Search Results

Search found 8371 results on 335 pages for 'inline block'.

Page 84/335 | < Previous Page | 80 81 82 83 84 85 86 87 88 89 90 91  | Next Page >

  • Javascript Running slow in IE

    - by SharePoint Newbie
    Hi, Javascript is running extremely slow on IE on some pages in our site. Profiling seems to show that the following methods are taking the most time: (Method, count, inclusive time, exclusive time) JScript - window script block 2,332 237.98 184.98 getDimensions 4 33 33 eh 213 32 32 extend 446 30 30 tt_HideSrcTagsRecurs 1,362 26 26 String.split 794 18 18 $ 717 49 17 findElements 104 184.98 14 What does "JScript - window script block" do? We are using jquery and prototype. Thanks,

    Read the article

  • Basic concepts in file system implementation

    - by darkie15
    I am a unclear about file system implementation. Specifically (Operating Systems - Tannenbaum (Edition 3), Page 275) states "The first word of each block is used as a pointer to the next one. The rest of block is data". Can anyone please explain to me the hierarchy of the division here? Like, each disk partition contains blocks, blocks contain words, and so on...

    Read the article

  • Wordpress css and ie6

    - by marc-andre menard
    my website : http://www.equipe94.com have a two column layout and in ie6 the right column is flushed at the button... it look like and inline problem, but even WITH the inline widget.. it's still at the bottom.. any idea to fix a wordpress template to play well with ie6 ? thanks in advance n.b. As mentioned in the comment... my page don't validate... after fixing the multiples problems now I validate in XHTML 1.0 Strict... but the problem is still there !

    Read the article

  • XNA - 2D Tile Lighting

    - by Cyral
    Im adding lighting to my 2D Tile based game. I found the link http://blog.josack.com/2011/07/xna-2d-dynamic-lighting.html useful, but the way its done it dosent support collision. What Id like is some help or links as I want one that can have -always lit up light points -collision (If the light ray hits a block, then dim the next block by whatever amount until its dark) Im a noob at this stuff, but ive been searching around for quite a while but no luck (I did find Catalin's tutorial, but it seemed abit advanced for me)

    Read the article

  • Strict doctype - form and input element

    - by David
    Does anyone know the reasoning behind the strict doctype not allowing input elements to be direct descendents of a form element. I find it annoying that i have to wrap a submit button which is a block level element inside another block level element say a fieldset or a div. However, I cannot find an answer anywhere as to why this actually is.

    Read the article

  • Does changing the order of class private data members breaks ABI

    - by Dmitry Yudakov
    I have a class with number of private data members (some of them static), accessed by virtual and non-virtual member functions. There's no inline functions and no friend classes. class A { int number; string str; static const int static_const_number; public: // got virtual and non-virtual functions, working with these memebers virtual void func1(); void func2(); // no inline functions or friends }; Does changing the order of private data members breaks ABI in this case? class A { string str; static const int static_const_number; int number; // <-- integer member moved here ... };

    Read the article

  • Migrating from Maven to SBT

    - by Vasil Remeniuk
    Hi people, As you know, SBT is compatible with Maven in some way -- SBT recognizes simple Maven POMs and can use dependencies and repositories specified in them. However, SBT wiki says that, if inline dependency is specified in SBT project definition, POM will be ignored (so using both in this case is impossible): Maven and Ivy configurations (pom.xml and ivy.xml) are ignored when inline dependency declarations are present. Does anyone know, if any kind of converter from Maven POM to SBT project definition exists (translating POM's XML into project definition Scala code)? I'm considering writing such script (that will help to migrate my old Scala/Maven projects to SBT), but want to know first, if this functionality already exists. Thanks in advance.

    Read the article

  • gcc segmentation fault compiling 20k file

    - by aaa
    hi. I have fairly large file, 20k lines long (auto generated). It has been compiling okay, but after adding new if/endif preprocessor block, I started getting gcc internal errors: segmentation fault. the code inside new preprocessor block is not being compiled, so I am not sure where the error is coming from. my only guess is memory, but as far as I can tell it does not exhaust computer memory. Any thoughts?

    Read the article

  • Finding leaks under GeneralBlock-16?

    - by erastusnjuki
    If ObjectAlloc cannot deduce type information for the block, it uses 'GeneralBlock'. Any strategies to get leaks from this block that may eliminate the need of my 'trial and error' methods that I use? The Extended Detail thing doesn't really do it for me as I just keep guessing.

    Read the article

  • Send/cache multidimensional array to php with jQuery

    - by robertdd
    hy, i have a little, big problem here :) after i upload some images i get a list with all the images. I have some jQuery function for rotate, duplicate, delete, shuffle images! when i select a image and hit delete i send a post to php with the alt="" value of the image,i identify the picture and edit. I want to make a save button, Instead of sending a post every time i rotate a image, better send a post after editing the list of images with an array that contains all data? my php array after upload looks like this: [files] => Array ( [lcxkijgr] => lcxkijgr.jpg [xcewxpfv] => xcewxpfv.jpg [rtiurwxf] => rtiurwxf.jpg [gsbxdsdc] => gsbxdsdc.jpg ) say that I uploaded 4 pictures, firs picture i rotate 90 degrees second i want to duplicate third i rotate 270 degrees and the fourth image i delete i can do all this only with jQuery, but on the server the images are the same, after a refresh the images are the same this is the list with the images: <div class="upimage"> <ul id="upimagesQueue"> <li id="upimagesHPVEJM"> <a href="javascript:jQuery('#upimagesHPVEJM').showlargeimage('HPVEJM')"> <img alt="lcxkijgr" src="uploads/s6id9r9icnp8q9102h8md9kfd7/lcxkijgr.jpg?1272087830477" id="HPVEJM" style="display: block;" > </a> </li> <li id="upimagesSTCSAV"> <a href="javascript:jQuery('#upimagesSTCSAV').showlargeimage('STCSAV')"> <img alt="xcewxpfv" src="uploads/s6id9r9icnp8q9102h8md9kfd7/xcewxpfv.jpg?1272087831360" id="STCSAV" style="display: block;" > </a> </li> <li id="upimagesBFPUEQ"> <a href="javascript:jQuery('#upimagesBFPUEQ').showlargeimage('BFPUEQ')"> <img alt="rtiurwxf" src="uploads/s6id9r9icnp8q9102h8md9kfd7/rtiurwxf.jpg?1272087832162" id="BFPUEQ" style="display: block;" > </a> </li> <li id="upimagesRKXNSV"> <a href="javascript:jQuery('#upimagesRKXNSV').showlargeimage('RKXNSV')"> <img alt="gsbxdsdc" src="uploads/s6id9r9icnp8q9102h8md9kfd7/gsbxdsdc.jpg?1272087832957" id="RKXNSV" style="display: block;"> </a> </li> <ul> </div> is ok if i make one array like this: array{ imgFromLi = array(img1,img2,img3,img4,img5,img6) rotate = array{img1=90, img2=270, img3=90} delete = array{img4,img5,img6} duplicate = array{img2, img3} } how i can send/cache this array?? sorry for my very bad english

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

  • How do I use the information about exceptions a method throws in .NET in my code?

    - by dotnetdev
    For many methods in .NET, the exceptions they can potentially throw can be as many as 7-8 (one or two methods in XmlDocument, Load() being one I think, can throw this many exceptions). Does this mean I have to write 8 catch blocks to catch all of these exceptions (it is best practise to catch an exception with a specific exception block and not just a general catch block of type Exception). How do I use this information? Thanks

    Read the article

  • Unity 2 and Enterprise library configuration tool

    - by nachid
    Hi, Can someone show me how to use Enterprise library configuration tool with Unity2 Whatever I did, when I open the Enterprise library configuration tool, I could not have it working with a Unity config file. When I click on the menu to add a new block, there is no Unity configuration block What am I doing wrong? Thank you for your help

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

  • an x86 question

    - by wide
    i'm working for my exam. i didn't resolved this question. does anyone help me? assume that there are two block, BLOCK1 AND BLOCK2. every block has 50 bytes. write a program to add BLOCK1 with BLOCK2 , and store result to BLOCK2 using LODS, STOS and LOOP etc. assembly commands?

    Read the article

  • to change the style of div

    - by ramyatk06
    hi guys, I have 2 buttons and 2 divs div1 and div2.On click button1 div1 is made visible and div2 invisible,On clicking button2 div2 is made visible and div1 is invisible. For that i used javascript. function showdiv2() { document.getElementById("div2").style.visibility="visible"; document.getElementById("div2").style.display="inline"; document.getElementById("div1").style.visibility="hidden"; document.getElementById("div1").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } function showdiv1() { document.getElementById("div1").style.visibility="visible"; document.getElementById("div1").style.display="inline"; document.getElementById("div2").style.visibility="hidden"; document.getElementById("div2").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } In div2 i have a gridview in which i have a linkbutton named lnkDelete.In its click control is going to div1.In click of lnkDelete,i want to make div1 invisible,but on clicking button1 div1 should be visible.Can anybody help to make div1 invisible in clickevent of lnkDelete in codebehind?

    Read the article

  • loading an asp after starting a session

    - by Noam Smadja
    the jQuery $("#loginform").submit(function(){ $.ajax({ type: "POST", url: "loginrespajax.asp", data: $("#loginform").serialize(), success: function(){ $("#loginform").hide("slow"); $("#loginform").load("userheader.asp"); $("#loginform").show("slow"); } }); }); thats userheader.asp <div class="userlinks"> <%if (session("userlevel")) then%> <% select case session("userlevel") case 1 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="manageusers.asp"><%langstring("manage_users")%></a> | <a href="manageorders.asp"><%langstring("manage_orders")%></a> | <a href="managelanguage.asp"><%langstring("manage_language")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 2 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 3 %> <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% End select %> <a href="editprofile.asp"><%langstring("editprofile_header")%></a> | <a href="changepassword.asp"><%langstring("changepassword_header")%></a> | <a href="logout.asp"><%langstring("logout_header")%></a> <%else%> <form action="loginrespajax.asp" method="POST" name="loginform" id="loginform" class="loginform" onSubmit="return false;"> <input type="text" name="username" value="username" class="input inline" onFocus="clearText(this);"> <input type="password" name="password" value="password" class="input inline" onFocus="clearText(this);"> <input type="submit" value="Log In" class="submit inline"> </form> <%End if%> </div> i am submiting the login form using AJAX and the jQuery partially works. it does hide and show again. but it prints the ELSE part of in userheader.asp. the session does start, for sure :)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Bullets WILL NOT dissapear in firefox

    - by DunlopBurns
    Hoping you can help me with a problem. I cannot get rid of Bullets in Firefox, i don't want any anywhere, hence my list-style-type: none!important being everywhere. It only appears in Firefox as far as i can tell. the HTML.... <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <title>littleprints.nl</title> <meta name="description" content="----" /> <meta name="keywords" content="----" /> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4/jquery.min.js"></script> <script type="text/javascript" src="js/slimbox2.js"></script> <link rel="stylesheet" href="css/slimbox2.css" type="text/css" media="screen" /> <link rel="stylesheet" href="layout.css"/> <link rel="stylesheet" href="style.css"/> </head> <body> <div id="container"> <div id="inline1"> <div id="mainpic"> <img src="myimages/circle.jpg" width="100%" alt="Circle bracelet"/> </div> <div id="intro"> <p>Hi and welcome to little prints NL. we make this and that all by hand with 100% silver. my name is Donna Burns and i work by commision, ive been studying for 4 years and am currently learning to become a goldsmith.</p> </div> </div> <div id="inline2"> <p>Click for more...</p> <div id="images"> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/chunky.gif" alt="chunky"/></a> <a href="myimages/photos/hearts.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/hearts.gif" alt="hearts"/></a> <a href="myimages/photos/close.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/close.gif" alt="close"/></a> <a href="myimages/photos/pearl.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/flower.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/frontcircle.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> </div> </div> </div><!--end container--> <div id="footer"> <div id="footalign"> <div id="social"> <ul> <li> <a href="http://www.facebook.com/littleprints" title="Little Prints"> <img src="myimages/facebook.png" width="50px" height="50px" alt="FB"/> </a> </li> <li> <a href="contact.html" title="contact"> <img src="myimages/at.gif" alt="@"/> </a> </li> </ul> </div> <div id="contact"> <p><br/>To enquire about a charm either phone:<br/> 0787463289<br/> or use one of the methods to the side.</p> </div> </div> </div> </body> </html> the CSS... * {margin: 0; padding: 0; border: 0;} html, body { background-color: #000000;image; text-align: center; font: 16px/1.8 Verdana, Arial, Helvetica, sans-serif; list-style-type: none!important; text-decoration: none;} #container { position: relative; width: 900px; top: 0; min-height: 100%; margin-left: auto; margin-right: auto; padding-top: 20px; background-image: URL(myimages/back2.gif); margin-bottom: 180px; } #footer { background-color: #555555; position: relative; clear: both; bottom: 0; width: 900px; height: auto; margin-left: auto; margin-right: auto; margin-bottom: 20px; padding-bottom: 22px; margin-top: -180px; } #inline1{ display: inline-block; margin-top: 250px; margin-bottom: 20px; } #inline2 { display: inline-block; margin-top: 30px; margin-bottom: 50px; } #mainpic { float: left; width: 68%; margin-left: 20px; } #intro { float: right; width: 20%; margin-left: auto; margin-right: 50px; margin-top: 20px; } #images { margin-bottom: 20px; margin-left: auto; margin-right: auto; } #footalign { display: inline; width:900px; list-style-type: none; } #contact { text-align: center; background-color:#555555; float: middle; list-style-type: none; } #social{ background-color:#555555; float: right; list-style: none; padding:0; padding-right: 5px; text-align:center; list-style-type: none!important; } #social img{ border: none; list-style-type: none!important; margin: 3px; } #social ul{ border: none; list-style-type: none!important; } #social a{ display:inline-block; -webkit-transition:all .5s ease-out; -moz-transition:all .5s ease-out; -ms-transition:all .5s ease-out; -o-transition:all .5s ease-out; transition:all .5s ease-out; list-style-type: none!important; } #social a:hover{ display:inline-block; -webkit-transform:translate(-10px,0px); -moz-transform:translate(0px,-10px); -ms-transform:translate(-10px,0px); -o-transform:translate(-10px,0px); transform:translate(-10px,0px); list-style-type: none!important; } #form { margin-top: 250px; margin-bottom: 50px; } .nav1 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #000000;} a:link {text-decoration:none; color:#000000; padding:3px;} a:visited {text-decoration:none; color:#000000;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .nav2 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #ffffff;} a:link {text-decoration:none; color:#ffffff; padding:3px;} a:visited {text-decoration:none; color:#ffffff;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .p1 { color: #ffffff; } div#images img { max-width: 500px; height: auto; }

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • How to achieve table like rows within container using CSS

    - by Barry
    I'm helping an artist maintain her website and have inherited some pretty outdated code. Have moved lots of redundant common code to include files and am now working on moving from inline styles to more CSS-driven styles. For the gallery pages, e.g. http://artistsatlaketahoe.com/abstract.html, a lot of inline styling is used to force the current layout. My preference would be to replace this entirely with CSS that presents the following table-like layout within the "content" div: [image] [image descriptives and purchase button] [image] [image descriptives and purchase button] [image] [image descriptives and purchase button] I'd like to middle-align the image descriptives & purchase button relative to the image if possible. And then apply some padding above and below each row to stop using tags for vertical spacing. Any ideas how to create a div that I can use to get this kind of layout? Thanks!

    Read the article

< Previous Page | 80 81 82 83 84 85 86 87 88 89 90 91  | Next Page >