Search Results

Search found 10028 results on 402 pages for 'berkeley db'.

Page 83/402 | < Previous Page | 79 80 81 82 83 84 85 86 87 88 89 90  | Next Page >

  • passing multiple queries to view with codeigniter

    - by LvS
    I am trying to build a forum with Codeigniter. So far i have the forums themselves displayed and the threads displayed, based on the creating dynamic news tutorial. But that is 2 different pages, i need to obviously display them into one page, like this: Forum 1 - thread 1 - thread 2 - thread 3 Forum 2 - thread 1 - thread 2 etc. And then the next step is obviously to display all the posts in a thread. Most likely with some pagination going on. But that is for later. For now i have the forum controller (slimmed version): <?php class Forum extends CI_Controller { public function __construct() { parent::__construct(); $this->load->model('forum_model'); $this->lang->load('forum'); $this->lang->load('dutch'); } public function index() { $data['forums'] = $this->forum_model->get_forums(); $data['title'] = $this->lang->line('title'); $data['view'] = $this->lang->line('view'); $this->load->view('templates/header', $data); $this->load->view('forum/index', $data); $this->load->view('templates/footer'); } public function view($slug) { $data['forum_item'] = $this->forum_model->get_forums($slug); if (empty($data['forum_item'])) { show_404(); } $data['title'] = $data['forum_item']['title']; $this->load->view('templates/header', $data); $this->load->view('forum/view', $data); $this->load->view('templates/footer'); } } ?> And the forum_model (also slimmed down) <?php class Forum_model extends CI_Model { public function __construct() { $this->load->database(); } public function get_forums($slug = FALSE) { if ($slug === FALSE) { $query= $this->db->get('forum'); return $query->result_array(); } $query = $this->db->get_where('forum', array('slug' => $slug)); return $query->row_array(); } public function get_threads($forumid, $limit, $offset) { $query = $this->db->get_where('thread', array('forumid', $forumid), $limit, $offset); return $query->result_array(); } } ?> And the view file <?php foreach ($forums as $forum_item): ?> <h2><?=$forum_item['title']?></h2> <div id="main"> <?=$forum_item['description']?> </div> <p><a href="forum/<?php echo $forum_item['slug'] ?>"><?=$view?></a></p> <?php endforeach ?> Now that last one, i would like to have something like this: <?php foreach ($forums as $forum_item): ?> <h2><?=$forum_item['title']?></h2> <div id="main"> <?=$forum_item['description']?> </div> <?php foreach ($threads as $thread_item): ?> <h2><?php echo $thread_item['title'] ?></h2> <p><a href="thread/<?php echo $thread_item['slug'] ?>"><?=$view?></a></p> <?php endforeach ?> <?php endforeach ?> But the question is, how do i get the model to return like a double query to the view, so that it contains both the forums and the threads within each forum. I tried to make a foreach loop in the get_forum function, but when i do this: public function get_forums($slug = FALSE) { if ($slug === FALSE) { $query= $this->db->get('forum'); foreach ($query->row_array() as $forum_item) { $thread_query=$this->get_threads($forum_item->forumid, 50, 0); } return $query->result_array(); } $query = $this->db->get_where('forum', array('slug' => $slug)); return $query->row_array(); } i get the error A PHP Error was encountered Severity: Notice Message: Trying to get property of non-object Filename: models/forum_model.php Line Number: 16 I hope anyone has some good tips, thanks! Lenny *EDIT*** Thanks for the feedback. I have been puzzling and this seems to work now :) $query= $this->db->get('forum'); foreach ($query->result() as $forum_item) { $forum[$forum_item->forumid]['title']=$forum_item->title; $thread_query=$this->db->get_where('thread', array('forumid' => $forum_item->forumid), 20, 0); foreach ($thread_query->result() as $thread_item) { $forum[$forum_item->forumid]['thread'][]=$thread_item->title; } } return $forum; } What is now next, is how to display this multidimensional array in the view, with foreach statements.... Any suggestions ? Thanks

    Read the article

  • setting up bind to work with nsupdate (SERVFAIL)

    - by funny_ha_ha
    I'm trying to update my DNS-Server dynamically using nsupdate. Prerequisite I'm using Debian 6 on my DNS-Server and Debian 4 on my client. I created a public/private key pair using: dnssec-keygen -C -a HMAC-MD5 -b 512 -n USER sub.example.com. I then edited my named.conf.local to contain my public key and the new zone i wish to update. It now looks like this (note: I also tried allow-update { any; }; without success): zone "example.com" { type master; file "/etc/bind/primary/example.com"; notify yes; allow-update { none; }; allow-query { any; }; }; zone "sub.example.com" { type master; file "/etc/bind/primary/sub.example.com"; notify yes; allow-update { key "sub.example.com."; }; allow-query { any; }; }; key sub.example.com. { algorithm HMAC-MD5; secret "xxxx xxxx"; }; Next, I copied the private key file (key.private) to another server I want to update the zone from. I also created a textfile (update) on this server which contained the update information (note: I tried toying around with this stuff too. no success): server example.com zone sub.example.com update add sub.example.com. 86400 A 10.10.10.1 show send Now I'm trying to update the zone using: nsupdate -k key.private -v update The Problem Said command gives me the following output: Outgoing update query: ;; ->>HEADER<<- opcode: UPDATE, status: NOERROR, id: 0 ;; flags: ; ZONE: 0, PREREQ: 0, UPDATE: 0, ADDITIONAL: 0 ;; ZONE SECTION: ;sub.example.com. IN SOA ;; UPDATE SECTION: sub.example.com. 86400 IN A 10.10.10.1 update failed: SERVFAIL named debug Level 3 gives me the following information when I issue the nsupdate command on the remote server (note: I obfuscated the client IP): 06-Aug-2012 14:51:33.977 client X.X.X.X#33182: new TCP connection 06-Aug-2012 14:51:33.977 client X.X.X.X#33182: replace 06-Aug-2012 14:51:33.978 clientmgr @0x2ada3c7ee760: createclients 06-Aug-2012 14:51:33.978 clientmgr @0x2ada3c7ee760: recycle 06-Aug-2012 14:51:33.978 client @0x2ada475f1120: accept 06-Aug-2012 14:51:33.978 client X.X.X.X#33182: read 06-Aug-2012 14:51:33.978 client X.X.X.X#33182: TCP request 06-Aug-2012 14:51:33.978 client X.X.X.X#33182: request has valid signature 06-Aug-2012 14:51:33.978 client X.X.X.X#33182: recursion not available 06-Aug-2012 14:51:33.978 client X.X.X.X#33182: update 06-Aug-2012 14:51:33.978 client X.X.X.X#33182: send 06-Aug-2012 14:51:33.978 client X.X.X.X#33182: sendto 06-Aug-2012 14:51:33.979 client X.X.X.X#33182: senddone 06-Aug-2012 14:51:33.979 client X.X.X.X#33182: next 06-Aug-2012 14:51:33.979 client X.X.X.X#33182: endrequest 06-Aug-2012 14:51:33.979 client X.X.X.X#33182: read 06-Aug-2012 14:51:33.986 client X.X.X.X#33182: next 06-Aug-2012 14:51:33.986 client X.X.X.X#33182: request failed: end of file 06-Aug-2012 14:51:33.986 client X.X.X.X#33182: endrequest 06-Aug-2012 14:51:33.986 client X.X.X.X#33182: closetcp But it doesn't do anything. The zone isn't updated, nor does my nsupdate change anything. I'm not sure if the file /etc/bind/primary/sub.example.com should exist prior to the first update or not. I tried it without the file, with an empty file and with a pre-configured zone file. Without success. The sparse information I found on the net pointed me towards file and folder permissions regarding the bind working directory, so I changed the permissions of both /etc/bind and /var/cache/bind (which is the home dir of my "bind" user). I'm not a 100% sure if the permissions are correct.. but it looks good to me: ls -lah /var/cache/bind/ total 224K drwxrwxr-x 2 bind bind 4.0K Aug 6 03:13 . drwxr-xr-x 12 root root 4.0K Jul 21 11:27 .. -rw-r--r-- 1 bind bind 211K Aug 6 03:21 named.run ls -lah /etc/bind/ total 72K drwxr-sr-x 3 bind bind 4.0K Aug 6 14:41 . drwxr-xr-x 87 root root 4.0K Jul 30 01:24 .. -rw------- 1 bind bind 125 Aug 6 02:54 key.public -rw------- 1 bind bind 156 Aug 6 02:54 key.private -rw-r--r-- 1 bind bind 2.5K Aug 6 03:07 bind.keys -rw-r--r-- 1 bind bind 237 Aug 6 03:07 db.0 -rw-r--r-- 1 bind bind 271 Aug 6 03:07 db.127 -rw-r--r-- 1 bind bind 237 Aug 6 03:07 db.255 -rw-r--r-- 1 bind bind 353 Aug 6 03:07 db.empty -rw-r--r-- 1 bind bind 270 Aug 6 03:07 db.local -rw-r--r-- 1 bind bind 3.0K Aug 6 03:07 db.root -rw-r--r-- 1 bind bind 493 Aug 6 03:32 named.conf -rw-r--r-- 1 bind bind 490 Aug 6 03:07 named.conf.default-zones -rw-r--r-- 1 bind bind 1.2K Aug 6 14:18 named.conf.local -rw-r--r-- 1 bind bind 666 Jul 29 22:51 named.conf.options drwxr-sr-x 2 bind bind 4.0K Aug 6 03:57 primary/ -rw-r----- 1 root bind 77 Mar 19 02:57 rndc.key -rw-r--r-- 1 bind bind 1.3K Aug 6 03:07 zones.rfc1918 ls -lah /etc/bind/primary/ total 20K drwxr-sr-x 2 bind bind 4.0K Aug 6 03:57 . drwxr-sr-x 3 bind bind 4.0K Aug 6 14:41 .. -rw-r--r-- 1 bind bind 356 Jul 30 00:45 example.com

    Read the article

  • DB2 upgrade database Fails due to descriptor corruption

    - by Jdcc
    Hi Everyone, I've recently upgraded my DB2 9.5 to DB2 9.7, and I am unable to update my database to v9.7. The error I have been receiving is this: "SQL0901N The SQL statement failed because of a non-severe system error. Subsequent SQL statements can be processed. (Reason "Packed descriptor corruption found. Please run RUNSTATS on this table".) SQLSTATE=58004" I have tried to connect with 9.5 clients that worked before the "upgrade" on other machines, but they complain about the DB not being migrated to the current version. So my DB is now somewhere in limbo between 9.5 and 9.7. Would anyone have any clever ideas on how to execute runstats on this DB without being able to connect to it? I'm not concerned so much about the data inside, as I am about the settings (name,optimization stuff, etc) Please let me know if I there is any information I left out. Thanks, Jdcc

    Read the article

  • Cloudera Manager CDH5 - Installation Failure on Oozie Database

    - by Nerrve
    While doing the installation, i keep getting a failure on the step "Creating Oozie database" java.lang.Exception: DB schema exists at org.apache.oozie.tools.OozieDBCLI.validateDBSchema(OozieDBCLI.java:877) at org.apache.oozie.tools.OozieDBCLI.createDB(OozieDBCLI.java:184) at org.apache.oozie.tools.OozieDBCLI.run(OozieDBCLI.java:127) at org.apache.oozie.tools.OozieDBCLI.main(OozieDBCLI.java:78) How do i fix this? Where do i get the password/username/dbname for the PostgreSQL database to drop the existing schema? I tried cat /etc/cloudera-scm-server/db*.properties | grep pass and /var/lib/cloudera-scm-server-db/data/generated-password.txt but the passwords don't work!

    Read the article

  • sudo: apache restarting a service on CentOS

    - by WaveyDavey
    I need my web app to restart the dansguardian service (on CentOS) so it needs to run '/sbin/service dansguardian restart' I have a shellscript in /home/topological called apacherestart.sh which does the following: #!/bin/sh id=`id` /sbin/service dansguardian restart r=$? return $r This runs ok (logger statement in script for testing output to syslog, so I know it's running) To make it run, I put this in /etc/sudoers: User_Alias APACHE=www # Cmnd alias specification Cmnd_Alias HTTPRESTART=/home/topological/apacherestart.sh,/sbin/e-smith/db,/etc/rc7.d/S91dansguardian # Defaults specification # User privilege specification root ALL=(ALL) ALL APACHE ALL=(ALL) NOPASSWD: HTTPRESTART So far so good. But the service does not restart. To test this I created a user david, and fudged the uid/gid in /etc/passwd to be the same as www: www:x:102:102:e-smith web server:/home/e-smith:/bin/false david:x:102:102:David:/home/e-smith/files/users/david:/bin/bash then logged in as david and tried to run the apacherestart.sh. The problem I get is: /etc/rc7.d/S91dansguardian: line 51: /sbin/e-smith/db: Permission denied even though S91dansguardian and db are in the sudoers command list. Any ideas?

    Read the article

  • Execute Backup-SqlDatabase cmdlet remotely

    - by Maxim V. Pavlov
    When I run the following script line locally on an SQL Server machine, it executes perfectly: Backup-SqlDatabase -ServerInstance $serverName -Database $sqldbname -BackupFile "$($backupFolder)$($dbname)_db_$($addinionToName).bak" $serverName contains a short name of the SQL Server instance. SQL Server is 2012, so these new cmdlets work like a charm. On the other hand, when I am trying to perform a DB backup from a TeamCity agent machine like this (Through Invoke-Command cmdlet): function BackupDB([String] $serverName, [String] $sqldbname, [String] $backupFolder, [String] $addinionToName) { Import-Module SQLPS -DisableNameChecking Backup-SqlDatabase -ServerInstance $serverName -Database $sqldbname -BackupFile "$($backupFolder)$($dbname)_db_$($addinionToName).bak" } Invoke-Command -computername $SQLComputerName -Credential $credentials -ScriptBlock ${function:BackupDB} -ArgumentList $SQLInstanceName, $DatabaseName, $BackupDirectory, $BakId results in an error: Failed to connect to server $serverName. + CategoryInfo : NotSpecified: (:) [Backup-SqlDatabase], ConnectionFailureException + FullyQualifiedErrorId : Microsoft.SqlServer.Management.Common.ConnectionFailureException,Microsoft.SqlServer.M anagement.PowerShell.BackupSqlDatabaseCommand What is the correct way to execute Backup-SqlDatabase cmdlet remotely?

    Read the article

  • Install Oracle Drive and TNS for Windows XP?

    - by David.Chu.ca
    I am building a box with Windows XP with some applications. One application requires connection to an Oracle database on remote. I have installed OracleXEClient.exe from Oracle download. The installation does install "Oracle Provider for OLE DB" driver. My problem is that I still cannot make connections to the remote Oracle db. The test I have done is to create a UDL file with Oracle provider OLE DB connection. The error message is: --------------------------- Microsoft Data Link Error --------------------------- Test connection failed because of an error in initializing provider. ORA-12154: TNS:could not resolve the connect identifier specified I think I may miss TNSNAMEC.ora in the box. I can find this file from another box where Oracle connection works fine. I am not sure what package I should install (from Oracle) so that the default TNSNAEMES.ora will be installed with related files and setup path for accessing the TNS file?

    Read the article

  • restore content database in sharepoint server 2007

    - by Boris
    I have a site collection set up at web app running at port 80. I have made the backup of the site collection content db using stsadm.exe tool. Now, I want to restore that backup as a new content db of a different site collection - the one set up at web app running at port 500. I have done the following: Created a backup Created new web app at port 500 (I did not create a site collection for this web app) I have removed the content db of that new web app using Central Administration I have run the stsadm.exe -o addcontentdb -url webapp-at-port-500 -databasename Command is successfully completed, however when I check the Content Database page for that web app, it says that the Number of Sites is 0! Also, when I try to open http://webapp-at-port-500, I get the error saying that the webpage cannot be found. Could anyone please help me, it's driving me crazy. Thanks.

    Read the article

  • SSH tunnel over http proxy with blocked 443 (SSL)

    - by Evgeny Zhulenev
    Is it possible to create an SSH tunnel over http-proxy when https access is denied? I had such configuration in .ssh\config Host home User root Hostname *my-home-pc-with-ssh-access-allowed* Port 8090 ProxyCommand corkscrew db-isa-01 8080 %h %p ~/.ssh/.corkscrew-db-isa-auth IdentityFile ~/.ssh/id_rsa Where db-isa-01 is my corporate proxy server. Today the admins blocked all https access and allowed it only for few servers on the white list. I used this command to create a tunnel: ssh -D 7070 -o 'GatewayPorts yes' -A -q -g -t root@home and now it doesn't work. As I can understand, that's because our proxy denies all https connections Proxy could not open connnection to ***: Proxy Error ( The specified Secure Sockets Layer (SSL) port is not allowed. Forefront TMG is not configured to allow SSL requests from this port. Most Web browsers use port 443 for SSL requests. ) P.S. I use Windows 7, and corscskrew with cygwin, so Linux solutions not suitable for me.

    Read the article

  • UnicodeEncodeError when uploading files in Django admin

    - by Samuel Linde
    Note: I asked this question on StackOverflow, but I realize this might be a more proper place to ask this kind of question. I'm trying to upload a file called 'Testaråäö.txt' via the Django admin app. I'm running Django 1.3.1 with Gunicorn 0.13.4 and Nginx 0.7.6.7 on a Debian 6 server. Database is PostgreSQL 8.4.9. Other Unicode data is saved to the database with no problem, so I guess the problem must be with the filesystem somehow. I've set http { charset utf-8; } in my nginx.conf. LC_ALL and LANG is set to 'sv_SE.UTF-8'. Running 'locale' verifies this. I even tried setting LC_ALL and LANG in my nginx init script just to make sure locale is set properly. Here's the traceback: Traceback (most recent call last): File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/core/handlers/base.py", line 111, in get_response response = callback(request, *callback_args, **callback_kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/contrib/admin/options.py", line 307, in wrapper return self.admin_site.admin_view(view)(*args, **kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/utils/decorators.py", line 93, in _wrapped_view response = view_func(request, *args, **kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/views/decorators/cache.py", line 79, in _wrapped_view_func response = view_func(request, *args, **kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/contrib/admin/sites.py", line 197, in inner return view(request, *args, **kwargs) File "/srv/django/letebo/app/cms/admin.py", line 81, in change_view return super(PageAdmin, self).change_view(request, obj_id) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/utils/decorators.py", line 28, in _wrapper return bound_func(*args, **kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/utils/decorators.py", line 93, in _wrapped_view response = view_func(request, *args, **kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/utils/decorators.py", line 24, in bound_func return func(self, *args2, **kwargs2) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/db/transaction.py", line 217, in inner res = func(*args, **kwargs) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/contrib/admin/options.py", line 985, in change_view self.save_formset(request, form, formset, change=True) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/contrib/admin/options.py", line 677, in save_formset formset.save() File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/forms/models.py", line 482, in save return self.save_existing_objects(commit) + self.save_new_objects(commit) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/forms/models.py", line 613, in save_new_objects self.new_objects.append(self.save_new(form, commit=commit)) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/forms/models.py", line 717, in save_new obj.save() File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/db/models/base.py", line 460, in save self.save_base(using=using, force_insert=force_insert, force_update=force_update) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/db/models/base.py", line 504, in save_base self.save_base(cls=parent, origin=org, using=using) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/db/models/base.py", line 543, in save_base for f in meta.local_fields if not isinstance(f, AutoField)] File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/db/models/fields/files.py", line 255, in pre_save file.save(file.name, file, save=False) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/db/models/fields/files.py", line 92, in save self.name = self.storage.save(name, content) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/core/files/storage.py", line 48, in save name = self.get_available_name(name) File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/core/files/storage.py", line 74, in get_available_name while self.exists(name): File "/srv/.virtualenvs/letebo/lib/python2.6/site-packages/django/core/files/storage.py", line 218, in exists return os.path.exists(self.path(name)) File "/srv/.virtualenvs/letebo/lib/python2.6/genericpath.py", line 18, in exists st = os.stat(path) UnicodeEncodeError: 'ascii' codec can't encode characters in position 52-54: ordinal not in range(128) I tried running Gunicorn with debugging turned on, and the file uploads without any problem at all. I suppose this must mean that the issue is with Nginx. Still beats me where to look, though. Here are the raw response headers from Gunicorn and Nginx, if it makes any sense: Gunicorn: HTTP/1.1 302 FOUND Server: gunicorn/0.13.4 Date: Thu, 09 Feb 2012 14:50:27 GMT Connection: close Transfer-Encoding: chunked Expires: Thu, 09 Feb 2012 14:50:27 GMT Vary: Cookie Last-Modified: Thu, 09 Feb 2012 14:50:27 GMT Location: http://my-server.se:8000/admin/cms/page/15/ Cache-Control: max-age=0 Content-Type: text/html; charset=utf-8 Set-Cookie: messages="yada yada yada"; Path=/ Nginx: HTTP/1.1 500 INTERNAL SERVER ERROR Server: nginx/0.7.67 Date: Thu, 09 Feb 2012 14:50:57 GMT Content-Type: text/html; charset=utf-8 Transfer-Encoding: chunked Connection: close Vary: Cookie 500 UPDATE: Both locale.getpreferredencoding() and sys.getfilesystemencoding() outputs 'UTF-8'. locale.getdefaultlocale() outputs ('sv_SE', 'UTF8'). This seem correct to me, so I'm still not sure why I keep getting these errors.

    Read the article

  • “Disk /dev/xvda1 doesn't contain a valid partition table”

    - by Simpanoz
    Iam newbie to EC2 and Ubuntu 11 (EC2 Free tier Ubuntu). I have made following commands. sudo mkfs -t ext4 /dev/xvdf6 sudo mkdir /db sudo vim /etc/fstab /dev/xvdf6 /db ext4 noatime,noexec,nodiratime 0 0 sudo mount /dev/xvdf6 /db fdisk -l I got following output. Can some one guide me what I am doing wrong and how it can be rectified. Disk /dev/xvda1: 8589 MB, 8589934592 bytes 255 heads, 63 sectors/track, 1044 cylinders, total 16777216 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00000000 Disk /dev/xvda1 doesn't contain a valid partition table Disk /dev/xvdf6: 6442 MB, 6442450944 bytes 255 heads, 63 sectors/track, 783 cylinders, total 12582912 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00000000 Disk /dev/xvdf6 doesn't contain a valid partition table.

    Read the article

  • Database OR Array

    - by rezoner
    What is the exact point of using external database system if I have simple relations (95% querries are dependant on ID). I am storing users and their stats. Why would I use external database if I can have neat constructions like: db.users[32] = something Array of 500K users is not that big effort for RAM Pros are: no problematic asynchronity (instant results) easy export/import dealing with database like with a native object LITERALLY ps. and considerations: Would it be faster or slower to do collection[3] than db.query("select ... I am going to store it as a file/s There is only ONE application/process accessing this data, and the code is executed line by line - please don't elaborate about locking. Please don't answer with database propositions but why to use external DB over native array/object - I have experience in a few databases - that's not the case. What I am building is a client/gateway/server(s) game. Gateway deals with all users data, processing, authenticating, writing statistics e.t.c No other part of software needs to access directly to this data/database.

    Read the article

  • Set up Glassfish connection pool to talk to a database on a Ubuntu VPS

    - by Harry Pham
    On my Ubuntu VPS, i have a mysql server running and a Glassfish 3.0.1 Application Server running. And I am having a hard to have my GF successfully ping the database. Here is my GF set up Assume: x.y.z.t is the ip of my VPS Resource Type: javax.sql.ConnectionPoolDataSource User: root DatabaseName: scholar Url: jdbc:mysql://x.y.z.t:3306/scholar URL: jdbc:mysql://x.y.z.t:3306/scholar Password: xxxx PortNumber: 3306 ServerName: x.y.z.t Inside my glassfish3/glassfish/lib, I have my mysql-connector-java-5.1.13-bin.jar Inside the database, table mysql here is the result of the query select User, Host from user; +------------------+-----------+ | User | Host | +------------------+-----------+ | root | 127.0.0.1 | | debian-sys-maint | localhost | | root | localhost | | root | yunaeyes | +------------------+-----------+ Now from my machine, if I try to connect to this db via mysql browser (mysql client software), well I cant. Well from the table above, seem like it only allow localhost to connect to this db. Keep in mind that both my db and my GF are on the same VPS. Please help

    Read the article

  • How to use Binary Log file for Auditing and Replicating in MySQL?

    - by Pranav
    How to use Binary Log file for Auditing in MySQL? I want to track the change in a DB using Binary Log so that I can replicate these changes to other DB please do not give me hyperlinks for MySQL website. please direct me to find the solution EDIT I have looked for auditing options and created a script using Triggers for that, but due toi the Joomla DB structure it did'nt worked for me, hence I have to move on to Binary Log file concept now i am stucked in initiating the concept as I am not getting the concept of making the server master/slave, so can any body guide me how to actually initiate it via PHP?

    Read the article

  • How to proxy to different named databases on the same server using MySQL Proxy?

    - by cclark
    I would like to have two databases on my MySQL server: DEV_DB_A DEV_DB_B However, in order to keep everyone's scripts, Query Browser settings and anything else from changing when we switch from using on DB to another I'd like to have everyone connect to DEV_DB and then use something like MySQL Proxy running a lua script which knows the currently active DB is DEV_DB_A and routes queries to there. If we restore a fresh version of the DB to DEV_DB_B or make some changes (e.g. partition a table) we can easily switch to DEV_DB_B by changing one Lua script instead of updating references everywhere. I had hoped I might be able to symlink inside of the mysql data directory but that didn't work so it seems like MySQL Proxy is a reasonable approach. Being new to Lua and MySQL Proxy I'm wondering if anyone else has approached the problem this way and how it worked.

    Read the article

  • Migrating data from Oracle database to Pervasive .DAT files

    - by kaychaks
    The requirement is to migrate some tables with data from a Oracle database server to Pervasive database's .DAT file. Then those .DAT files will be used by a Pervasive database server. The restriction is that Oracle DB can not directly migrate to the Pervasive DB. It has to generate the .DAT files and then the new .DAT files will replace the old one for the Pervasive DB which will then use them for the new data. I was trying this task with SSIS. Exporting the Oracle table to a delimited .txt file and then creating a .DAT file from that text file. I can export the data from Oracle to .txt but I am not finding any way to migrate .txt to Pervasive .DAT? Is this the right approach? If not then please help with my problem.

    Read the article

  • Hyper-V cluster VS regular cluster

    - by Sasha
    We need to choice between Hyper-V and regular cluster technologies. What is the advantage and disadvantage of these approaches? Update: We have to physical servers and want to build reliably solution using cluster approach. We need to clustering our application and DB (MS SQL). We know that we can use: Regular Windows Cluster Service. Application and DB will be migrating from one node to other. Hyper-V Failover Cluster. Virtual machine will be migrating from one node to other. Combined variant. DB mirroring for MS SQL and Hyper-V for our application. We need to make a choice between this approach. So we need to know advantage and disadvantage of these approaches?

    Read the article

  • Multiple client connecting to master MySQL over SSL

    - by Bastien974
    I successfully configured a MySQL replication over SSL between 2 servers accross the internet. Now I want a second server in the same location as the replication slave, to open a connection to the master db over ssl. I used the same command found here http://dev.mysql.com/doc/refman/5.1/en/secure-create-certs.html to generate a new set of client-cert.pem and client-key.pem with the same master db ca-cert/key.pem and I also used a different Common Name. When I try to initiate a connection between this new server and the master db, it fails : mysql -hmasterdb -utestssl -p --ssl-ca=/var/lib/mysql/newcerts/ca-cert.pem --ssl-cert=/var/lib/mysql/newcerts/client-cert.pem --ssl-key=/var/lib/mysql/newcerts/client-key.pem ERROR 2026 (HY000): SSL connection error It's working without SSL.

    Read the article

  • How to use Binary Log file for Auditing and Replicating in MySQL?

    - by Pranav
    How to use Binary Log file for Auditing in MySQL? I want to track the change in a DB using Binary Log so that I can replicate these changes to other DB please do not give me hyperlinks for MySQL website. please direct me to find the solution I have looked for auditing options and created a script using Triggers for that, but due toi the Joomla DB structure it did'nt worked for me, hence I have to move on to Binary Log file concept now i am stucked in initiating the concept as I am not getting the concept of making the server master/slave, so can any body guide me how to actually initiate it via PHP?

    Read the article

  • DBD::mysql gives mysql_init not found

    - by highBandWidth
    I have to install a non-admin copy of mysql and perl module DBD::mysql in my home directory. I installed mysql in ~/software/db/mysql and this works since I can start and stop the server and go to the mysql prompt. Then, I downloaded the perl module and installed it using perl Makefile.PL PREFIX=~/myperl/ LIB=~/myperl/lib/lib64/perl5/ --mysql_config=/my_home/software/db/mysql/bin/mysql_config --libs=/myhome/software/db/mysql/lib/libmysqlclient.a make make install I did this to use the statically linked mysql client library. perl -MDBD::mysql -e 1 gives no errors. However, when I actually try to use the module, I get /usr/bin/perl: symbol lookup error: /myhome/myperl/lib/lib64/perl5/x86_64-linux-thread-multi/auto/DBD/mysql/mysql.so: undefined symbol: mysql_init

    Read the article

  • zero downtime during database scheme upgrade on SQL 2008

    - by eject
    I have web application on IIS7 with SQL server 2008 as RDBMS. Need get 0 downtime during future upgrades of ASP.NET code and DB schema as well. I need to get right scenario for this. I have 2 web servers and 2 sql servers and one http load balancer whcih allows to switch web backend server for web requests. Main goal is to make 1st web server and DB server up and running, update code and db schema on 2nd server and then switch all the requests to 2nd server and then main problem - how to copy data from 1st database 2nd (which was changed during upgrade).

    Read the article

  • Is allowing remote Sql Server Management Studio safe?

    - by dave thieben
    I administer a website that runs on IIS on one box, and SQL Server 2008 Workgroup on another box. typically I remote into the DB box and run SSMS to work on the db, but I would like to be able to access the db directly with SSMS on my local box. I've seen the other questions about allowing remote access to the database, but my question is, is this safe? I'm concerned that I'm opening a hole in the firewall and potential for hack attempts. Is this just a bad idea in general?

    Read the article

  • MS Access 2007 end user access

    - by LtDan
    I need some good advise. I have used Access for many years and I use Sharepoint but never the two combined. My newly created Access db needs to be shared with many users across the organization. The back end is SQL and the old way to distribute the database would be placing the db on a shared drive, connecting their PC ODBC connections to the SQL db and then they would open the database and have at it. This has become the OLD way. What is the best (and simpliest) way to allow the end users to utilize a frontend for data entry/edit reporting etc. Can I create a link through SharePoint and the user just open it from there. Your good advise is greatly approciated.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • htaccess not found

    - by clarkk
    I have installed a Apache 2 (from webmin) server on Debian 6.. I have setup a virtual host db.domain.com on the server which works fine, but .htaccess doesn't work if you get access from the ip address and the directory is listed if no index.php is found? db.domain.com -> 403 forbidden xxx.xxx.xxx.xxx -> gets access to the server Why is .htaccess omitted when you get access from the servers ip address? httpd.conf <Directory *> Options -Indexes FollowSymLinks </Directory> <VirtualHost *:80> ServerName db.domain.com DocumentRoot /var/www </VirtualHost> htaccess order deny,allow deny from all

    Read the article

< Previous Page | 79 80 81 82 83 84 85 86 87 88 89 90  | Next Page >