Search Results

Search found 4812 results on 193 pages for 'expression encoder'.

Page 78/193 | < Previous Page | 74 75 76 77 78 79 80 81 82 83 84 85  | Next Page >

  • trie reg exp parse step over char and continue

    - by forest.peterson
    Setup: 1) a string trie database formed from linked nodes and a vector array linking to the next node terminating in a leaf, 2) a recursive regular expression function that if A) char '*' continues down all paths until string length limit is reached, then continues down remaining string paths if valid, and B) char '?' continues down all paths for 1 char and then continues down remaining string paths if valid. 3) after reg expression the candidate strings are measured for edit distance against the 'try' string. Problem: the reg expression works fine for adding chars or swapping ? for a char but if the remaining string has an error then there is not a valid path to a terminating leaf; making the matching function redundant. I tried adding a 'step-over' ? char if the end of the node vector was reached and then followed every path of that node - allowing this step-over only once; resulted in a memory exception; I cannot find logically why it is accessing the vector out of range - bactracking? Questions: 1) how can the regular expression step over an invalid char and continue with the path? 2) why is swapping the 'sticking' char for '?' resulting in an overflow? Function: void Ontology::matchRegExpHelper(nodeT *w, string inWild, Set<string> &matchSet, string out, int level, int pos, int stepover) { if (inWild=="") { matchSet.add(out); } else { if (w->alpha.size() == pos) { int testLength = out.length() + inWild.length(); if (stepover == 0 && matchSet.size() == 0 && out.length() > 8 && testLength == tokenLength) {//candidate generator inWild[0] = '?'; matchRegExpHelper(w, inWild, matchSet, out, level, 0, stepover+1); } else return; //giveup on this path } if (inWild[0] == '?' || (inWild[0] == '*' && (out.length() + inWild.length() ) == level ) ) { //wild matchRegExpHelper(w->alpha[pos].next, inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover);//follow path -> if ontology is full, treat '*' like a '?' } else if (inWild[0] == '*') matchRegExpHelper(w->alpha[pos].next, '*'+inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover); //keep adding chars if (inWild[0] == w->alpha[pos].letter) //follow self matchRegExpHelper(w->alpha[pos].next, inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover); //follow char matchRegExpHelper(w, inWild, matchSet, out, level, pos+1, stepover);//check next path } } Error Message: +str "Attempt to access index 1 in a vector of size 1." std::basic_string<char,std::char_traits<char>,std::allocator<char> > +err {msg="Attempt to access index 1 in a vector of size 1." } ErrorException Note: this function works fine for hundreds of test strings with '*' wilds if the extra stepover gate is not used Semi-Solved: I place a pos < w->alpha.size() condition on each path that calls w->alpha[pos]... - this prevented the backtrack calls from attempting to access the vector with an out of bounds index value. Still have other issues to work out - it loops infinitely adding the ? and backtracking to remove it, then repeat. But, moving forward now. Revised question: why during backtracking is the position index accumulating and/or not deincrementing - so at somepoint it calls w->alpha[pos]... with an invalid position that is either remaining from the next node or somehow incremented pos+1 when passing upward?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Can someone help me compare using F# over C# in this specific example (IP Address expressions)?

    - by Phobis
    So, I am writing code to parse and IP Address expression and turn it into a regular expression that could be run against and IP Address string and return a boolean response. I wrote the code in C# (OO) and it was 110 lines of code. I am trying to compare the amount of code and the expressiveness of C# to F# (I am a C# programmer and a noob at F#). I don't want to post both the C# and F#, just because I don't want to clutter the post. If needed, I will do so. Anyway, I will give an example. Here is an expression: 192.168.0.250,244-248,108,51,7;127.0.0.1 I would like to take that and turn it into this regular expression: ((192.168.0.(250|244|245|246|247|248|108|51|7))|(127.0.0.1)) Here are some steps I am following: Operations: Break by ";" 192.168.0.250,244-248,108,51,7 127.0.0.1 Break by "." 192 168 0 250,244-248,108,51,7 Break by "," 250 244-248 108 51 7 Break by "-" 244 248 I came up with F# that produces the output. I am trying to forward-pipe through my operations listed above, as I think that would be more expressive. Can anyone make this code better? Teach me something :) open System let createItemArray (group:bool) (y:char) (items:string[]) = [| let indexes = items.Length - 1 let group = indexes > 0 && group if group then yield "(" for i in 0 .. indexes do yield items.[i].ToString() if i < indexes then yield y.ToString() if group then yield ")" |] let breakBy (group:bool) (x:string) (y:char): string[] = x.Split(y) |> createItemArray group y let breakItem (x:string) (y:char): string[] = breakBy false x y let breakGroup (x:string) (y:char): string[] = breakBy true x y let AddressExpression address:string = let builder = new System.Text.StringBuilder "(" breakGroup address ';' |> Array.collect (fun octet -> breakItem octet '.') |> Array.collect (fun options -> breakGroup options ',') |> Array.collect (fun (ranges : string) -> match (breakGroup ranges '-') with | x when x.Length > 3 -> match (Int32.TryParse(x.[1]), Int32.TryParse(x.[3])) with | ((true, a) ,(true, b)) -> [|a .. b|] |> Array.map (int >> string) |> createItemArray false '-' | _ -> [|ranges|] | _ -> [|ranges|] ) |> Array.iter (fun item -> match item with | ";" -> builder.Append ")|(" | "." -> builder.Append "\." | "," | "-" -> builder.Append "|" | _ -> builder.Append item |> ignore ) builder.Append(")").ToString() let address = "192.168.0.250,244-248,108,51,7;127.0.0.1" AddressExpression address

    Read the article

  • How to specify Multiple Secure Webpages with .htaccess RewriteCond

    - by Patrick Ndille
    I have 3 pages that I want to make secure on my website using .htaccess -login.php -checkout.php -account.php I know how to make just one work page at a time using .htaccess RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] I and trying to figure out how to include the other 2 specific pages to make them also secure and used the expression below but it didn't work RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteCond %{REQUEST_URI} /checkout.php RewriteCond %{REQUEST_URI} /account.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] Can someone help me the right expression that will work with multiple pages? The second part of the code is that, if https is already on and a user move to a page that Is not any of the pages i specified about, I want that it should get back to http. how should I write the statement for it to redirect back to http if its not any of the pages above? I have my statement like this but its not working RewriteCond %{HTTPS} on RewriteRule !(checkout|login|account|payment)\.php http://%{HTTP_HOST}%{REQUEST_URI} [L,R] Any thoughts?

    Read the article

  • ASP.NET MVC Paging/Sorting/Filtering a list using ModelMetadata

    - by rajbk
    This post looks at how to control paging, sorting and filtering when displaying a list of data by specifying attributes in your Model using the ASP.NET MVC framework and the excellent MVCContrib library. It also shows how to hide/show columns and control the formatting of data using attributes.  This uses the Northwind database. A sample project is attached at the end of this post. Let’s start by looking at a class called ProductViewModel. The properties in the class are decorated with attributes. The OrderBy attribute tells the system that the Model can be sorted using that property. The SearchFilter attribute tells the system that filtering is allowed on that property. Filtering type is set by the  FilterType enum which currently supports Equals and Contains. The ScaffoldColumn property specifies if a column is hidden or not The DisplayFormat specifies how the data is formatted. public class ProductViewModel { [OrderBy(IsDefault = true)] [ScaffoldColumn(false)] public int? ProductID { get; set; }   [SearchFilter(FilterType.Contains)] [OrderBy] [DisplayName("Product Name")] public string ProductName { get; set; }   [OrderBy] [DisplayName("Unit Price")] [DisplayFormat(DataFormatString = "{0:c}")] public System.Nullable<decimal> UnitPrice { get; set; }   [DisplayName("Category Name")] public string CategoryName { get; set; }   [SearchFilter] [ScaffoldColumn(false)] public int? CategoryID { get; set; }   [SearchFilter] [ScaffoldColumn(false)] public int? SupplierID { get; set; }   [OrderBy] public bool Discontinued { get; set; } } Before we explore the code further, lets look at the UI.  The UI has a section for filtering the data. The column headers with links are sortable. Paging is also supported with the help of a pager row. The pager is rendered using the MVCContrib Pager component. The data is displayed using a customized version of the MVCContrib Grid component. The customization was done in order for the Grid to be aware of the attributes mentioned above. Now, let’s look at what happens when we perform actions on this page. The diagram below shows the process: The form on the page has its method set to “GET” therefore we see all the parameters in the query string. The query string is shown in blue above. This query gets routed to an action called Index with parameters of type ProductViewModel and PageSortOptions. The parameters in the query string get mapped to the input parameters using model binding. The ProductView object created has the information needed to filter data while the PageAndSorting object is used for paging and sorting the data. The last block in the figure above shows how the filtered and paged list is created. We receive a product list from our product repository (which is of type IQueryable) and first filter it by calliing the AsFiltered extension method passing in the productFilters object and then call the AsPagination extension method passing in the pageSort object. The AsFiltered extension method looks at the type of the filter instance passed in. It skips properties in the instance that do not have the SearchFilter attribute. For properties that have the SearchFilter attribute, it adds filter expression trees to filter against the IQueryable data. The AsPagination extension method looks at the type of the IQueryable and ensures that the column being sorted on has the OrderBy attribute. If it does not find one, it looks for the default sort field [OrderBy(IsDefault = true)]. It is required that at least one attribute in your model has the [OrderBy(IsDefault = true)]. This because a person could be performing paging without specifying an order by column. As you may recall the LINQ Skip method now requires that you call an OrderBy method before it. Therefore we need a default order by column to perform paging. The extension method adds a order expressoin tree to the IQueryable and calls the MVCContrib AsPagination extension method to page the data. Implementation Notes Auto Postback The search filter region auto performs a get request anytime the dropdown selection is changed. This is implemented using the following jQuery snippet $(document).ready(function () { $("#productSearch").change(function () { this.submit(); }); }); Strongly Typed View The code used in the Action method is shown below: public ActionResult Index(ProductViewModel productFilters, PageSortOptions pageSortOptions) { var productPagedList = productRepository.GetProductsProjected().AsFiltered(productFilters).AsPagination(pageSortOptions);   var productViewFilterContainer = new ProductViewFilterContainer(); productViewFilterContainer.Fill(productFilters.CategoryID, productFilters.SupplierID, productFilters.ProductName);   var gridSortOptions = new GridSortOptions { Column = pageSortOptions.Column, Direction = pageSortOptions.Direction };   var productListContainer = new ProductListContainerModel { ProductPagedList = productPagedList, ProductViewFilterContainer = productViewFilterContainer, GridSortOptions = gridSortOptions };   return View(productListContainer); } As you see above, the object that is returned to the view is of type ProductListContainerModel. This contains all the information need for the view to render the Search filter section (including dropdowns),  the Html.Pager (MVCContrib) and the Html.Grid (from MVCContrib). It also stores the state of the search filters so that they can recreate themselves when the page reloads (Viewstate, I miss you! :0)  The class diagram for the container class is shown below.   Custom MVCContrib Grid The MVCContrib grid default behavior was overridden so that it would auto generate the columns and format the columns based on the metadata and also make it aware of our custom attributes (see MetaDataGridModel in the sample code). The Grid ensures that the ShowForDisplay on the column is set to true This can also be set by the ScaffoldColumn attribute ref: http://bradwilson.typepad.com/blog/2009/10/aspnet-mvc-2-templates-part-2-modelmetadata.html) Column headers are set using the DisplayName attribute Column sorting is set using the OrderBy attribute. The data is formatted using the DisplayFormat attribute. Generic Extension methods for Sorting and Filtering The extension method AsFiltered takes in an IQueryable<T> and uses expression trees to query against the IQueryable data. The query is constructed using the Model metadata and the properties of the T filter (productFilters in our case). Properties in the Model that do not have the SearchFilter attribute are skipped when creating the filter expression tree.  It returns an IQueryable<T>. The extension method AsPagination takes in an IQuerable<T> and first ensures that the column being sorted on has the OrderBy attribute. If not, we look for the default OrderBy column ([OrderBy(IsDefault = true)]). We then build an expression tree to sort on this column. We finally hand off the call to the MVCContrib AsPagination which returns an IPagination<T>. This type as you can see in the class diagram above is passed to the view and used by the MVCContrib Grid and Pager components. Custom Provider To get the system to recognize our custom attributes, we create our MetadataProvider as mentioned in this article (http://bradwilson.typepad.com/blog/2010/01/why-you-dont-need-modelmetadataattributes.html) protected override ModelMetadata CreateMetadata(IEnumerable<Attribute> attributes, Type containerType, Func<object> modelAccessor, Type modelType, string propertyName) { ModelMetadata metadata = base.CreateMetadata(attributes, containerType, modelAccessor, modelType, propertyName);   SearchFilterAttribute searchFilterAttribute = attributes.OfType<SearchFilterAttribute>().FirstOrDefault(); if (searchFilterAttribute != null) { metadata.AdditionalValues.Add(Globals.SearchFilterAttributeKey, searchFilterAttribute); }   OrderByAttribute orderByAttribute = attributes.OfType<OrderByAttribute>().FirstOrDefault(); if (orderByAttribute != null) { metadata.AdditionalValues.Add(Globals.OrderByAttributeKey, orderByAttribute); }   return metadata; } We register our MetadataProvider in Global.asax.cs. protected void Application_Start() { AreaRegistration.RegisterAllAreas();   RegisterRoutes(RouteTable.Routes);   ModelMetadataProviders.Current = new MvcFlan.QueryModelMetaDataProvider(); } Bugs, Comments and Suggestions are welcome! You can download the sample code below. This code is purely experimental. Use at your own risk. Download Sample Code (VS 2010 RTM) MVCNorthwindSales.zip

    Read the article

  • HTML5 Form Validation

    - by Stephen.Walther
    The latest versions of Google Chrome (16+), Mozilla Firefox (8+), and Internet Explorer (10+) all support HTML5 client-side validation. It is time to take HTML5 validation seriously. The purpose of the blog post is to describe how you can take advantage of HTML5 client-side validation regardless of the type of application that you are building. You learn how to use the HTML5 validation attributes, how to perform custom validation using the JavaScript validation constraint API, and how to simulate HTML5 validation on older browsers by taking advantage of a jQuery plugin. Finally, we discuss the security issues related to using client-side validation. Using Client-Side Validation Attributes The HTML5 specification discusses several attributes which you can use with INPUT elements to perform client-side validation including the required, pattern, min, max, step, and maxlength attributes. For example, you use the required attribute to require a user to enter a value for an INPUT element. The following form demonstrates how you can make the firstName and lastName form fields required: <!DOCTYPE html> <html > <head> <title>Required Demo</title> </head> <body> <form> <label> First Name: <input required title="First Name is Required!" /> </label> <label> Last Name: <input required title="Last Name is Required!" /> </label> <button>Register</button> </form> </body> </html> If you attempt to submit this form without entering a value for firstName or lastName then you get the validation error message: Notice that the value of the title attribute is used to display the validation error message “First Name is Required!”. The title attribute does not work this way with the current version of Firefox. If you want to display a custom validation error message with Firefox then you need to include an x-moz-errormessage attribute like this: <input required title="First Name is Required!" x-moz-errormessage="First Name is Required!" /> The pattern attribute enables you to validate the value of an INPUT element against a regular expression. For example, the following form includes a social security number field which includes a pattern attribute: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Pattern</title> </head> <body> <form> <label> Social Security Number: <input required pattern="^d{3}-d{2}-d{4}$" title="###-##-####" /> </label> <button>Register</button> </form> </body> </html> The regular expression in the form above requires the social security number to match the pattern ###-##-####: Notice that the input field includes both a pattern and a required validation attribute. If you don’t enter a value then the regular expression is never triggered. You need to include the required attribute to force a user to enter a value and cause the value to be validated against the regular expression. Custom Validation You can take advantage of the HTML5 constraint validation API to perform custom validation. You can perform any custom validation that you need. The only requirement is that you write a JavaScript function. For example, when booking a hotel room, you might want to validate that the Arrival Date is in the future instead of the past: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Constraint Validation API</title> </head> <body> <form> <label> Arrival Date: <input id="arrivalDate" type="date" required /> </label> <button>Submit Reservation</button> </form> <script type="text/javascript"> var arrivalDate = document.getElementById("arrivalDate"); arrivalDate.addEventListener("input", function() { var value = new Date(arrivalDate.value); if (value < new Date()) { arrivalDate.setCustomValidity("Arrival date must be after now!"); } else { arrivalDate.setCustomValidity(""); } }); </script> </body> </html> The form above contains an input field named arrivalDate. Entering a value into the arrivalDate field triggers the input event. The JavaScript code adds an event listener for the input event and checks whether the date entered is greater than the current date. If validation fails then the validation error message “Arrival date must be after now!” is assigned to the arrivalDate input field by calling the setCustomValidity() method of the validation constraint API. Otherwise, the validation error message is cleared by calling setCustomValidity() with an empty string. HTML5 Validation and Older Browsers But what about older browsers? For example, what about Apple Safari and versions of Microsoft Internet Explorer older than Internet Explorer 10? What the world really needs is a jQuery plugin which provides backwards compatibility for the HTML5 validation attributes. If a browser supports the HTML5 validation attributes then the plugin would do nothing. Otherwise, the plugin would add support for the attributes. Unfortunately, as far as I know, this plugin does not exist. I have not been able to find any plugin which supports both the required and pattern attributes for older browsers, but does not get in the way of these attributes in the case of newer browsers. There are several jQuery plugins which provide partial support for the HTML5 validation attributes including: · jQuery Validation — http://docs.jquery.com/Plugins/Validation · html5Form — http://www.matiasmancini.com.ar/jquery-plugin-ajax-form-validation-html5.html · h5Validate — http://ericleads.com/h5validate/ The jQuery Validation plugin – the most popular JavaScript validation library – supports the HTML5 required attribute, but it does not support the HTML5 pattern attribute. Likewise, the html5Form plugin does not support the pattern attribute. The h5Validate plugin provides the best support for the HTML5 validation attributes. The following page illustrates how this plugin supports both the required and pattern attributes: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>h5Validate</title> <style type="text/css"> .validationError { border: solid 2px red; } .validationValid { border: solid 2px green; } </style> </head> <body> <form id="customerForm"> <label> First Name: <input id="firstName" required /> </label> <label> Social Security Number: <input id="ssn" required pattern="^d{3}-d{2}-d{4}$" title="Expected pattern is ###-##-####" /> </label> <input type="submit" /> </form> <script type="text/javascript" src="Scripts/jquery-1.4.4.min.js"></script> <script type="text/javascript" src="Scripts/jquery.h5validate.js"></script> <script type="text/javascript"> // Enable h5Validate plugin $("#customerForm").h5Validate({ errorClass: "validationError", validClass: "validationValid" }); // Prevent form submission when errors $("#customerForm").submit(function (evt) { if ($("#customerForm").h5Validate("allValid") === false) { evt.preventDefault(); } }); </script> </body> </html> When an input field fails validation, the validationError CSS class is applied to the field and the field appears with a red border. When an input field passes validation, the validationValid CSS class is applied to the field and the field appears with a green border. From the perspective of HTML5 validation, the h5Validate plugin is the best of the plugins. It adds support for the required and pattern attributes to browsers which do not natively support these attributes such as IE9. However, this plugin does not include everything in my wish list for a perfect HTML5 validation plugin. Here’s my wish list for the perfect back compat HTML5 validation plugin: 1. The plugin would disable itself when used with a browser which natively supports HTML5 validation attributes. The plugin should not be too greedy – it should not handle validation when a browser could do the work itself. 2. The plugin should simulate the same user interface for displaying validation error messages as the user interface displayed by browsers which natively support HTML5 validation. Chrome, Firefox, and Internet Explorer all display validation errors in a popup. The perfect plugin would also display a popup. 3. Finally, the plugin would add support for the setCustomValidity() method and the other methods of the HTML5 validation constraint API. That way, you could implement custom validation in a standards compatible way and you would know that it worked across all browsers both old and new. Security It would be irresponsible of me to end this blog post without mentioning the issue of security. It is important to remember that any client-side validation — including HTML5 validation — can be bypassed. You should use client-side validation with the intention to create a better user experience. Client validation is great for providing a user with immediate feedback when the user is in the process of completing a form. However, client-side validation cannot prevent an evil hacker from submitting unexpected form data to your web server. You should always enforce your validation rules on the server. The only way to ensure that a required field has a value is to verify that the required field has a value on the server. The HTML5 required attribute does not guarantee anything. Summary The goal of this blog post was to describe the support for validation contained in the HTML5 standard. You learned how to use both the required and the pattern attributes in an HTML5 form. We also discussed how you can implement custom validation by taking advantage of the setCustomValidity() method. Finally, I discussed the available jQuery plugins for adding support for the HTM5 validation attributes to older browsers. Unfortunately, I am unaware of any jQuery plugin which provides a perfect solution to the problem of backwards compatibility.

    Read the article

  • Silverlight TV 22: Tim Heuer on Extending the SMF

    In this episode of Silverlight TV, Tim Heuer demonstrates how to use the Silverlight Media Framework (SMF) to create a nice media experience akin to what has been demonstrated through the 2010 Winter Olympics and Sunday Night Football players. He also demonstrates how to encode smooth streaming video using Expression Encoder and play the video using SMF. Tim also shows how he extended the SMF implementation and created a player to suit his specific needs (including not using DVR, among other features)....Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Looking for good Regex book

    - by Cyberherbalist
    I've been trying to get a good grounding with Regular Expressions, and am looking for a single book to do so. I've been going through Amazon.com's listings on this subject, and I've identified a few possibilities, but am unsure which would be best for a C# developer who can write very simple Regexs, but wants to learn more. On a scale of 0-9 where 0 is knowing how to spell "Regex" but nothing else, and 9 where I could write a book on the subject out of my own head, I would place myself at 2. Which of the following would be your choice: Mastering Regular Expressions by Jeffrey E F Friedl Regular Expressions Cookbook by Jan Goyvaerts and Steven Levithan Sams Teach Yourself Regular Expressions in 10 Minutes by Ben Forta Beginning Regular Expressions (Programmer to Programmer) by Andrew Watt Regular Expression Recipes for Windows Developers: A Problem-Solution Approach by Nathan A. Good Regular Expression Recipes: A Problem-Solution Approach by Nathan A. Good Now, according to Amazon, "Regular Expressions Cookbook" (REC) above is rated the highest according to user ratings, but only based on 20 reviews. The first one, "Mastering Regular Expressions" (MRE) is rated second based on 140 reviews. This alone suggests that MRE might be by far the best one. But is it best for a relative beginner? Would I perhaps be better getting "Beginning Regular Expressions" (BRE) instead, to start with? Please help me resolve my confusion!

    Read the article

  • Unable to uninstall maas completely

    - by user210844
    I'm not able to uninstall MAAS sudo apt-get purge maas ; sudo apt-get autoremove Reading package lists... Done Building dependency tree Reading state information... Done Package 'maas' is not installed, so not removed 0 upgraded, 0 newly installed, 0 to remove and 2 not upgraded. 2 not fully installed or removed. After this operation, 0 B of additional disk space will be used. Setting up maas-region-controller (1.2+bzr1373+dfsg-0ubuntu1) ... Considering dependency proxy for proxy_http: Module proxy already enabled Module proxy_http already enabled Module expires already enabled Module wsgi already enabled sed: -e expression #1, char 91: unterminated `s' command dpkg: error processing maas-region-controller (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of maas-dns: maas-dns depends on maas-region-controller (= 1.2+bzr1373+dfsg-0ubuntu1); however: Package maas-region-controller is not configured yet. dpkg: error processing maas-dns (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Errors were encountered while processing: maas-region-controller maas-dns E: Sub-process /usr/bin/dpkg returned an error code (1) Reading package lists... Done Building dependency tree Reading state information... Done 0 upgraded, 0 newly installed, 0 to remove and 2 not upgraded. 2 not fully installed or removed. After this operation, 0 B of additional disk space will be used. Setting up maas-region-controller (1.2+bzr1373+dfsg-0ubuntu1) ... Considering dependency proxy for proxy_http: Module proxy already enabled Module proxy_http already enabled Module expires already enabled Module wsgi already enabled sed: -e expression #1, char 91: unterminated `s' command dpkg: error processing maas-region-controller (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of maas-dns: maas-dns depends on maas-region-controller (= 1.2+bzr1373+dfsg-0ubuntu1); however: Package maas-region-controller is not configured yet. dpkg: error processing maas-dns (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Errors were encountered while processing: maas-region-controller maas-dns E: Sub-process /usr/bin/dpkg returned an error code (1)

    Read the article

  • Optimize SUMMARIZE with ADDCOLUMNS in Dax #ssas #tabular #dax #powerpivot

    - by Marco Russo (SQLBI)
    If you started using DAX as a query language, you might have encountered some performance issues by using SUMMARIZE. The problem is related to the calculation you put in the SUMMARIZE, by adding what are called extension columns, which compute their value within a filter context defined by the rows considered in the group that the SUMMARIZE uses to produce each row in the output. Most of the time, for simple table expressions used in the first parameter of SUMMARIZE, you can optimize performance by removing the extended columns from the SUMMARIZE and adding them by using an ADDCOLUMNS function. In practice, instead of writing SUMMARIZE( <table>, <group_by_column>, <column_name>, <expression> ) you can write: ADDCOLUMNS(     SUMMARIZE( <table>, <group by column> ),     <column_name>, CALCULATE( <expression> ) ) The performance difference might be huge (orders of magnitude) but this optimization might produce a different semantic and in these cases it should not be used. A longer discussion of this topic is included in my Best Practices Using SUMMARIZE and ADDCOLUMNS article on SQLBI, which also include several details about the DAX syntax with extended columns. For example, did you know that you can create an extended column in SUMMARIZE and ADDCOLUMNS with the same name of existing measures? It is *not* a good thing to do, and by reading the article you will discover why. Enjoy DAX!

    Read the article

  • What do you think of this generator syntax?

    - by ChaosPandion
    I've been working on an ECMAScript dialect for quite some time now and have reached a point where I am comfortable adding new language features. I would love to hear some thoughts and suggestions on the syntax. Example generator { yield 1; yield 2; yield 3; if (true) { yield break; } yield continue generator { yield 4; yield 5; yield 6; }; } Syntax GeneratorExpression:     generator  {  GeneratorBody  } GeneratorBody:     GeneratorStatementsopt GeneratorStatements:     StatementListopt GeneratorStatement GeneratorStatementsopt GeneratorStatement:     YieldStatement     YieldBreakStatement     YieldContinueStatement YieldStatement:     yield  Expression  ; YieldBreakStatement:     yield  break  ; YieldContinueStatement:     yield  continue  Expression  ; Semantics The YieldBreakStatement allows you to end iteration early. This helps avoid deeply indented code. You'll be able to write something like this: generator { yield something1(); if (condition1 && condition2) yield break; yield something2(); if (condition3 && condition4) yield break; yield something3(); } instead of: generator { yield something1(); if (!condition1 && !condition2) { yield something2(); if (!condition3 && !condition4) { yield something3(); } } } The YieldContinueStatement allows you to combine generators: function generateNumbers(start) { return generator { yield 1 + start; yield 2 + start; yield 3 + start; if (start < 100) { yield continue generateNumbers(start + 1); } }; }

    Read the article

  • MVVM Light V3 released at #MIX10

    - by Laurent Bugnion
    During my session “Understanding the MVVM pattern” at MIX10 in Vegas, I showed some components of the MVVM Light toolkit V3, which gave me the occasion to announce the release of version 3. This version has been in alpha stage for a while, and has been tested by many users. it is very stable, and ready for a release. So here we go! What’s new What’s new in MVVM Light Toolkit V3 is the topic of the next post. Cleaning up I would recommend cleaning up older versions before installing V3. I prepared a page explaining how to do that manually. Unfortunately I didn’t have time to create an automatic cleaner/installer, this is very high on my list but with the book and the conferences going on, it will take a little more time. Cleaning up is recommended because I changed the name of some DLLs to avoid some confusion (between the WPF3.5 and WPF4 version, as well as between the SL3 and SL4 versions). More details in the section titled “Compatibility”. Installation Installing MVVM Light toolkit is the manual process of unzipping a few files. The installation page has been updated to reflect the newest information. Compatibility MVVM Light toolkit V3 has components for the following environments and frameworks: Visual Studio 2008: Silverlight 3 Windows Presentation Foundation 3.5 SP1 Expression Blend 3 Silverlight 3 Windows Presentation Foundation 3.5 SP1 Visual Studio 2010 RC Silverlight 3 Silverlight 4 Windows Presentation Foundation 3.5 SP1 Windows Presentation Foundation 4 Silverlight for Windows Phone 7 series Expression Blend 4 beta Silverlight 3 Silverlight 4 Windows Presentation Foundation 3.5 SP1 Windows Presentation Foundation 4 Feedback As usual I welcome your constructive feedback. If you want the issue to be discussed in public, the best way is through the discussion page on the Codeplex site. if you wish to keep the conversation private, please check my Contact page for ways to talk to me. Video, tutorials There are a few new videos and tutorials available for the MVVM Light toolkit. The material is listed on the Get Started page, under “tutorials”.   Laurent Bugnion (GalaSoft) Subscribe | Twitter | Facebook | Flickr | LinkedIn

    Read the article

  • Google sort « Bali », un nouveau SDK pour le VP8 : le codec vidéo open-source gagne en vitesse d'encodage et en qualité

    Google sort « Bali », un nouveau SDK pour le VP8 Le codec vidéo open-source gagne en vitesse d'encodage et en qualité Mise à jour du 10/03/11 Google vient de mettre à jour son environnement de développement autour du VP8, le codec vidéo open-source derrière WebM. Selon Google, ce nouveau SDK permet d'encoder une fois et demi plus vite des vidéos qu'avec la précédente version (Aylesbury, lire ci-avant) sur les plate-formes x86. Autre nouveauté majeure de « Bali » (nom de code de cette version), l'amélioration du multithreading et de la prise en charge du multi-coeur. Ici aussi, l'objectif était d'augmenter les vitesses d'en...

    Read the article

  • HUGE EF4 Inheritance Bug

    - by djsolid
    Well maybe not for everyone but for me is definitely really important. That is why I get straight into the point. We have the following model: Which maps to the following database: We are using EF4.0 and we want to load all Burgers including BurgerDetails. So we write the following query: But it fails. The error is : “The ResultType of the specified expression is not compatible with the required type. The expression ResultType is 'Transient.reference[SampleEFDBModel.Food]' but the required type is 'Transient.reference[SampleEFDBModel.Burger]'.Parameter name: arguments[0]”   So in the new version of EF there is no way to eager load data through Navigation Properties with 1-1 relationships defined in subclasses. Here is the relevant Microsoft Connect Issue. It is described through an other example but the result is the same.  Please if you think this is important vote up on Microsoft Connect.   EF 4.0 has many improvements. I am using it since v1 in large-scale projects and this version is faster,produces cleaner sql, more reliable and can be used for complicated business scenarios. That is why I believe this issue should be solved as soon as possible. I understand that release cycles are slow but I am hoping atleast for a hotfix. I also have uploaded the example project so you can test it. Download it from here. If anyone has found any workarounds please post it in the comments section. Thanks!

    Read the article

  • HTML5 Form Validation

    - by Stephen.Walther
    The latest versions of Google Chrome (16+), Mozilla Firefox (8+), and Internet Explorer (10+) all support HTML5 client-side validation. It is time to take HTML5 validation seriously. The purpose of the blog post is to describe how you can take advantage of HTML5 client-side validation regardless of the type of application that you are building. You learn how to use the HTML5 validation attributes, how to perform custom validation using the JavaScript validation constraint API, and how to simulate HTML5 validation on older browsers by taking advantage of a jQuery plugin. Finally, we discuss the security issues related to using client-side validation. Using Client-Side Validation Attributes The HTML5 specification discusses several attributes which you can use with INPUT elements to perform client-side validation including the required, pattern, min, max, step, and maxlength attributes. For example, you use the required attribute to require a user to enter a value for an INPUT element. The following form demonstrates how you can make the firstName and lastName form fields required: <!DOCTYPE html> <html > <head> <title>Required Demo</title> </head> <body> <form> <label> First Name: <input required title="First Name is Required!" /> </label> <label> Last Name: <input required title="Last Name is Required!" /> </label> <button>Register</button> </form> </body> </html> If you attempt to submit this form without entering a value for firstName or lastName then you get the validation error message: Notice that the value of the title attribute is used to display the validation error message “First Name is Required!”. The title attribute does not work this way with the current version of Firefox. If you want to display a custom validation error message with Firefox then you need to include an x-moz-errormessage attribute like this: <input required title="First Name is Required!" x-moz-errormessage="First Name is Required!" /> The pattern attribute enables you to validate the value of an INPUT element against a regular expression. For example, the following form includes a social security number field which includes a pattern attribute: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Pattern</title> </head> <body> <form> <label> Social Security Number: <input required pattern="^\d{3}-\d{2}-\d{4}$" title="###-##-####" /> </label> <button>Register</button> </form> </body> </html> The regular expression in the form above requires the social security number to match the pattern ###-##-####: Notice that the input field includes both a pattern and a required validation attribute. If you don’t enter a value then the regular expression is never triggered. You need to include the required attribute to force a user to enter a value and cause the value to be validated against the regular expression. Custom Validation You can take advantage of the HTML5 constraint validation API to perform custom validation. You can perform any custom validation that you need. The only requirement is that you write a JavaScript function. For example, when booking a hotel room, you might want to validate that the Arrival Date is in the future instead of the past: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Constraint Validation API</title> </head> <body> <form> <label> Arrival Date: <input id="arrivalDate" type="date" required /> </label> <button>Submit Reservation</button> </form> <script type="text/javascript"> var arrivalDate = document.getElementById("arrivalDate"); arrivalDate.addEventListener("input", function() { var value = new Date(arrivalDate.value); if (value < new Date()) { arrivalDate.setCustomValidity("Arrival date must be after now!"); } else { arrivalDate.setCustomValidity(""); } }); </script> </body> </html> The form above contains an input field named arrivalDate. Entering a value into the arrivalDate field triggers the input event. The JavaScript code adds an event listener for the input event and checks whether the date entered is greater than the current date. If validation fails then the validation error message “Arrival date must be after now!” is assigned to the arrivalDate input field by calling the setCustomValidity() method of the validation constraint API. Otherwise, the validation error message is cleared by calling setCustomValidity() with an empty string. HTML5 Validation and Older Browsers But what about older browsers? For example, what about Apple Safari and versions of Microsoft Internet Explorer older than Internet Explorer 10? What the world really needs is a jQuery plugin which provides backwards compatibility for the HTML5 validation attributes. If a browser supports the HTML5 validation attributes then the plugin would do nothing. Otherwise, the plugin would add support for the attributes. Unfortunately, as far as I know, this plugin does not exist. I have not been able to find any plugin which supports both the required and pattern attributes for older browsers, but does not get in the way of these attributes in the case of newer browsers. There are several jQuery plugins which provide partial support for the HTML5 validation attributes including: · jQuery Validation — http://docs.jquery.com/Plugins/Validation · html5Form — http://www.matiasmancini.com.ar/jquery-plugin-ajax-form-validation-html5.html · h5Validate — http://ericleads.com/h5validate/ The jQuery Validation plugin – the most popular JavaScript validation library – supports the HTML5 required attribute, but it does not support the HTML5 pattern attribute. Likewise, the html5Form plugin does not support the pattern attribute. The h5Validate plugin provides the best support for the HTML5 validation attributes. The following page illustrates how this plugin supports both the required and pattern attributes: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>h5Validate</title> <style type="text/css"> .validationError { border: solid 2px red; } .validationValid { border: solid 2px green; } </style> </head> <body> <form id="customerForm"> <label> First Name: <input id="firstName" required /> </label> <label> Social Security Number: <input id="ssn" required pattern="^\d{3}-\d{2}-\d{4}$" title="Expected pattern is ###-##-####" /> </label> <input type="submit" /> </form> <script type="text/javascript" src="Scripts/jquery-1.4.4.min.js"></script> <script type="text/javascript" src="Scripts/jquery.h5validate.js"></script> <script type="text/javascript"> // Enable h5Validate plugin $("#customerForm").h5Validate({ errorClass: "validationError", validClass: "validationValid" }); // Prevent form submission when errors $("#customerForm").submit(function (evt) { if ($("#customerForm").h5Validate("allValid") === false) { evt.preventDefault(); } }); </script> </body> </html> When an input field fails validation, the validationError CSS class is applied to the field and the field appears with a red border. When an input field passes validation, the validationValid CSS class is applied to the field and the field appears with a green border. From the perspective of HTML5 validation, the h5Validate plugin is the best of the plugins. It adds support for the required and pattern attributes to browsers which do not natively support these attributes such as IE9. However, this plugin does not include everything in my wish list for a perfect HTML5 validation plugin. Here’s my wish list for the perfect back compat HTML5 validation plugin: 1. The plugin would disable itself when used with a browser which natively supports HTML5 validation attributes. The plugin should not be too greedy – it should not handle validation when a browser could do the work itself. 2. The plugin should simulate the same user interface for displaying validation error messages as the user interface displayed by browsers which natively support HTML5 validation. Chrome, Firefox, and Internet Explorer all display validation errors in a popup. The perfect plugin would also display a popup. 3. Finally, the plugin would add support for the setCustomValidity() method and the other methods of the HTML5 validation constraint API. That way, you could implement custom validation in a standards compatible way and you would know that it worked across all browsers both old and new. Security It would be irresponsible of me to end this blog post without mentioning the issue of security. It is important to remember that any client-side validation — including HTML5 validation — can be bypassed. You should use client-side validation with the intention to create a better user experience. Client validation is great for providing a user with immediate feedback when the user is in the process of completing a form. However, client-side validation cannot prevent an evil hacker from submitting unexpected form data to your web server. You should always enforce your validation rules on the server. The only way to ensure that a required field has a value is to verify that the required field has a value on the server. The HTML5 required attribute does not guarantee anything. Summary The goal of this blog post was to describe the support for validation contained in the HTML5 standard. You learned how to use both the required and the pattern attributes in an HTML5 form. We also discussed how you can implement custom validation by taking advantage of the setCustomValidity() method. Finally, I discussed the available jQuery plugins for adding support for the HTM5 validation attributes to older browsers. Unfortunately, I am unaware of any jQuery plugin which provides a perfect solution to the problem of backwards compatibility.

    Read the article

  • CodePlex Daily Summary for Saturday, May 29, 2010

    CodePlex Daily Summary for Saturday, May 29, 2010New ProjectsASP.NET MVC Time Planner: ASP.NET MVC based time planner is example solution that introduces ASP.NET MVC, MSSQL AJAX and jQuery development.Blit Scripting Engine: Blit Scripting Engine provides developers using Microsofts XNA Framework the ability to implement a scripting solution to their games and other pro...Expression Evaluator: This is an article on how to build a basic expression evaluator. It can evaluate any numerical expression combined with trigonometric functions for...Log Analyzer: This project has the aim to help developers to see live log/trace from their application applying visual styles to the grabbed text.LParse: LParse is a monadic parser combinator library, similar to Haskell’s Parsec. It allows you create parsers on C# language. All parsers are first-clas...NeatHtml: NeatHtml™ is a highly-portable open source website component that displays untrusted content securely, efficiently, and accessibly. Untrusted conte...NeatUpload: The NeatUpload ™ ASP.NET component allows developers to stream uploaded files to storage (filesystem or database) and allows users to monitor uplo...NSoup: NSoup is a .NET port of the jsoup (http://jsoup.org) HTML parser and sanitizer originally written in Java. jsoup originally written by Jonathan He...Ordering: c# farm softwarephone7: Project for Windows Phone 7RestCall: A very simple library to make a simple REST call and deserialize to an object. It uses WCF REST Starter Kit and the .net serializer in: System.Runt...SCSM CSV Connector: CSV Connector allows you to specify a data file and mapping location and a scheuled interval in minutes. At each scheduled interval Service Manage...Silverlight Adorner Control: An Adorner is a custom FrameworkElement that is bound to a FrameworkElement and displays information about that element 'above' the element without...Simple Stupid Tools: Simple Stupid ToolsSQScriptRunner: Simple Quick Script Runner allows an administrator to run T-SQL Scripts against one or more servers with common characteristics. For example, an m...ssisassembly: ssisassemblySSRS Report RoboCopy: a tools used to pass a report from a server to anotherTeam Foundation Server Explorer: A standalone Team Foundation Server explorer that can be used to view and manage source files.New Releases(SocketCoder) Full Silverlight Web Video/Voice Conferencing: SocketCoderWebConferencingSystem_Compiled: Installing The Server: 1- before you start you should allow the SocketCoderWCService.MainService.exe service to use the TCP ports from 4528 to 4532...ASP.NET MVC Time Planner: MVC Time Planner - v0.0.1.0: First public alpha of MVC Time Planner is now available. I got a lot of letters from my ASP.NET blog readers who are interested in this example sol...AvalonDock: AvalonDock 1.3.3384: Welcome to AvalonDock 1.3 This is the new version of AvalonDock targetting .NET 4 These are the main features that are included: - Target Microso...Blit Scripting Engine: Blit Scripting Engine 1.0: This marks the initial release of the Blit Scripting Engine. It provides the ability to compile scripts to an assembly, load pre-compiled assemblie...Community Forums NNTP bridge: Community Forums NNTP Bridge V12: Release of the Community Forums NNTP Bridge to access the social and anwsers MS forums with a single, open source NNTP bridge. This release has add...Community Forums NNTP bridge: Community Forums NNTP Bridge V13: Release of the Community Forums NNTP Bridge to access the social and anwsers MS forums with a single, open source NNTP bridge. This release has add...CSharp Intellisense: V2.4: bug fix: Pascal Casing, Single Selection and other selection errorsExpression Evaluator: Expression Evaluator - Visual Studio 2010: Visual Studio 2010 VersionFacebook Graph Toolkit: Preview 2: Preview 2 updates the source to be much more like the Facebook PHP-SDK. Additionally, the code has been updated to follow StyleCop framework rules....Facebook Graph Toolkit: Preview 3: Rest API now working although not fully tested. Removed JsonObject and JsonArray custom dynamic objects in favor of standard ExpandoObject and List...Free Silverlight & WPF Chart Control - Visifire: Visifire SL and WPF Charts v3.1.1 beta Released: Hi, Today we are releasing the two most awaited features i.e, Logarithmic axis and auto update of y-axis while Scrolling and Zooming. * Logar...Free Silverlight & WPF Chart Control - Visifire: Visifire SL and WPF Charts v3.5.4 beta Released: Hi, Today we are releasing the two most awaited features i.e, Logarithmic axis and auto update of y-axis while Scrolling and Zooming. Logarithmic...Fulcrum: Fulcrum 1.0: Initial release.Git Source Control Provider: V 0.3: V 0.3 Add automatic status refresh when files in solution folder changedIBCSharp: IBCSharp 1.04: What IBCSharp 1.04.zip unzips to: http://i50.tinypic.com/205qofl.png IBCSharp Change Log 1.04 - 5/28/2010 Updated IBClient.dll to IB API version...MapWindow6: MapWindow 6.0 May 28 2010: This shifts the projection library to System.Spatial.Projections instead of MWProj4. This also fixes a meter/feet conversion error.Microsoft Health Common User Interface: Release 8.2.51.000: This is version 8.2 of the Microsoft® Health Common User Interface Control Toolkit. This release includes code updates to controls as listed below....NeatHtml: NeatHtml-trunk.221: Adds support for Internet Explorer Mobile 6.NeatUpload: NeatUpload-1.3.25: Fixes the following bugs: SWFUpload.swf could not be served by a CDN because it was embedded without setting allowScriptAccess="always". NeatUpl...NSoup: NSoup 0.1: Initial port release. Corresponds to jsoup version 0.3.1.Numina Application/Security Framework: Numina.Framework Core 53265: Visit http://framework.numina.net to help get you started.Nuntio Content: Nuntio Content 4.2.0: This upgrades MagicContent instances to the latest version that is now called NuntioContent. While this release is quite stable it is still marked ...patterns & practices: Composite WPF and Silverlight: ProjectLinker Source for VS2010 - May 2010: The ProjectLinker helps keep the source for two projects in sync by automatically creating a linked file in one project as files are added in anoth...phone7: Prism for WP7: This the first version of prism for wp7SCSM CSV Connector: SCSM CSV Connector Version 0.1: Release Notes This is the first release of the SCSM CSV Connector solution. It is an 'alpha' release and has only been tested by the developers on ...Silverlight Adorner Control: 1.0: Initial releaseSilverlight Web Comic: Comic 1.1.1: Comic Beta with functionality to button newSilverlight Web Comic: Web Comic 1.1: This version has a little implementation no visible about the future versions, options to new, save, and load. The next version has a better review...Simple.NET: Simple.Mocking 1.0.0.6: Initial version of a new mocking framework for .NET Revision 1: Expect.AnyInocationOn<T>(T target) changed to Expect.AnyInocationOn(object target...Sonic.Net: Sonic.Net v1.0.1 For Unity 2.0: This Version is a port to VS2010 of the codebase with support for unity 2.0. note: currently follows the xsd schema of the previous unity Configur...Squiggle - A Free open source Lan Messenger: Squiggle 1.0.2: v1.0 Release.Team Foundation Server Explorer: Beta 1: The first public beta release of the TFS Explorer.thinktecture WSCF.blue: WSCF.blue V1 Update (1.0.8): Bug fix release with the following fix: When an XmlArrayAttribute decorated member has IsNullable=false, and the List<T> or Collection option is s...VCC: Latest build, v2.1.30528.0: Automatic drop of latest buildVisual Studio 2010 AutoScroller Extension: AutoScroller v0.4: A Visual studio 2010 auto-scroller extension. Simply hold down your middle mouse button and drag the mouse in the direction you wish to scroll, fu...WatchersNET CKEditor™ Provider for DotNetNuke: CKEditor Provider 1.10.03: !!Whats New Added CKEditor 3.3 Revision 5542 changes Options: Default Toolbar Set to Full for Administrators Browser Window: Increased Size of ...Most Popular ProjectsRawrWBFS ManagerAJAX Control ToolkitMicrosoft SQL Server Product Samples: DatabaseSilverlight ToolkitWindows Presentation Foundation (WPF)patterns & practices – Enterprise LibraryMicrosoft SQL Server Community & SamplesPHPExcelASP.NETMost Active ProjectsAStar.netpatterns & practices – Enterprise LibraryBlogEngine.NETGMap.NET - Great Maps for Windows Forms & PresentationCommunity Forums NNTP bridgeRawrSqlServerExtensionsCustomer Portal Accelerator for Microsoft Dynamics CRMPAPpatterns & practices: Windows Azure Security Guidance

    Read the article

  • TFS Build 2010: BuildNumber and DropLocation

    - by javarg
    Automatic Builds for Application Release is a current practice in every major development factory nowadays. Using Team Foundation Server Build 2010 to accomplish this offers many opportunities to improve quality of your releases. The following approach allow us to generate build drop folders including the BuildNumber and the Changeset or Label provided. Using this procedure we can quickly identify the generated binaries in the Drop Server with the corresponding Version. Branch the DefaultTemplate.xaml and renamed it with CustomDefaultTemplate.xaml Open it for edit (check out) Go to the Set Drop Location Activity and edit the DropLocation property. Write the following expression: BuildDetail.DropLocationRoot + "\" + BuildDetail.BuildDefinition.Name + "\" + If(String.IsNullOrWhiteSpace(GetVersion), BuildDetail.SourceGetVersion, GetVersion) + "_" + BuildDetail.BuildNumber Check in the branched template. Now create a build definition named TestBuildForDev using the new template. The previous expression sets the DropLocation with the following format: (ChangesetNumber|LabelName)_BuildName_BuildNumber The first part of the folder name will be the changeset number or the label name (if triggered using labels). Folder names will be generated as following: C1850_TestBuildForDev_20111117.1 (changesets start with letter C) LLabelname_TestBuildForDev_20111117.1 (labels start with letter L) Try launching a build from a Changeset and from a Label. You can specify a Label in the GetVersion parameter in the Queue new Build Wizard, going to the Parameters tab (for labels add the “L” prefix):

    Read the article

  • Ban HTML comments from your pages and views

    - by Bertrand Le Roy
    Too many people don’t realize that there are other options than <!-- --> comments to annotate HTML. These comments are harmful because they are sent to the client and thus make your page heavier than it needs to be. When doing ASP.NET, a simple drop-in replacement is server comments, which are delimited by <%-- --%> instead of <!-- -->. Those server comments are visible in your source code, but will never be rendered to the client. Here’s a simple way to sanitize a web site. From Visual Studio, hit CTRL+H to bring the search and replace dialog. Choose “Replace in Files” from the second meny on top of the dialog. Open the find options, check “use” and make sure “Regular expressions” are selected. Use “*.aspx;*.ascx;” as the file types to examine. Choose “Entire Solution” under “Look in”. Here’s the expression to search for comments: \<!--{[^-]*}--\> And here’s the replacement string: <%--\1--%> I usually use the “Find Next” and “Replace” buttons rather than the more brutal “Replace All” in order to not apply the fix blindingly. Once this is done, I do a second manual pass of finds with the same expression to make sure I didn’t miss anything.

    Read the article

  • Silverlight Cream for May 01, 2010 -- #853

    - by Dave Campbell
    In this Issue: Damian Schenkelman, Rob Eisenberg, Sergey Barskiy, Victor Gaudioso, CorrinaB, Mike Snow, and Adam Kinney. From SilverlightCream.com: Prism’s future: Trying to summarize things Damian Schenkelman collected links to the latest Prism information to provide a reference post, including discussing WP7. MVVM Study - Interlude Rob Eisenberg discusses MVVM - it's beginnings and links out to all the major players old and new. Windows Phone 7 Database Here we go... Sergey Barskiy converted his Silverlight database project to WP7, and it's available on CodePlex... cool! New Silverlight Video Tutorial: How to Save an Image in Your Silverlight Applications Victor Gaudioso has a new video tutorial up... demonstrating saving an image from Silverlight to your hard disk. He also has the source files for download. Enforce Design Guidelines With Styles And Behaviors CorrinaB has a post up discussing attaching behaviors in styles. She has a couple good examples and a sample project to download. Silverlight Tip of the Day #9 – Obtaining Your clients IP Address Mike Snow has Tip number 9 up and he's explaining how to find the client IP address even though it's not natively available from Silverlight or jscript. Expression Blend 4 for Windows Phone in 90 seconds Adam Kinney talks about the release of a new version of the Expression Blend add-in for WP7. He's got links and instructions for removing and upgrading. Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • Going to Tech*Ed 2010

    - by Nikita Polyakov
    After years of one night community and volunteering tasks; and even running cool events like ]inbetween[ weekend, I finally get to go to the actual event! And this time it’s not in Orlando – it’s in New Orleans - which is also exciting! I will be attending many Windows Phone 7 sessions. And will hover over the Windows Phone booths. I am also extremely excited about this short exchange I had on twitter with the brand new Windows Phone Partner Community account: @wppartner #WindwosPhone 7 Enterprise story is what we are all waiting to hear :) #wp7dev 7:51 PM Jun 1st via TweetDeck in reply to wppartner @NikitaP We'll definitely be covering that at @WPCDC but we'll also be talking about it at @TechEd_NA next week! about 4 hours ago via CoTweet in reply to NikitaP As you might know I also love Microsoft Expression Blend and SketchFlow. I will be hanging out at the Microsoft Expression TLC [Technical Learning Center] booths in Expo Hall during these times: Day Start Finish 7-Jun 10:30 AM 12:30 PM 7-Jun 7:30 PM 9:00 PM 8-Jun 2:45 PM 5:00 PM 9-Jun 2:45 PM 5:00 PM 10-Jun 12:15 PM 3:00 PM   Feel free to find me and chat me up. I’ll be twittering under @NikitaP, if you are in Florida dev community use #teched_fl hash tag. If you are going and you have a Windows Phone 6.5, iPhone/ipad, Android or a Vista/Win7 laptop with you, grab this: Kevin Wolf’s TechEd 2010 Schedule and Twitter Tool – One App, 5 Different Platforms in one word: Aaaaaaamazing!

    Read the article

  • Regular-Expressions.info Thoroughly Updated

    - by Jan Goyvaerts
    RegexBuddy 4 was released earlier this month. This is a major upgrade that significantly improves RegexBuddy’s ability to emulate the features and deficiencies of the latest versions of all the popular regex flavors as well as many past versions of these flavors. Along with that, the Regular-Expressions.info website has been thoroughly updated with new content. Both the tutorial and reference sections have been significantly expanded to cover all the features of the latest regular expression flavors. There are also new tutorial and reference subsections that explain the syntax used by replacement strings when searching and replacing with regular expressions. I’m also reviving this blog. In the coming weeks you can expect blog post that highlight the new topics on the Regular-Expressions.info website. Later on I’ll blog about more intricate regex-related issues that RegexBuddy 4 emulates but that the website doesn’t talk about or only mentions in passing. RegexBuddy 4.0.0 is aware of 574 different aspects (syntactic and behavioral differences) of 94 regular expression flavors. These numbers are surely to grow with future 4.x.x releases. While RegexBuddy juggles it all with ease, that’s far too much detail to cover in a tutorial or reference that any person would want to read. So the tutorial and reference cover the important features and behaviors, while the blog will serve the corner cases as tidbits. Subscribe to the Regex Guru RSS Feed if you don’t want to miss any articles.

    Read the article

  • Why binding is not a native feature in most of the languages?

    - by Gulshan
    IMHO binding a variable to another variable or an expression is a very common scenario in mathematics. In fact, in the beginning, many students think the assignment operator(=) is some kind of binding. But in most of the languages, binding is not supported as a native feature. In some languages like C#, binding is supported in some cases with some conditions fulfilled. But IMHO implementing this as a native feature was as simple as changing the following code- int a,b,sum; sum := a + b; a = 10; b = 20; a++; to this- int a,b,sum; a = 10; sum = a + b; b = 20; sum = a + b; a++; sum = a + b; Meaning placing the binding instruction as assignments after every instruction changing values of any of the variable contained in the expression at right side. After this, trimming redundant instructions (or optimization in assembly after compilation) will do. So, why it is not supported natively in most of the languages. Specially in the C-family of languages? Update: From different opinions, I think I should define this proposed "binding" more precisely- This is one way binding. Only sum is bound to a+b, not the vice versa. The scope of the binding is local. Once the binding is established, it cannot be changed. Meaning, once sum is bound to a+b, sum will always be a+b. Hope the idea is clearer now. Update 2: I just wanted this P# feature. Hope it will be there in future.

    Read the article

  • #TechEd 2010

    - by T
    It has been another fantastic year for TechEd North America.  I always love my time here.  First, I have to give a huge thank you to Ineta for giving me the opportunity to work the Ineta booth and BOF’s (birds of a feather).   I can not even begin to list how many fantastic leaders in the .Net space and Developers from all over I have met through Ineta at this event.  It has been truly amazing and great fun!! New Orlean’s has been awesome.  The night life is hoppin’.  In addition to enjoying a few (too many??) of the local hurricanes in New Orleans, I have hung out with some of the coolest people  Deepesh Mohnani, David Poll, Viresh, Alan Stephens, Shawn Wildermuth, Greg Leonardo, Doug Seven, Chris Willams, David Carley and some of our southcentral hero’s Jeffery Palermo, Todd Anglin, Shawn Weisfeld, Randy Walker, The midnight DBA’s, Zeeshan Hirani, Dennis Bottjer just to name a few. A big thanks to Microsoft and everyone that has helped to put TechEd together.  I have loved hanging out with people from the Silverlight and Expression Teams and have learned a ton.  I am ramped up and ready to take all that knowledge back to my co-workers and my community. I can not wait to see you all again next year in Atlanta!!! Here are video links to some of my fav sessions: Using MVVM Design Pattern with VS 2010 XAML Designer – Rockford Lhotka Effective RIA: Tips and Tricks for Building Effective Rich Internet Applications – Deepesh Mohani Taking Microsoft Silverlight 4 Applications Beyond the Browser – David Poll Jump into Silvelright! and become immediately effective – Tim Huckaby Prototyping Rich Microsoft Silverlight 4 Applications with MS Expression Blend + SketchFlow – David Carley Tales from the Trenches: Building a Real-World Microsoft Silvelright Line-of-Business Application – Dan Wahlin

    Read the article

  • Silverlight Center And Scale Behavior

    - by Jacek Ciereszko
    If you are interested in my last post about "How to center and scale Silverlight applications using ViewBox control", I just published behavior that you can use instead of making changes in code. How it works? 1. Download behavior (http://gallery.expression.microsoft.com/en-us/CenterAndScale ) 2. Add dll to your application <UserControl .....     xmlns:interaction="clr-namespace:System.Windows.Interactivity;assembly=System.Windows.Interactivity"            xmlns:behavior="clr-namespace:CenterAncScaleBehavior;assembly=CenterAncScaleBehavior"  .... >     <interaction:Interaction.Behaviors>         <behavior:CenterAncScaleBehavior />     </interaction:Interaction.Behaviors>     <Grid > ... </Grid> </UserControl> 3. DONE! Your application is ready!   Watch movie to see how it works (66 seconds): See examples Application without "Center And Scale Behavior":  http://bit.ly/cVinEC Application with "Center And Scale Behavior":  http://bit.ly/ba8UsI   Source code and dlls http://gallery.expression.microsoft.com/en-us/CenterAndScale   Cheers! Jacek Ciereszko

    Read the article

  • What do you think of this iterator syntax?

    - by ChaosPandion
    I've been working on an ECMAScript dialect for quite some time now and have reached a point where I am comfortable adding new language features. I would love to hear some thoughts and suggestions on the syntax. Example iterator Numbers { yield 1; yield 2; yield 3; if (true) { yield break; } yield continue iterator { yield 4; yield 5; yield 6; }; } Syntax IteratorDeclaration:     iterator  Identifier  {  IteratorBody  } IteratorExpression:     iterator  Identifieropt  {  IteratorBody  } IteratorBody:     IteratorStatementsopt IteratorStatements:     IteratorStatement IteratorStatementsopt IteratorStatement:     Statement but not one of BreakStatement ContinueStatement ReturnStatement     YieldStatement     YieldBreakStatement     YieldContinueStatement YieldStatement:     yield  Expression  ; YieldBreakStatement:     yield  break  ; YieldContinueStatement:     yield  continue  Expression  ;

    Read the article

< Previous Page | 74 75 76 77 78 79 80 81 82 83 84 85  | Next Page >