Search Results

Search found 194 results on 8 pages for 'sahil garg'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 8/8 | < Previous Page | 4 5 6 7 8 

  • autorelease object not confirming protocol does not give any warning

    - by Sahil Wasan
    I have a class "ABC" and its method which returns non autoreleases object of that class. @interface ABC:NSObject +(ABC *)aClassMethodReturnsObjectWhichNotAutoreleased; @end @implementation ABC +(ABC *)aClassMethodReturnsObjectWhichNotAutoreleased{ ABC *a = [[ABC alloc]init]; return a; } @end If I have a protocol Foo. @Protocol Foo @required -(void)abc; @end My ABC class is "not" confirming Foo protocols. 1st call id<Foo> obj = [ABC aClassMethodReturnsObjectWhichNotAutoreleased]; //show warning It shows warning "Non Compatible pointers.." thats good.Abc did not confirm protocol Foo BUT 2nd call id<Foo> obj = [NSArray arrayWithObjects:@"abc",@"def",nil]; // It will "not" show warning as it will return autorelease object.NSArray don't confirm protocol Foo In first call compiler gives warning and in second call compiler is not giving any warning.I think that is because i am not returning autorelease object. Why is compiler not giving warning in 2nd call as NSArray is also not confirming FOO Thanks in advance

    Read the article

  • input in search box programmatically

    - by Sahil Manchanda
    I'm making a Java program where I programmatically insert data into search field of a website and make submit event programmatically . after submission a new website is opened.. i know i can read data using URLCONNECTION. Eg if website name is www.pqr.net/index.php after I make search submission I'm redirected to that page. eg. www.pqr.net/ind2.php how to get the url of page where I'm redirected because I want to read the contents of that page , unless I don't know the url of the page where I'm redirected , I can't read the contents

    Read the article

  • how to get the content of iframe in a php variable? [closed]

    - by Sahil
    My code is somewhat like this: <?php if($_REQUEST['post']) { $title=$_REQUEST['title']; $body=$_REQUEST['body']; echo $title.$body; } ?> <script type="text/javascript" src="texteditor.js"> </script> <form action="" method="post"> Title: <input type="text" name="title"/><br> <a id="bold" class="font-bold"> B </a> <a id="italic" class="italic"> I </a> Post: <iframe id="textEditor" name="body"></iframe> <input type="submit" name="post" value="Post" /> </form> the texteditor.js file code is: $(document).ready(function(){ document.getElementById('textEditor').contentWindow.document.designMode="on"; document.getElementById('textEditor').contentWindow.document.close(); $("#bold").click(function(){ if($(this).hasClass("selected")) { $(this).removeClass("selected"); }else { $(this).addClass("selected"); } boldIt(); }); $("#italic").click(function(){ if($(this).hasClass("selected")) { $(this).removeClass("selected"); }else { $(this).addClass("selected"); } ItalicIt(); }); }); function boldIt(){ var edit = document.getElementById("textEditor").contentWindow; edit.focus(); edit.document.execCommand("bold", false, ""); edit.focus(); } function ItalicIt(){ var edit = document.getElementById("textEditor").contentWindow; edit.focus(); edit.document.execCommand("italic", false, ""); edit.focus(); } function post(){ var iframe = document.getElementById("body").contentWindow; } actualy i want to fetch data from this texteditor (which is created using iframe and javascript) and store it in some other place. i'm not able to fetch the content that is entered in the editor (i.e. iframe here). please help me out of this....

    Read the article

  • SQL SERVER – Winners – Contest Win Joes 2 Pros Combo (USD 198)

    - by pinaldave
    Earlier this week we had contest ran over the blog where we are giving away USD 198 worth books of Joes 2 Pros. We had over 500+ responses during the five days of the contest. After removing duplicate and incorrect responses we had a total of 416 valid responses combined total 5 days. We got maximum correct answer on day 2 and minimum correct answer on day 5. Well, enough of the statistics. Let us go over the winners’ names. The winners have been selected randomly by one of the book editors of Joes 2 Pros. SQL Server Joes 2 Pros Learning Kit 5 Books Day 1 Winner USA: Philip Dacosta India: Sandeep Mittal Day 2 Winner USA: Michael Evans India: Satyanarayana Raju Pakalapati Day 3 Winner USA: Ratna Pulapaka India: Sandip Pani Day 4 Winner USA: Ramlal Raghavan India: Dattatrey Sindol Day 5 Winner USA: David Hall India: Mohit Garg I congratulate all the winners for their participation. All of you will receive emails from us. You will have to reply the email with your physical address. Once you receive an email please reply within 3 days so we can ship the 5 book kits to you immediately. Bonus Winners Additionally, I had announced that every day I will select a winner from the readers who have left comments with their favorite blog post. Here are the winners with their favorite blog post. Day 1: Prasanna kumar.D [Favorite Post] Day 2: Ganesh narim [Favorite Post] Day 3: Sreelekha [Favorite Post] Day 4: P.Anish Shenoy [Favorite Post] Day 5: Rikhil [Favorite Post] All the bonus winners will receive my print book SQL Wait Stats if your shipping address is in India or Pluralsight Subscription if you are outside India. If you are not winner of the contest but still want to learn SQL Server you can get the book from here. Amazon | 1 | 2 | 3 | 4 | 5 | Flipkart | Indiaplaza Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Joes 2 Pros, PostADay, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • OBJC_CLASS_$_MTSCRA", referenced from

    - by user1078841
    I was trying to make a sample code run download by the link http://www.magtek.com/support/software/downloads/sw/99510108.zip This is a card reader api ,here is a sample code.When I run this code I got the error: ld: warning: ignoring file /Users/gaurav.garg/Downloads/99510108/SampleCode/Lib/libMTSCRA.a, missing required architecture i386 in file Undefined symbols for architecture i386: "_OBJC_CLASS_$_MTSCRA", referenced from: objc-class-ref in MagTekDemoAppDelegate.o ld: symbol(s) not found for architecture i386 clang: error: linker command failed with exit code 1 (use -v to see invocation) The class MTSCRA is only a header file,And the solution that I have cheked That we have to add the .m file in compiled source path of build build phase of target...but unfortunately I don't have the MTSCRA.m file.MTscra.h have the AudioToolBox and externalAccesory framework.

    Read the article

  • Travelling MVP #4: DevReach 2012

    - by DigiMortal
    Our next stop after Varna was Sofia where DevReach happens. DevReach is one of my favorite conferences in Europe because of sensible prices and strong speakers line-up. Also they have VIP-party after conference and this is good event to meet people you don’t see every day, have some discussion with speakers and find new friends. Our trip from Varna to Sofia took about 6.5 hours on bus. As I was tired from last evening it wasn’t problem for me as I slept half the trip. After smoking pause in Velike Tarnovo I watched movies from bus TV. We had supper later in city center Happy’s – place with good meat dishes and nice service. And next day it begun…. :) DevReach 2012 DevReach is held usually in Arena Mladost. It’s near airport and Telerik office. The event is organized by local MVP Martin Kulov together with Telerik. Two days of sessions with strong speakers is good reason enough for me to go to visit some event. Some topics covered by sessions: Windows 8 development web development SharePoint Windows Azure Windows Phone architecture Visual Studio Practically everybody can find some interesting session in every time slot. As the Arena is not huge it is very easy to go from one sessions to another if selected session for time slot is not what you expected. On the second floor of Arena there are many places where you can eat. There are simple chunk-food places like Burger King and also some restaurants. If you are hungry you will find something for your taste for sure. Also you can buy beer if it is too hot outside :) Weather was very good for October – practically Estonian summer – 25C and over. Sessions I visited Here is the list of sessions I visited at DevReach 2012: DevReach 2012 Opening & Welcome Messsage with Martin Kulov and Stephen Forte Principled N-Tier Solution Design with Steve Smith Data Patterns for the Cloud with Brian Randell .NET Garbage Collection Performance Tips with Sasha Goldshtein Building Secured, Scalable, Low-latency Web Applications with the Windows Azure Platform with Ido Flatow It’s a Knockout! MVVM Style Web Applications with Charles Nurse Web Application Architecture – Lessons Learned from Adobe Brackets with Brian Rinaldi Demystifying Visual Studio 2012 Performance Tools with Martin Kulov SPvNext – A Look At All the Exciting And New Features In SharePoint with Sahil Malik Portable Libraries – Why You Should Care with Lino Tadros I missed some sessions because of some death march projects that are going and that I have to coordinate but it was not big loss as I had time to walk around in session venue neighborhood and see Sofia Business Park. Next year again! I will be there again next year and hopefully more guys from Estonia will join me. I think it’s good idea to take short vacation for DevReach time and do things like we did this time – Bucharest, Varna, Sofia. It’s only good idea to plan some more free time so we are not very much in hurry and also we have no work stuff to do on the trip. This far this trip has been one of best trips I have organized and I will go and meet all those guys in this region again! :)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Building the Ultimate SharePoint 2010 Development Environment

    - by Manesh Karunakaran
    It’s been more than a month since SharePoint 2010 RTMed. And a lot of people have downloaded and set up their very own SharePoint 2010 development rigs. And quite a few people have written blogs about setting up good development environments, there is even an MSDN article on it. Two of the blogs worth noting are from MVPs Sahil Malik and Wictor Wilén. Make sure that you check these out as well. Part of the bad side-effects of being a geek is the need to do the technical stuff the best way possible (pragmatic or otherwise), but the problem with this is that what is considered “best” is relative. Precisely the reason why you are reading this post now. Most of the posts that I read are out dated/need updations or are using the wrong OS’es or virtualization solutions (again, opinions vary) or using them the wrong way. Here’s a developer’s view of Building the Ultimate SharePoint 2010 Development Rig. If you are a sales guy, it’s time to close this window. Confusion 1: Which Host Operating System and Virtualization Solution to use? This point has been beaten to death in numerous blog posts in the past, if you have time to invest, read this excellent post by our very own SharePoint Joel on this subject. But if you are planning to build the Ultimate Development Rig, then Windows Server 2008 R2 with Hyper-V is the option that you should be looking at. I have been using this as my primary OS for about 6-7 months now, and I haven’t had any Driver issue or Application compatibility issue. In my experience all the Windows 7 drivers work fine with WIN2008 R2 also. You can enable Aero for eye candy (and the Windows 7 look and feel) and except for a few things like the Hibernation support (which a can be enabled if you really want it), Windows Server 2008 R2, is the best Workstation OS that I have used till date. But frankly the answer to this question of which OS to use depends primarily on one question - Are you willing to change your primary OS? If the answer to that is ‘Yes’, then Windows 2008 R2 with Hyper-V is the best option, if not look at vmWare or VirtualBox, both are equally good. Those who are familiar with a Virtual PC background might prefer Sun VirtualBox. Besides, these provide support for running 64 bit guest machines on 32 bit hosts if the underlying hardware is truly 64 bit. See my earlier post on this. Since we are going to make the ultimate rig, we will use Windows Server 2008 R2 with Hyper-V, for reasons mentioned above. Confusion 2: Should I use a multi-(virtual) server set up? A lot of people use multiple servers for their development environments - like Wictor Wilén is suggesting - one server hosting the Active directory, one hosting SharePoint Server and another one for SQL Server. True, this mimics the production environment the best possible way, but as somebody who has fallen for this set up earlier, I can tell you that you don’t really get anything by doing this. Microsoft has done well to ensure that if you can do it on one machine, you can do it in a farm environment as well. Besides, when you run multiple Server class machine instances in parallel, there are a lot of unwanted processor cycles wasted for no good use. In my personal experience, as somebody who needs to switch between MOSS 2007/SharePoint 2010 environments from time to time, the best possible solution is to Make the host Windows Server 2008 R2 machine your Domain Controller (AD Server) Make all your Virtual Guest OS’es join this domain. Have each Individual Guest OS Image have it’s own local SQL Server instance. The advantages are that you can reuse the users and groups in each of the Guest operating systems, you can manage the users in one place, AD is light weight and doesn't take too much resources on your host machine and also having separate SQL instances for each of the Development images gives you maximum flexibility in terms of configuration, for example your SharePoint rigs can have simpler DB configurations, compared to your MS BI blast pits. Confusion 3: Which Operating System should I use to run SharePoint 2010 Now that’s a no brainer. Use Windows 2008 R2 as your Guest OS. When you are building the ultimate rig, why compromise? If you are planning to run Windows Server 2008 as your Guest OS, there are a few patches that you need to install at different times during the installation, for that follow the steps mentioned here Okay now that we have made our choices, let’s get to the interesting part of building the rig, Step 1: Prepare the host machine – Install Windows Server 2008 R2 Install Windows Server 2008 R2 on your best Desktop/Laptop. If you have read this far, I am quite sure that you are somebody who can install an OS on your own, so go ahead and do that. Make sure that you run the compatibility wizard before you go ahead and nuke your current OS. There are plenty of blogs telling you how to make a good Windows 2008 R2 Workstation that feels and behaves like a Windows 7 machine, follow one and once you are done, head to Step 2. Step 2: Configure the host machine as a Domain Controller Before we begin this, let me tell you, this step is completely optional, you don’t really need to do this, you can simply use the local users on the Guest machines instead, but if this is a much cleaner approach to manage users and groups if you run multiple guest operating systems.  This post neatly explains how to configure your Windows Server 2008 R2 host machine as a Domain Controller. Follow those simple steps and you are good to go. If you are not able to get it to work, try this. Step 3: Prepare the guest machine – Install Windows Server 2008 R2 Open Hyper-V Manager Choose to Create a new Guest Operating system Allocate at least 2 GB of Memory to the Guest OS Choose the Windows 2008 R2 Installation Media Start the Virtual Machine to commence installation. Once the Installation is done, Activate the OS. Step 4: Make the Guest operating systems Join the Domain This step is quite simple, just follow these steps below, Fire up Hyper-V Manager, open your Guest OS Click on Start, and Right click on ‘Computer’ and choose ‘Properties’ On the window that pops-up, click on ‘Change Settings’ On the ‘System Properties’ Window that comes up, Click on the ‘Change’ button Now a window named ‘Computer Name/Domain Changes’ opens up, In the text box titled Domain, type in the Domain name from Step 2. Click Ok and windows will show you the welcome to domain message and ask you to restart the machine, click OK to restart. If the addition to domain fails, that means that you have not set up networking in Hyper-V for the Guest OS to communicate with the Host. To enable it, follow the steps I had mentioned in this post earlier. Step 5: Install SQL Server 2008 R2 on the Guest Machine SQL Server 2008 R2 gets installed with out hassle on Windows Server 2008 R2. SQL Server 2008 needs SP2 to work properly on WIN2008 R2. Also SQL Server 2008 R2 allows you to directly add PowerPivot support to SharePoint. Choose to install in SharePoint Integrated Mode in Reporting Server Configuration. Step 6: Install KB971831 and SharePoint 2010 Pre-requisites Now install the WCF Hotfix for Microsoft Windows (KB971831) from this location, and SharePoint 2010 Pre-requisites from the SP2010 Installation media. Step 7: Install and Configure SharePoint 2010 Install SharePoint 2010 from the installation media, after the installation is complete, you are prompted to start the SharePoint Products and Technologies Configuration Wizard. If you are using a local instance of Microsoft SQL Server 2008, install the Microsoft SQL Server 2008 KB 970315 x64 before starting the wizard. If your development environment uses a remote instance of Microsoft SQL Server 2008 or if it has a pre-existing installation of Microsoft SQL Server 2008 on which KB 970315 x64 has already been applied, this step is not necessary. With the wizard open, do the following: Install SQL Server 2008 KB 970315 x64. After the Microsoft SQL Server 2008 KB 970315 x64 installation is finished, complete the wizard. Alternatively, you can choose not to run the wizard by clearing the SharePoint Products and Technologies Configuration Wizard check box and closing the completed installation dialog box. Install SQL Server 2008 KB 970315 x64, and then manually start the SharePoint Products and Technologies Configuration Wizard by opening a Command Prompt window and executing the following command: C:\Program Files\Common Files\Microsoft Shared Debug\Web Server Extensions\14\BIN\psconfigui.exe The SharePoint Products and Technologies Configuration Wizard may fail if you are using a computer that is joined to a domain but that is not connected to a domain controller. Step 8: Install Visual Studio 2010 and SharePoint 2010 SDK Install Visual Studio 2010 Download and Install the Microsoft SharePoint 2010 SDK Step 9: Install PowerPivot for SharePoint and Configure Reporting Services Pop-In the SQLServer 2008 R2 installation media once again and install PowerPivot for SharePoint. This will get added as another instance named POWERPIVOT. Configure Reporting Services by following the steps mentioned here, if you need to get down to the details on how the integration between SharePoint 2010 and SQL Server 2008 R2 works, see Working Together: SQL Server 2008 R2 Reporting Services Integration in SharePoint 2010 an excellent article by Alan Le Marquand Step 10: Download and Install Sample Databases for Microsoft SQL Server 2008R2 SharePoint 2010 comes with a lot of cool stuff like PerformancePoint Services and BCS, if you need to try these out, you need to have data in your databases. So if you want to save yourself the trouble of creating sample data for your PerformancePoint and BCS experiments, download and install Sample Databases for Microsoft SQL Server 2008R2 from CodePlex. And you are done! Fire up your Visual Studio 2010 and Start Coding away!!

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 4 5 6 7 8