWeek') .find('.'+collClass+':last').width(); var height = 0; if(closeGap && (startRowNo != endRowNo)){ height = $('.fc-content').find('.fc-view-agendaWeek') .find('.fc-slot'+ startRowNo).height(); } $('.fc-view-agendaWeek').find('.fc-agenda-body').prepend('<div class="'+cellClass+' ' + ''+cellClass+''+startRowNo+''+collClass+'"></div>'); $('.'+cellClass).width(width - 2); height += $('.fc-content').find('.fc-view-agendaWeek') .find('.fc-slot'+ endRowNo).position().top - $('.fc-content').find('.fc-view-agendaWeek') .find('.fc-slot'+ startRowNo).position().top; $('.'+cellClass+''+startRowNo+''+collClass).height(height); $('.'+cellClass+''+startRowNo+''+collClass) .css('margin-top', $('.fc-content').find('.fc-view-agendaWeek') .find('.fc-slot'+ startRowNo).position().top); $('.'+cellClass+''+startRowNo+''+collClass) .css('margin-left', $('.fc-content').find('.fc-view-agendaWeek') .find('.'+collClass+':last').offset().left - width / 2); } } Don't forget about CSS: .fc-work-time-day{ background-color: yellow; opacity: 0.3; filter: alpha(opacity=30); /* for IE */ } .fc-work-time{ position: absolute; background-color: yellow; z-index:10; margin: 0; padding: 0; text-align: left; z-index: 0; opacity: 0.3; filter: alpha(opacity=30); /* for IE */ } So, I've got some questions about - is the other way to make the same, but no using absolute div's in agendaWeek? And... How can I get in viewDisplay function actual slotMinutes, minTime and maxTime

    Read the article

  • Losing NSManaged Objects in my Application

    - by Wayfarer
    I've been doing quite a bit of work on a fun little iPhone app. At one point, I get a bunch of player objects from my Persistant store, and then display them on the screen. I also have the options of adding new player objects (their just custom UIButtons) and removing selected players. However, I believe I'm running into some memory management issues, in that somehow the app is not saving which "players" are being displayed. Example: I have 4 players shown, I select them all and then delete them all. They all disappear. But if I exit and then reopen the application, they all are there again. As though they had never left. So somewhere in my code, they are not "really" getting removed. MagicApp201AppDelegate *appDelegate = [[UIApplication sharedApplication] delegate]; context = [appDelegate managedObjectContext]; NSFetchRequest *request = [[NSFetchRequest alloc] init]; NSEntityDescription *desc = [NSEntityDescription entityForName:@"Player" inManagedObjectContext:context]; [request setEntity:desc]; NSError *error; NSMutableArray *objects = [[[context executeFetchRequest:request error:&error] mutableCopy] autorelease]; if (objects == nil) { NSLog(@"Shit man, there was an error taking out the single player object when the view did load. ", error); } int j = 0; while (j < [objects count]) { if ([[[objects objectAtIndex:j] valueForKey:@"currentMultiPlayer"] boolValue] == NO) { [objects removeObjectAtIndex:j]; j--; } else { j++; } } [self setPlayers:objects]; //This is a must, it NEEDS to work Objects are all the players playing So in this snippit (in the viewdidLoad method), I grab the players out of the persistant store, and then remove the objects I don't want (those whose boolValue is NO), and the rest are kept. This works, I'm pretty sure. I think the issue is where I remove the players. Here is that code: NSLog(@"Remove players"); /** For each selected player: Unselect them (remove them from SelectedPlayers) Remove the button from the view Remove the button object from the array Remove the player from Players */ NSLog(@"Debugging Removal: %d", [selectedPlayers count]); for (int i=0; i < [selectedPlayers count]; i++) { NSManagedObject *rPlayer = [selectedPlayers objectAtIndex:i]; [rPlayer setValue:[NSNumber numberWithBool:NO] forKey:@"currentMultiPlayer"]; int index = [players indexOfObjectIdenticalTo:rPlayer]; //this is the index we need for (int j = (index + 1); j < [players count]; j++) { UIButton *tempButton = [playerButtons objectAtIndex:j]; tempButton.tag--; } NSError *error; if ([context hasChanges] && ![context save:&error]) { NSLog(@"Unresolved error %@, %@", error, [error userInfo]); abort(); } UIButton *aButton = [playerButtons objectAtIndex:index]; [players removeObjectAtIndex:index]; [aButton removeFromSuperview]; [playerButtons removeObjectAtIndex:index]; } [selectedPlayers removeAllObjects]; NSError *error; if ([context hasChanges] && ![context save:&error]) { NSLog(@"Unresolved error %@, %@", error, [error userInfo]); abort(); } NSLog(@"About to refresh YES"); [self refreshAllPlayers:YES]; The big part in the second code snippet is I set them to NO for currentMultiPlayer. NO NO NO NO NO, they should NOT come back when the view does load, NEVER ever ever. Not until I say so. No other relevant part of the code sets that to YES. Which makes me think... perhaps they aren't being saved. Perhaps that doesn't save, perhaps those objects aren't being managed anymore, and so they don't get saved in. Is there a lifetime (metaphorically) of NSManaged object? The Players array is the same I set in the "viewDidLoad" method, and SelectedPlayers holds players that are selected, references to NSManagedObjects. Does it have something to do with Removing them from the array? I'm so confused, some insight would be greatly appreciated!!

    Read the article

  • STORED PROCEDURE working in my local test machine cannot be created in production environment.

    - by Marcos Buarque
    Hi, I have an SQL CREATE PROCEDURE statement that runs perfectly in my local SQL Server, but cannot be recreated in production environment. The error message I get in production is Msg 102, Level 15, State 1, Incorrect syntax near '='. It is a pretty big query and I don't want to annoy StackOverflow users, but I simply can't find a solution. If only you could point me out what settings I could check in the production server in order to enable running the code... I must be using some kind of syntax or something that is conflicting with some setting in production. This PROCEDURE was already registered in production before, but when I ran a DROP - CREATE PROCEDURE today, the server was able to drop the procedure, but not to recreate it. I will paste the code below. Thank you! =============== USE [Enorway] GO /****** Object: StoredProcedure [dbo].[Spel_CM_ChartsUsersTotals] Script Date: 03/17/2010 11:59:57 ******/ SET ANSI_NULLS ON GO SET QUOTED_IDENTIFIER ON GO CREATE PROC [dbo].[Spel_CM_ChartsUsersTotals] @IdGroup int, @IdAssessment int, @UserId int AS SET NOCOUNT ON DECLARE @RequiredColor varchar(6) SET @RequiredColor = '3333cc' DECLARE @ManagersColor varchar(6) SET @ManagersColor = '993300' DECLARE @GroupColor varchar(6) SET @GroupColor = 'ff0000' DECLARE @SelfColor varchar(6) SET @SelfColor = '336600' DECLARE @TeamColor varchar(6) SET @TeamColor = '993399' DECLARE @intMyCounter tinyint DECLARE @intManagersPosition tinyint DECLARE @intGroupPosition tinyint DECLARE @intSelfPosition tinyint DECLARE @intTeamPosition tinyint SET @intMyCounter = 1 -- Table that will hold the subtotals... DECLARE @tblTotalsSource table ( IdCompetency int, CompetencyName nvarchar(200), FunctionRequiredLevel float, ManagersAverageAssessment float, SelfAssessment float, GroupAverageAssessment float, TeamAverageAssessment float ) INSERT INTO @tblTotalsSource ( IdCompetency, CompetencyName, FunctionRequiredLevel, ManagersAverageAssessment, SelfAssessment, GroupAverageAssessment, TeamAverageAssessment ) SELECT e.[IdCompetency], dbo.replaceAccentChar(e.[Name]) AS CompetencyName, (i.[LevelNumber]) AS FunctionRequiredLevel, ( SELECT ROUND(avg(CAST(ac.[LevelNumber] AS float)),0) FROM Spel_CM_AssessmentsData aa INNER JOIN Spel_CM_CompetenciesLevels ab ON aa.[IdCompetencyLevel] = ab.[IdCompetencyLevel] INNER JOIN Spel_CM_Levels ac ON ab.[IdLevel] = ac.[IdLevel] INNER JOIN Spel_CM_AssessmentsEvents ad ON aa.[IdAssessmentEvent] = ad.[IdAssessmentEvent] WHERE aa.[EvaluatedUserId] = @UserId AND aa.[AssessmentType] = 't' AND aa.[IdGroup] = @IdGroup AND ab.[IdCompetency] = e.[IdCompetency] AND ad.[IdAssessment] = @IdAssessment ) AS ManagersAverageAssessment, ( SELECT bc.[LevelNumber] FROM Spel_CM_AssessmentsData ba INNER JOIN Spel_CM_CompetenciesLevels bb ON ba.[IdCompetencyLevel] = bb.[IdCompetencyLevel] INNER JOIN Spel_CM_Levels bc ON bb.[IdLevel] = bc.[IdLevel] INNER JOIN Spel_CM_AssessmentsEvents bd ON ba.[IdAssessmentEvent] = bd.[IdAssessmentEvent] WHERE ba.[EvaluatedUserId] = @UserId AND ba.[AssessmentType] = 's' AND ba.[IdGroup] = @IdGroup AND bb.[IdCompetency] = e.[IdCompetency] AND bd.[IdAssessment] = @IdAssessment ) AS SelfAssessment, ( SELECT ROUND(avg(CAST(cc.[LevelNumber] AS float)),0) FROM Spel_CM_AssessmentsData ca INNER JOIN Spel_CM_CompetenciesLevels cb ON ca.[IdCompetencyLevel] = cb.[IdCompetencyLevel] INNER JOIN Spel_CM_Levels cc ON cb.[IdLevel] = cc.[IdLevel] INNER JOIN Spel_CM_AssessmentsEvents cd ON ca.[IdAssessmentEvent] = cd.[IdAssessmentEvent] WHERE ca.[EvaluatedUserId] = @UserId AND ca.[AssessmentType] = 'g' AND ca.[IdGroup] = @IdGroup AND cb.[IdCompetency] = e.[IdCompetency] AND cd.[IdAssessment] = @IdAssessment ) AS GroupAverageAssessment, ( SELECT ROUND(avg(CAST(dc.[LevelNumber] AS float)),0) FROM Spel_CM_AssessmentsData da INNER JOIN Spel_CM_CompetenciesLevels db ON da.[IdCompetencyLevel] = db.[IdCompetencyLevel] INNER JOIN Spel_CM_Levels dc ON db.[IdLevel] = dc.[IdLevel] INNER JOIN Spel_CM_AssessmentsEvents dd ON da.[IdAssessmentEvent] = dd.[IdAssessmentEvent] WHERE da.[EvaluatedUserId] = @UserId AND da.[AssessmentType] = 'm' AND da.[IdGroup] = @IdGroup AND db.[IdCompetency] = e.[IdCompetency] AND dd.[IdAssessment] = @IdAssessment ) AS TeamAverageAssessment FROM Spel_CM_AssessmentsData a INNER JOIN Spel_CM_AssessmentsEvents c ON a.[IdAssessmentEvent] = c.[IdAssessmentEvent] INNER JOIN Spel_CM_CompetenciesLevels d ON a.[IdCompetencyLevel] = d.[IdCompetencyLevel] INNER JOIN Spel_CM_Competencies e ON d.[IdCompetency] = e.[IdCompetency] INNER JOIN Spel_CM_Levels f ON d.[IdLevel] = f.[IdLevel] -- This will link with user's assigned functions INNER JOIN Spel_CM_FunctionsCompetenciesLevels g ON a.[IdFunction] = g.[IdFunction] INNER JOIN Spel_CM_CompetenciesLevels h ON g.[IdCompetencyLevel] = h.[IdCompetencyLevel] AND e.[IdCompetency] = h.[IdCompetency] INNER JOIN Spel_CM_Levels i ON h.[IdLevel] = i.[IdLevel] WHERE (NOT c.[EndDate] IS NULL) AND a.[EvaluatedUserId] = @UserId AND c.[IdAssessment] = @IdAssessment AND a.[IdGroup] = @IdGroup GROUP BY e.[IdCompetency], e.[Name], i.[LevelNumber] ORDER BY e.[Name] ASC -- This will define the position of each element (managers, group, self and team) SELECT @intManagersPosition = @intMyCounter FROM @tblTotalsSource WHERE NOT ManagersAverageAssessment IS NULL IF IsNumeric(@intManagersPosition) = 1 BEGIN SELECT @intMyCounter += 1 END SELECT @intGroupPosition = @intMyCounter FROM @tblTotalsSource WHERE NOT GroupAverageAssessment IS NULL IF IsNumeric(@intGroupPosition) = 1 BEGIN SELECT @intMyCounter += 1 END SELECT @intSelfPosition = @intMyCounter FROM @tblTotalsSource WHERE NOT SelfAssessment IS NULL IF IsNumeric(@intSelfPosition) = 1 BEGIN SELECT @intMyCounter += 1 END SELECT @intTeamPosition = @intMyCounter FROM @tblTotalsSource WHERE NOT TeamAverageAssessment IS NULL -- This will render the final table for the end user. The tabe will flatten some of the numbers to allow them to be prepared for Google Graphics. SELECT SUBSTRING( ( SELECT ( '|' + REPLACE(ma.[CompetencyName],' ','+')) FROM @tblTotalsSource ma ORDER BY ma.[CompetencyName] DESC FOR XML PATH('') ), 2, 1000) AS 'CompetenciesNames', SUBSTRING( ( SELECT ( ',' + REPLACE(ra.[FunctionRequiredLevel]*10,' ','+')) FROM @tblTotalsSource ra FOR XML PATH('') ), 2, 1000) AS 'FunctionRequiredLevel', SUBSTRING( ( SELECT ( ',' + CAST(na.[ManagersAverageAssessment]*10 AS nvarchar(10))) FROM @tblTotalsSource na FOR XML PATH('') ), 2, 1000) AS 'ManagersAverageAssessment', SUBSTRING( ( SELECT ( ',' + CAST(oa.[GroupAverageAssessment]*10 AS nvarchar(10))) FROM @tblTotalsSource oa FOR XML PATH('') ), 2, 1000) AS 'GroupAverageAssessment', SUBSTRING( ( SELECT ( ',' + CAST(pa.[SelfAssessment]*10 AS nvarchar(10))) FROM @tblTotalsSource pa FOR XML PATH('') ), 2, 1000) AS 'SelfAssessment', SUBSTRING( ( SELECT ( ',' + CAST(qa.[TeamAverageAssessment]*10 AS nvarchar(10))) FROM @tblTotalsSource qa FOR XML PATH('') ), 2, 1000) AS 'TeamAverageAssessment', SUBSTRING( ( SELECT ( '|t++' + CAST([FunctionRequiredLevel] AS varchar(10)) + ',' + @RequiredColor + ',0,' + CAST(ROW_NUMBER() OVER(ORDER BY CompetencyName) - 1 AS varchar(2)) + ',9') FROM @tblTotalsSource FOR XML PATH('') ), 2, 1000) AS 'FunctionRequiredAverageLabel', SUBSTRING( ( SELECT ( '|t++' + CAST([ManagersAverageAssessment] AS varchar(10)) + ',' + @ManagersColor + ',' + CAST(@intManagersPosition AS varchar(2)) + ',' + CAST(ROW_NUMBER() OVER(ORDER BY CompetencyName) - 1 AS varchar(2)) + ',9') FROM @tblTotalsSource FOR XML PATH('') ), 2, 1000) AS 'ManagersLabel', SUBSTRING( ( SELECT ( '|t++' + CAST([GroupAverageAssessment] AS varchar(10)) + ',' + @GroupColor + ',' + CAST(@intGroupPosition AS varchar(2)) + ',' + CAST(ROW_NUMBER() OVER(ORDER BY CompetencyName) - 1 AS varchar(2)) + ',9') FROM @tblTotalsSource FOR XML PATH('') ), 2, 1000) AS 'GroupLabel', SUBSTRING( ( SELECT ( '|t++' + CAST([SelfAssessment] AS varchar(10)) + ',' + @SelfColor + ',' + CAST(@intSelfPosition AS varchar(2)) + ',' + CAST(ROW_NUMBER() OVER(ORDER BY CompetencyName) - 1 AS varchar(2)) + ',9') FROM @tblTotalsSource FOR XML PATH('') ), 2, 1000) AS 'SelfLabel', SUBSTRING( ( SELECT ( '|t++' + CAST([TeamAverageAssessment] AS varchar(10)) + ',' + @TeamColor + ',' + CAST(@intTeamPosition AS varchar(2)) + ',' + CAST(ROW_NUMBER() OVER(ORDER BY CompetencyName) - 1 AS varchar(2)) + ',10') FROM @tblTotalsSource FOR XML PATH('') ), 2, 1000) AS 'TeamLabel', (Count(src.[IdCompetency]) * 30) + 100 AS 'ControlHeight' FROM @tblTotalsSource src SET NOCOUNT OFF GO

    Read the article

  • .NET interview, code structure and the design

    - by j_lewis
    I have been given the below .NET question in an interview. I don’t know why I got low marks. Unfortunately I did not get a feedback. Question: The file hockey.csv contains the results from the Hockey Premier League. The columns ‘For’ and ‘Against’ contain the total number of goals scored for and against each team in that season (so Alabama scored 79 goals against opponents, and had 36 goals scored against them). Write a program to print the name of the team with the smallest difference in ‘for’ and ‘against’ goals. the structure of the hockey.csv looks like this (it is a valid csv file, but I just copied the values here to get an idea) Team - For - Against Alabama 79 36 Washinton 67 30 Indiana 87 45 Newcastle 74 52 Florida 53 37 New York 46 47 Sunderland 29 51 Lova 41 64 Nevada 33 63 Boston 30 64 Nevada 33 63 Boston 30 64 Solution: class Program { static void Main(string[] args) { string path = @"C:\Users\<valid csv path>"; var resultEvaluator = new ResultEvaluator(string.Format(@"{0}\{1}",path, "hockey.csv")); var team = resultEvaluator.GetTeamSmallestDifferenceForAgainst(); Console.WriteLine( string.Format("Smallest difference in ‘For’ and ‘Against’ goals > TEAM: {0}, GOALS DIF: {1}", team.Name, team.Difference )); Console.ReadLine(); } } public interface IResultEvaluator { Team GetTeamSmallestDifferenceForAgainst(); } public class ResultEvaluator : IResultEvaluator { private static DataTable leagueDataTable; private readonly string filePath; private readonly ICsvExtractor csvExtractor; public ResultEvaluator(string filePath){ this.filePath = filePath; csvExtractor = new CsvExtractor(); } private DataTable LeagueDataTable{ get { if (leagueDataTable == null) { leagueDataTable = csvExtractor.GetDataTable(filePath); } return leagueDataTable; } } public Team GetTeamSmallestDifferenceForAgainst() { var teams = GetTeams(); var lowestTeam = teams.OrderBy(p => p.Difference).First(); return lowestTeam; } private IEnumerable<Team> GetTeams() { IList<Team> list = new List<Team>(); foreach (DataRow row in LeagueDataTable.Rows) { var name = row["Team"].ToString(); var @for = int.Parse(row["For"].ToString()); var against = int.Parse(row["Against"].ToString()); var team = new Team(name, against, @for); list.Add(team); } return list; } } public interface ICsvExtractor { DataTable GetDataTable(string csvFilePath); } public class CsvExtractor : ICsvExtractor { public DataTable GetDataTable(string csvFilePath) { var lines = File.ReadAllLines(csvFilePath); string[] fields; fields = lines[0].Split(new[] { ',' }); int columns = fields.GetLength(0); var dt = new DataTable(); //always assume 1st row is the column name. for (int i = 0; i < columns; i++) { dt.Columns.Add(fields[i].ToLower(), typeof(string)); } DataRow row; for (int i = 1; i < lines.GetLength(0); i++) { fields = lines[i].Split(new char[] { ',' }); row = dt.NewRow(); for (int f = 0; f < columns; f++) row[f] = fields[f]; dt.Rows.Add(row); } return dt; } } public class Team { public Team(string name, int against, int @for) { Name = name; Against = against; For = @for; } public string Name { get; private set; } public int Against { get; private set; } public int For { get; private set; } public int Difference { get { return (For - Against); } } } Output: Smallest difference in for' andagainst' goals TEAM: Boston, GOALS DIF: -34 Can someone please review my code and see anything obviously wrong here? They were only interested in the structure/design of the code and whether the program produces the correct result (i.e lowest difference). Much appreciated. "P.S - Please correct me if the ".net-interview" tag is not the right tag to use"

    Read the article

< Previous Page | 764 765 766 767 768 769 770 771 772 773 774 775  | Next Page >