Search Results

Search found 15070 results on 603 pages for 'language conversion'.

Page 80/603 | < Previous Page | 76 77 78 79 80 81 82 83 84 85 86 87  | Next Page >

  • Is there a good, free way to fix broken/corrupt .wmv files?

    - by chbtn
    I've recovered some files from an hdd that weren't supposed to be deleted in the first place, but they have seeking problems/crash the players. Since they have the right size, I'm thinking it might be a problem of corrupt index/header, so I'm trying to find a way to fix them. It's easy to find examples on how to fix corrupt .avi files with mencoder, but .wmv seems trickier. Also, I realize there might not be a way to fix these files, but I figure I might as well as try. As far as players go, I've tried opening it with vlc/mplayer/windows media player. I can use anything on Windows XP/7 and Ubuntu, as long as it's free. Since the files are 200mb+ and there are quite a few, I don't think trial software would work.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Importer or converter for ClarisWorks cwk format?

    - by Justin Dearing
    I have several ClarisWorks documents (*.CWK) that I'd like to import into a more modern format like Microsoft Word or Open Office. It seems Star Office can apparently open cwk files, but the product is discontinued and cannot be downloaded any more. There has been a feature request to add a cwk importer to OpenOffice since 2002, so I doubt that OpenOffice will support cwk files any time soon. Are there any utilities that can open a cwk file besides ClarisWorks itself?

    Read the article

  • PDF - re/generate image using stream content

    - by tom_tap
    I have pdf file with 8 content streams (bytes) which behave like image layers (but they are not layers that I can turn off/on in Adobe Reader). I would like to extract these images separately, because they overlap each other (thus I am not able to "Take a Snapshot" or "Copy File to Clipboard"). So now I have these streams in below format: <Start Stream> q 599.7601 0 0 71.99921 5951.03423 4282.48177 cm /Im0 Do Q q 599.7601 0 0 71.99921 5951.03432 4210.48177 cm /Im1 Do Q q 599.7601 0 0 71.99921 5951.03441 4138.48177 cm /Im2 Do [...] My question is: how to use these data to generate or regenerate these images to be able to save it as raster or vector file? I have already tried pstoedit, but it doesn't work properly beacuse of these multi streams. Same with PDFedit.

    Read the article

  • Convert file from VOC to MP3

    - by Thomas
    I would like to convert a sound file (from a digital voice recorder) with the extension .voc to an .mp3 file or some other common sound files. I am on Windows 7 64 bit. I have tried the program voc2wav but it gives me an error message saying that the program isn't 64 bit. The program has to be free and able to run without installing. (The voice recorder did come with a program that I could install, but I would like to avoid that).

    Read the article

  • Flatten Word document

    - by user126389
    I have a document with some precise formatting, created in Word. This doc was converted to PDF for distribution. Now the original is lost, and reconverting to Word using a PDF to word add-on from Microsoft results in many text boxes in the new DOC file. How can I 'flatten' this to remove the text boxes and retain most of the formatting in order to update the contents? Recreating the original formatting would take a long time.

    Read the article

  • How to run a command from anywhere in Mac OS X

    - by pabloruiz55
    I need to use a command for converting my images to pvrtc. It is located in /Developer/Platforms/iPhoneOS.platform/Developer/usr/bin/texturetool. Right now I have to be inside that folder to be able to use the command. How can I set it up so I can run this command from anywhere? Thanks

    Read the article

  • ffmpeg - creating DNxHD MFX files with alphas

    - by Hugh
    I'm struggling with something in FFMpeg at the moment... I'm trying to make DNxHD 1080p/24, 36Mb/s MXF files from a sequence of PNG files. My current command-line is: ffmpeg -y -f image2 -i /tmp/temp.%04d.png -s 1920x1080 -r 24 -vcodec dnxhd -f mxf -pix_fmt rgb32 -b 36Mb /tmp/temp.mxf To which ffmpeg gives me the output: Input #0, image2, from '/tmp/temp.%04d.png': Duration: 00:00:01.60, start: 0.000000, bitrate: N/A Stream #0.0: Video: png, rgb32, 1920x1080, 25 tbr, 25 tbn, 25 tbc Output #0, mxf, to '/tmp/temp.mxf': Stream #0.0: Video: dnxhd, yuv422p, 1920x1080, q=2-31, 36000 kb/s, 90k tbn, 24 tbc Stream mapping: Stream #0.0 -> #0.0 [mxf @ 0x1005800]unsupported video frame rate Could not write header for output file #0 (incorrect codec parameters ?) There are a few things in here that concern me: The output stream is insisting on being yuv422p, which doesn't support alpha. 24fps is an unsupported video frame rate? I've tried 23.976 too, and get the same thing. I then tried the same thing, but writing to a quicktime (still DNxHD, though) with: ffmpeg -y -f image2 -i /tmp/temp.%04d.png -s 1920x1080 -r 24 -vcodec dnxhd -f mov -pix_fmt rgb32 -b 36Mb /tmp/temp.mov This gives me the output: Input #0, image2, from '/tmp/1274263259.28098.%04d.png': Duration: 00:00:01.60, start: 0.000000, bitrate: N/A Stream #0.0: Video: png, rgb32, 1920x1080, 25 tbr, 25 tbn, 25 tbc Output #0, mov, to '/tmp/1274263259.28098.mov': Stream #0.0: Video: dnxhd, yuv422p, 1920x1080, q=2-31, 36000 kb/s, 90k tbn, 24 tbc Stream mapping: Stream #0.0 -> #0.0 Press [q] to stop encoding frame= 39 fps= 9 q=1.0 Lsize= 7177kB time=1.62 bitrate=36180.8kbits/s video:7176kB audio:0kB global headers:0kB muxing overhead 0.013636% Which obviously works, to a certain extent, but still has the issue of being yuv422p, and therefore losing the alpha. If I'm going to QuickTime, then I can get what I need using Shake, but my main aim here is to be able to generate .mxf files. Any thoughts? Thanks

    Read the article

  • How to convert a power point pdf to a pdf that is easy to read on kindle?

    - by SpaceTrucker
    I have several power point presentations as pdfs. I would like to read them on the original kindle in landscape format. When I read the original on the kindle then a single slide won't fit on the kindles display. I thought the easiest way to convert the pdf was to repring it with a pdf printer. However I don't know the paper size to use. I already tried using Calibre as suggested by this question. However the output is not usable because of formatting issues. So what paper size should I use for the pdf printer to reprint them in landscape format or are there any other tools I could use for that task?

    Read the article

  • Convert video from .mp4 to .ogg

    - by Unknown
    I am using ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers . I need to convert a file .mp4, to .ogg format. I am on Mac OS X, and I have tried this so far: ffmpeg -i sample_mpeg4.mp4 -acodec vorbis -vcodec libtheora -f ogg output.ogv I am getting: Unknown encoder 'libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec --enable-libtheora output.ogv I am getting: Unknown encoder '--enable-libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec libtheora -f ogv output.ogv I am getting: [NULL @ 0x7f81bb00f800] Requested output format 'ogv' is not a suitable output format output.ogv: Invalid argument ffmpegtheora is not an option as it can not be install on the server.

    Read the article

  • How to convert a 1 page PDF to a 2 page per sheet PDF?

    - by mokasin
    I would like to print a PDF so that on the front of the first page are the first two pages, on the back the 3rd and 4th and so on. ----------------- ----------------- | | | | | | | | | | | | | 1 | 2 | | 3 | 4 | . . . | | | | | | |_______|_______| |_______|_______| page 1 - front page 1 - front Because my printer using Linux fails to support manual duplex printing I'd thought, maybe I could edit the pdf in a according way. But how?

    Read the article

  • How to train users converting from PC to Mac/Apple at a small non profit?

    - by Everette Mills
    Background: I am part of a team that provides volunteer tech support to a local non profit. We are in the position to obtain a grant to update almost all of our computers (many of them 5 to 7 year old machines running XP), provide laptops for users that need them, etc. We are considering switching our users from PC (WinXP) to Macs. The technical aspects of switching will not be an issue for the team. We are in the process of planning data conversions, machine setup, server changes, etc regardless of whether we switch to Macs or much newer PCs. About 1/4 of the staff uses or has access to a Mac at home, these users already understand the basics of using the equipment. We have another set of (generally younger) users that are technically savvy and while slightly inconvenienced and slowed for a few days should be able to switch over quickly. Finally, several members of the staff are older and have many issues using there computers today. We think in the long run switching to Macs may provide a better user experience, fewer IT headaches, and more effective use of computers. The questions we have is what resources and training (webpages, Books, online training materials or online courses) do you recommend that we provide to users to enable the switchover to happen smoothly. Especially, with a focus on providing different levels of training and support to users with different skill levels. If you have done this in your own organization, what steps were successful, what areas were less successful?

    Read the article

  • How can I reorder parts of a video file

    - by sandeep
    I have download a mkv movie file which gave me 3 files suffixed .001, .002, and .003. When i join them together with different tools like winrar, 7zip, hjsplit, concatenated file shows only last 40 min/1.22 hrs of the total length of the movie. If I play all the (.001, .002, .003) parts with vlc player, I can see that .003 is the first part of the video and .001 is the last part. Can anyone tell me how can join this parts of movie with correct position or how I can convert .003 file into .001 file.

    Read the article

  • Connecting Samsung Note 3 to Hitachi CPX3030WN via Samsung MHL 2.0 HD kit , Will there be video output? [on hold]

    - by Monolord's Knight
    I need the video output to projector. but nobody can assure me this may work or not. some says yes some says no.But they have no real experience. Some says an special android app is required for this. Depending on this answer, I will purchase Samsung MHL 2.0 cable . If it wont work it will be no use for me. I don't have a way to change my phone or projector. Just want to know will it work or not. Thanks

    Read the article

  • how can i edit my admission form which i filled wrong . their is no other form is avilable now ...what i do ??? [closed]

    - by user60065
    Hi, I am a 2nd year student in graduation. Recently I filled an admission form for final year admission but it came back to me after 2 days because I had entered wrong information. I want to edit the wrong information and I have scanned the form. I am looking for a good online site where I can upload the scanned document and convert same into an editable format. I don’t mind paying. If any can point to a good site will be great & thanks in advance

    Read the article

  • Why does Windows 7 always automatically change the input or keyboard language?

    - by B-Ball
    I am wondering why Windows 7 always automatically changes my input or keyboard language. I've a notebook with an integrated QWERTY keyboard English (United States). Traveling, I use that one but, additionally, I've my own as well as a much better keyboard at home which is a QWERTZ keyboard German (Germany). Thus, being at home, I'd like to use my QWERTZ keyboard. Unfortunately, Windows 7 does not play along at this one. Every time, I start up my notebook, it is usually set to English (United States) but that's not the problem. In case, I'd use my notebook QWERTY keyboard English (United States), that's fine. However, if I start up my notebook and I'd like to use my QWERTZ keyboard German (Germany), I usually press ALT + Left Shift in order to switch from English (United States) to German (Germany) and Windows 7 switches the input language but only for the program that is currently open. If my input language is set to German (Germany) and I, e.g., open NotePad, Windows 7 automatically switches my input language to English (United States). This is very annoying since I've to change the input or keyboard language to German (Germany) every time I open up a new program. Why doesn't Windows 7 stay with one input language if I changed it manually by pressing ALT + Left Shift? Why doesn't the manual change of the input or keyboard language apply for the whole Windows 7? Why does it only affect the currently opened program? Since I've two keyboards with two different layouts, I seriously need to have both of the keyboards languages installed. I tried both of the below settings in order to find a solution for my problem. Currently, I am using the first option, two input languages. First option: two input languages: Second option: two keyboard languages:

    Read the article

  • c language: printf help

    - by dydx
    Hi again, here is my coding which gives me the error 'warning: unknown conversion type character 0x20 in format' int subtotal; long long a,b,c,d,e,f,g,h,i,j,k,l,m; subtotal = (1*(a+c+e+g+i+k))+(3*(b+d+f+h+j+l)); printf(" = %d % 10 = %d; (10 - %d) % 10 = %lld\n", subtotal,subtotal%10,subtotal%10,m); any idea why this is wrong?

    Read the article

  • Best language on Linux to replace manual tasks that use SSH/Telnet? [on hold]

    - by Calab
    I've been tasked to create and maintain a web browser based interface to replace several of the manual tasks that we perform now. I currently have a "shakey" but working program written in Perl (2779 lines) that uses basic Expect coding, but it has some limitations that require a great deal of coding to get around. Because of this I am going to do a complete rewrite and want to do it "right" this time. My question is this... What would be the best language to use to create a web based interface to perform SSH/Telnet tasks that we would normally do manually? Keep in mind the following requirements: Runs on a CentOS Linux system v5.10 Http will be served by Apache2 This is an INTRANET site and only accessible within our organization. User load will be light. No more that 5 users accessing it at one time. perl 5.8.8, php 5.3.3, python 2.7.2 are available... Not sure what other languages to check for, or what modules might be installed in each language. The web interface will need to provide progress indicators and text output produced by the remote connection, in real time as it is generated. If we are running our process on multiple hosts, they should be in individual threads so that they can run side by side, not sequentially. I want the ability to "trap" on specific text generated by the remote host and display an alert to the user - such as when the remote host generates an error message. I would like to avoid as much client side scripting (javascript/vbscript) as I can. Most users will be on Windows PC's using Chrome or IE as a browser. Users will be downloading the resulting output so they can process it as they see fit. I currently have no experience with "Ajax" or the like. Most of my coding experience is old 6809 assembly, Visual Basic 6, and whatever I can cut/paste from online examples in various languages (hence my "shaky" Perl program) My coding environment is Eclipse for remote code editing, but I prefer stuff like UltraEdit if I can get a decent syntax file for the language I'm using. I do have su access on the server, but I'm not the only one using this server so I can't just upgrade/install blindly as I might impact other software currently running on the machine. One reason that I'm asking here, instead of searching (which I did) is that most replies were, "use language 'xyz', but you need to use an external SSH connection" - like I'm using Expect in my Perl script. Most also did not agree on what language that 'xyz' should be. ...so, after this long posting, can someone offer some advice?

    Read the article

  • Python for a hobbyist programmer ( a few questions)

    - by Matt
    I'm a hobbyist programmer (only in TI-Basic before now), and after much, much, much debating with myself, I've decided to learn Python. I don't have a ton of free time to teach myself a hundred languages and all programming I do will be for personal use or for distributing to people who need them, so I decided that I needed one good, strong language to be good at. My questions: Is python powerful enough to handle most things that a typical programmer might do in his off-time? I have in mind things like complex stat generators based on user input for tabletop games, making small games, automate install processes, and build interactive websites, but probably a hundred things along those lines Does python handle networking tasks fairly well? Can python source be obscufated (mispelled I think), or is it going to be open-source by nature? The reason I ask this is because if I make something cool and distribute it, I don't want some idiot script kiddie to edit his own name in and say he wrote it And how popular is python, compared to other languages. Ideally, my language would be good and useful with help found online without extreme difficulty, but not so common that every idiot with computer knows python. I like the idea of knowing a slightly obscure language. Thanks a ton for any help you can provide.

    Read the article

  • Why is VB6 still so widely used?

    - by Uri
    Note that this question is not meant to start an argument, I am genuinely curious: Back in the 90s I used to work for a large CPU maker and we were building some debuggers. All our core logic was in C++, but the GUI was made in VB6. We couldn't figure out MFC and it was too much a hassle. We glued together VB6 and C++ using COM which we created via ATL. Fast forward to 2009, having been mostly in the Java world I am looking at job boards and seeing more VB6 jobs than I expected. I genuinely thought that VB6 was extinct, especially since VB.NET supposedly solved a lot of the problems with the VB6 which at the time felt a lot like a scripting language than a true OOP language. So what happened? Why is new code still written in it? Isn't there a better way to glue C++ and VB.NET? Note that I haven't used VB.NET, I just understand that it is a much more "stricter" language than VB6 was. Even with Option Explicit or whatever it was.

    Read the article

  • How large a role does subjectiveness play in programming?

    - by Bob
    I often read about the importance of readability and maintainability. Or, I read very strong opinions about which syntax features are bad or good. Or discussions about the values of certain paradigms, like OOP. Aside from that, this same question floats about in my mind whenever I read debates on SO or Meta about subjective questions. Or read questions about best practices and sometimes find myself or others disagreeing. What role does subjectiveness play within the programming realm? Sometimes I think it plays a large role. Software developers are engineers in a way, but also people. A large part of programming is dealing with code that's human readable. This is very different from Math or Physics or other disciplines with very exact and structured rules. Here the exact structure and rules are largely up in the air, changeable on a whim, and hence the amount of languages in existence. And one person may find one language very readable, and another person may find their own language the most comforting. The same with practices. One person may not like certain accepted practices. I myself find splitting classes into different files very unreadable, for instance. But, I can't say rules haven't helped in general. Certain practices have and do make life easier. And new languages have given rise to syntax and structure that make life easier. There's certainly been a progression towards code that is easier to read and maintain even given a largely diverse group of people. So maybe these things aren't as subjective as I thought. It reminds me, in a way, of UI design. Certainly it's subjective, but then there's an entire discipline involved in crafting good UI and it tends to work. Is there something non-subjective about the ideas behind maintainability, readability, and other best practices? Is there something tangible to grasp when one develops a new language or thinks of new practices?

    Read the article

< Previous Page | 76 77 78 79 80 81 82 83 84 85 86 87  | Next Page >