Search Results

Search found 177 results on 8 pages for 'manish garg'.

Page 8/8 | < Previous Page | 4 5 6 7 8 

• Useful software for netbook?

  - by Moayad Mardini

  I'm looking for recommendations of good software that are particularly useful for netbooks. Software that run great on small screens and low CPU/RAM requirments. I'll start off with the following : Operating Systems: Ubuntu Netbook Remix. Easy Peasy: A fork of Ubuntu Netbook Remix that was once called UBuntu EEE. It isn't just for eeePCs though. Definitely worth a look if vanilla Netbook Remix isn't cutting it. (MarkM) Damn Small Linux (Source) Windows 7: With trimming the installation or compressing the Windows directory to fit on an 8GB SSD. (Will Eddins) nLite: A utility to install a lightweight version of Windows XP without the unnecessary components (like Media Player, Internet Explorer, Outlook Express, MSN Explorer, Messenger...). Utilites: TouchFreeze: To disable the touch pad while typing (Source) InSSIDer: Not only does it make it easier to find and keep a wireless connection, but it turns a netbook into the perfect mobile tool for troubleshooting wireless networks. (phenry) AltMove: Adds more functionality to your mouse for interacting with windows. (Rob) ASUS Font Resizer Utility and other tools by ASUS, specific to ASUS Eee PC series. Internet: Run FileZilla FTP client for a small screen : You can hide a lot of FileZilla's interface parts in the View menu, even the directory trees. Go into Settings = Interface and move the message log next to the transfer queue, if you haven't hidden them both or you want to see them. Select a theme with 16x16 icons. (Source) IDEs and Text Editors: Best lightweight IDE/Text Editor: A question on Stack Overflow that has many good suggestions of IDEs and general text editors for programmers. What’s a good linux C/C++ IDE for a low-res screen?: IDEs for Linux-powered netbooks. Online tools: Dropbox: Since the Netbook has limited disk space, you would like to use Cloud Apps like Dropbox and Ubuntu One so that you don't run out of space especially if you are on a holiday. Later when you go back to your desktop with big hard disk,you can take out the files from your dropbox repo. (Manish Sinha) Google products: like Docs, Calendar and Reader (aviraldg) Web sites and software lists: Netbookfiles.com: Netbook specific software downloads. Software Apps to Maximise your Netbook Battery Power: Netbooks are known for their portability. Not only are they small and lightweight but with their increased power efficiency, batteries can last much longer than conventional laptops. This also means you no longer have to carry a power adapter with you! Several brands emphasis the longevity of the battery as a strong selling point, and for those people who travel a lot, it sure is. Free Must-Have Netbook Apps: Finding software for netbooks can present challenges due to limited hard drive space, processor power, RAM, and screen real-estate. That doesn't mean you have to do without essential programs. The apps below cover all the bases -- entertainment, productivity, security, and communication -- without compromising on performance or usability. Best of all, they're free! Useful Netbook Software: With short battery lives and small resolution screens Netbooks, unlike many other computers on the market, could so with some specific software for their use. Now, not all of those I’ve found are specifically designed for Netbooks, but all are relevant. And they’re designed for Windows XP. The question is community wiki, so feel free to edit it. Updated, thank you all for suggestions.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

< Previous Page | 4 5 6 7 8