Search Results

Search found 25113 results on 1005 pages for 'grouped table'.

Page 85/1005 | < Previous Page | 81 82 83 84 85 86 87 88 89 90 91 92  | Next Page >

• Display continious dates in Pivot Chart

  - by Douglas

  I have a set of data in a pivot table with date times and events. I've made a pivot chart with this data, and grouped the data by day and year, then display a count of events for each day. So, my horizontal axis goes from 19 March 2007 to 11 May 2010, and my vertical axis is numeric, going from zero to 140. For some days, I have zero events. These days don't seem to be shown on the horizontal axis, so 2008 is narrower than 2009. How do I display a count of zero for days with no events? I'd like my horizontal axis to be continuous, so that it does not miss any days, and every month ends up taking up the same amount of horizontal space. (This question is similar to the unanswered question here, but I'd rather not generate a table of all the days in the last x number of years just to get a smooth plot!)

  Read the article

• Redirect to a link by clicking on a row which contains it

  - by Shymep

  I have a table <tr> <td>xxx</td> <td>yyy</td> <td><a href="javascript:__doPostBack('smth','')">Select</a></td> </tr> <tr> ...similar here </tr> My goal is to redirect to the select page link by clicking on the row. I was trying to implement such construction $("table tr").click(function() { $(this).find("a").click(); }); and also a few tricks with window.location but it didn't help. UPDATED: I'm getting errors like

  Read the article

• Interesting XSL Dilemma

  - by bobber205

  I've got this issue. A template called "checkbox" that's called from while inside a table HTML element and also outside of it. To solve an issue, I've added tags to "checkbox" input control. Here's what I'd like to do to but I'm not sure if it's possible or not. When I hit my "row" (part of the custom table markup) template, I would set some variable or pass some parameter, that for each template applied afterwards, would know it was in a "row" and do something special based on this information. I know I can't add parameters to apply-templates. I may be able to add a row "mode" but I can't make changes to each template and have one copy with the mod parameter and one without. Thanks for any suggestions. I know the ideal solution would to be to make changes to the XML but I'm not sure if I can do that as this point. That's a "content" issue. :P Thanks!

  Read the article

• How to use Joomla to allow users to create/update data on my site?

  - by gromo

  Right now Im using an extension called chronoforms but Im open to anything that works. I can make forms just fine, and it saves the submitted data to a table. Where I am stuck is, how do I then allow my front end users who filled out and submitted the form to go back, view their old answers, change them, and resubmit them or resave them. In order to do this I think I would need to be able to retrieve their last answers from the table on which it is stored, replug the last specific data record for that user only back into the original form on the front end and let the user change and resubmit it? Unless there is a better way to allow the user to change their answers to a form and resave them? If anyone knows how to do this, or if there is a better way I should be going about doing this, (perhaps there is another extension that handles this kind of thing) please let me know. Thanks!

  Read the article

• Trouble upgrading OSX, because HD doesn't use GUID Partition Table Scheme

  - by Erik Vold

  So I have a intel-based macbook with osx 10.5 and I'm trying to upgrade to 10.6, but when I run the upgrade 'install' I quickly get to a page where I am supposed to 'Select the disk where you want to install Mac OS X' and there is only the one hard drive, so it is auto selected, and below that I see a warning message and the only button available is the 'Go Back' button. The warning message says: "Macintosh HD" can't be used because it doesn't use the GUID Partition Table scheme. Use Disk Utility to change the partition scheme. Select the disk, choose the Partition tab, select the Volume Scheme and then click Options. So I followed the above instructions, and I got to the last step, where I'm supposed to click the 'Options' button, the problem is that I cannot click that button, it is disabled.. So what am I supposed to do?

  Read the article

• Damaged XenServer Storage LVM partition table

  - by Fiolek

  I have a homeserver running under XenServer control with 3x1TB discs inside, one for XenServer and two mirrored(using Intel's fakeRAID and dmraid) for VMs and a user data(but now I think RAID didn't work). I tried to pass PCI card to VM using PCI-passthroug and I read somewhere that I need to recompile kernel with pciback module but something went wrong(I made mistake in /boot/extlinux.conf and server couldn't run) and I had to use LiveCD of GPartEd(I already had it on USB key) to correct this. But when I re-run the server all VDIs were gone. I have completly no idea what could go wrong. I tried to repair RAID using dmraid -R in the hope that everything will return to noramal but now I think this done more bad than good(and corrupted rest of LVM table...). Is there any possibility to recover this SR or only data from one(~100GB) of VDI? I also wants to apologise for my English, I'm not from English-speaking country and I'm only 16 years old, so I hadn't "time" to learn it(school isn't good place to do this) in sufficient way.

  Read the article

• Word2007 - Preventing mid-item line breaks in a list in a table

  - by Dan

  It's not programming, but it's the paperwork you have to fill out ot get things to program. When you have a list with an item that's two lines long, and text above pushes it down such that a page break should fall between the two lines, Word pushes the item down so that both lines are on the following page - this is called Widow/Orphan Control and is an option on the Paragraph menu. When the list is inside of a table cell, however, this feature doesn't seem to work - which is what I'm looking to work around. Word doesn't push the item down automatically, so it breaks across two pages, as seen here: Solutions that have been tried: Playing with the options on the Paragraph tab: doesn't seem to do anything Changing the margins or text: this is a template and will need to always work Any ideas?

  Read the article

• re-enabling a table for mysql replication

  - by jessieE

  We were able to setup mysql master-slave replication with the following version on both master/slave: mysqld Ver 5.5.28-29.1-log for Linux on x86_64 (Percona Server (GPL), Release 29.1) One day, we noticed that replication has stopped, we tried skipping over the entries that caused the replication errors. The errors persisted so we decided to skip replication for the 4 problematic tables. The slave has now caught up with the master except for the 4 tables. What is the best way to enable replication again for the 4 tables? This is what I have in mind but I don't know if it will work: 1) Modify slave config to enable replication again for the 4 tables 2) stop slave replication 3) for each of the 4 tables, use pt-table-sync --execute --verbose --print --sync-to-master h=localhost,D=mydb,t=mytable 4) restart slave database to reload replication configuration 5) start slave replication

  Read the article

• Use pt-table-sync to setup a new MySQL DB

  - by Generation D Systems

  I have 2 hosts (A and B). B contains a MySQL server with a database called mydb, and A contains a MySQL server with nothing (fresh install). I want to replicate the entire mydb from B to A, by running a script on A (I do not have shell access to B). Can I run this on A: pt-table-sync --execute h=b.mydomain.com,D=mydb h=a.mydomain.com I've read the docs but don't get a 100% comfort feeling (perhaps because of all the warnings about damaging your data if you don't know what you're doing). Will this work? as well, is h=a.mydomin.com necessary? (Will it route all traffic back in/out the local NIC?) can I use localhost or nothing at all?

  Read the article

• 'inode table usage' spiking every morning at 8am

  - by Harry Wood

  I installed munin on my ubuntu server. It's showing my 'inode table usage' spiking every morning at 8am. It then rapidly curves down and settles over the course of several hours. What might cause this? I thought it might be something running in /etc/cron.daily but this was set to run at 6a.m. and I've changed it to 4am. The spike remains at 8am. I also enabled cron logging, but can't see anything getting launched at 8a.m. It's a virtual server hosted by memset. Could it be caused by something happening on the virtual host?

  Read the article

• How to calculate CIDR notation from entries in a routing table

  - by febreezey

  I have some entries in a routing table that were created using longest prefix matching, and I have to use those entries to determine the a.b.c.d/x notation (CIDR). This is an example entry: 11001000 00010111 00010. That was calculated from the range 11001000 00010111 00010000 00000000 through 11001000 00010111 00010111 11111111. I know the range is from IP addresses 200.23.16.0 to 200.23.23.255, but getting the /x for the subnet # doesn't make sense to me. Anyone know how to properly go about calculating it?

  Read the article

• Error 2020: Got packet bigger than 'max_allowed_packet' bytes when dumping table

  - by Imagineer

  I'm getting the above mentioned error when backing up with ZRM, which is using mysqldump for backup. mysqldump --opt --extended-insert --single-transaction --create-options --default-character-set=utf8 --user=" " -p --all-databases "/nfs/backup/mysql01/dailyrun/20091216043001/backup.sql" mysqldump: Error 2020: Got packet bigger than 'max_allowed_packet' bytes when dumping table TICKET_ATTACHMENT at row: 2286 I have increased the size for 'max_allowed_packet' to be 1G in /etc/my.cnf which is the server setting and for the client side setting I've set it by running this command: mysql -u -p --max_allowed_packet=1G And I have verified that on the client and server side they are of the same value. This is to check the client side value according to this forum posting http://forums.mysql.com/read.php?35,75794,261640 mysql SELECT @@MAX_ALLOWED_PACKET - ; +----------------------+ | @@MAX_ALLOWED_PACKET | +----------------------+ | 1073741824 | +----------------------+ 1 row in set (0.00 sec) And this is the check the server value setting. mysql SHOW VARIABLES | max_allowed_packet | 1073741824 | I have ran out of ideas, and tried searching within expert exchange and googling for solutions but so far none has worked. Reference http://dev.mysql.com/doc/refman/5.1/en/packet-too-large.html Anyone please advise, thank you.

  Read the article

• Trouble upgrading OS X, because HD doesn't use GUID Partition Table Scheme

  - by Erik Vold

  So I have a MacBook with Mac OS X 10.5 and I'm trying to upgrade to 10.6, but when I run the upgrade 'install' I quickly get to a page where I am supposed to 'Select the disk where you want to install Mac OS X' and there is only the one hard drive, so it is auto selected, and below that I see a warning message and the only button available is the 'Go Back' button. The warning message says: "Macintosh HD" can't be used because it doesn't use the GUID Partition Table scheme. Use Disk Utility to change the partition scheme. Select the disk, choose the Partition tab, select the Volume Scheme and then click Options. So I followed the above instructions, and I got to the last step, where I'm supposed to click the 'Options' button, the problem is that I cannot click that button, it is disabled.. So what am I supposed to do?

  Read the article

• Listing the routing table takes long time to complete

  - by Rafal Rawicki

  When I print routes defined on my computer using route, it takes about 5 to 20 seconds to complete. Why does it take so much time? With VPN enabled: $ time sudo route Kernel IP routing table (...) real 0m21.423s user 0m0.000s sys 0m0.012s With no VPN, this is about 5 seconds - still, computer can do a lot in this time. I've repeated my measurements few times, getting very similar results each try. My machine is Ubuntu with 3.0.0 kernel, but as far as I know, route on the other computers works the same way.

  Read the article

• GUID Partition Table & Linux

  - by Zac

  (1) Is it true that the new GUID Partition Table scheme allows a user to partition a drive however he/she like, outside of the traditional MBR "4 primaries or 3 primaries + 1 extension" paradigm? If so, are there any limitations to the GPT? If my assumption is wrong, what are its advantages over the MBR model? (2) I'm getting a new laptop this week and will be installing Ubuntu (and, more generally, Linux) for the first time ever. Does Ubunutu come pre-configured with MBR as a default? If so, how do I get Ubuntu w/ GPT? If not, how do I specify GPT over MBR? Thanks!

  Read the article

• Packets marked by iptables only sent to the correct routing table sometimes

  - by cookiecaper

  I am trying to route packets generated by a specific user out over a VPN. I have this configuration: $ sudo iptables -S -t nat -P PREROUTING ACCEPT -P OUTPUT ACCEPT -P POSTROUTING ACCEPT -A POSTROUTING -o tun0 -j MASQUERADE $ sudo iptables -S -t mangle -P PREROUTING ACCEPT -P INPUT ACCEPT -P FORWARD ACCEPT -P OUTPUT ACCEPT -P POSTROUTING ACCEPT -A OUTPUT -m owner --uid-owner guy -j MARK --set-xmark 0xb/0xffffffff $ sudo ip rule show 0: from all lookup local 32765: from all fwmark 0xb lookup 11 32766: from all lookup main 32767: from all lookup default $ sudo ip route show table 11 10.8.0.5 dev tun0 proto kernel scope link src 10.8.0.6 10.8.0.6 dev tun0 scope link 10.8.0.1 via 10.8.0.5 dev tun0 0.0.0.0/1 via 10.8.0.5 dev tun0 $ sudo iptables -S -t raw -P PREROUTING ACCEPT -P OUTPUT ACCEPT -A OUTPUT -m owner --uid-owner guy -j TRACE -A OUTPUT -p tcp -m tcp --dport 80 -j TRACE It seems that some sites work fine and use the VPN, but others don't and fall back to the normal interface. This is bad. This is a packet trace that used VPN: Oct 27 00:24:28 agent kernel: [612979.976052] TRACE: raw:OUTPUT:rule:2 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 Oct 27 00:24:28 agent kernel: [612979.976105] TRACE: raw:OUTPUT:policy:3 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 Oct 27 00:24:28 agent kernel: [612979.976164] TRACE: mangle:OUTPUT:rule:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 Oct 27 00:24:28 agent kernel: [612979.976210] TRACE: mangle:OUTPUT:policy:2 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:24:28 agent kernel: [612979.976269] TRACE: nat:OUTPUT:policy:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:24:28 agent kernel: [612979.976320] TRACE: filter:OUTPUT:policy:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:24:28 agent kernel: [612979.976367] TRACE: mangle:POSTROUTING:policy:1 IN= OUT=tun0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:24:28 agent kernel: [612979.976414] TRACE: nat:POSTROUTING:rule:1 IN= OUT=tun0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 MARK=0xb and this is one that didn't: Oct 27 00:22:41 agent kernel: [612873.662559] TRACE: raw:OUTPUT:rule:2 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 Oct 27 00:22:41 agent kernel: [612873.662609] TRACE: raw:OUTPUT:policy:3 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 Oct 27 00:22:41 agent kernel: [612873.662664] TRACE: mangle:OUTPUT:rule:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 Oct 27 00:22:41 agent kernel: [612873.662709] TRACE: mangle:OUTPUT:policy:2 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:22:41 agent kernel: [612873.662761] TRACE: nat:OUTPUT:policy:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:22:41 agent kernel: [612873.662808] TRACE: filter:OUTPUT:policy:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:22:41 agent kernel: [612873.662855] TRACE: mangle:POSTROUTING:policy:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 MARK=0xb I have already tried "ip route flush cache", to no avail. I do not know why the first packet goes through the correct routing table, and the second doesn't. Both are marked. Once again, I do not want ALL packets system-wide to go through the VPN, I only want packets from a specific user (UID=999) to go through the VPN. I am testing ipchicken.com and walmart.com via links, from the same user, same shell. walmart.com appears to use the VPN; ipchicken.com does not. Any help appreciated. Will send 0.5 bitcoins to answerer who makes this fixed.

  Read the article

• Routing table change to access Internet over mifi

  - by Randall Blake

  I have two networks at home. One uses a Verizon mifi wireless on 192.168.1.1. The other uses a dlink router on 192.168.0.1. I have one laptop with two nics, one wireless and one not. The wireless nic connects to the mifi. The Ethernet nic connects to the dlink router. It's ip is 192.168.0.2. I also have a laptop with only one nic connected to the dlink on 192.168.0.3. I want to connect laptop 2 to the Internet. Can I do that by adding an entry to the routing table so that destination 0.0.0.0 routes to 192.168.0.2? If I do that, will laptop 1 "know" that it should route traffic from 192.168.0.3 to 192.168.1.1? Thanks for any assistance.

  Read the article

• Excel 2007: Filtering out rows in a table based on a list

  - by Sam Johnson

  I have a large table that looks like this: ID String 1 abcde 2 defgh 3 defgh 4 defgh 5 ijkl 6 ijkl 7 mnop 8 qrst I want to selectivley hide rows by populating a list of filterd values. For example, I'd like to filter out (hide) all rows that contain 'ef', 'kl', and 'qr'. Is there an easy way to do this? I know how to use Advanced filters to include only the rows that contain those substrings, but not the inverse. Has anyone does this before?

  Read the article

• mysql error code 13 on windows xampp caused by lower case table names = 0

  - by user127379

  I can import an sql (from test linux server mysql) file if the lower case setting is removed. But then the table names are lower case and the web site doesn't work. Originally it was working (my.ini with the lower case settings), I then exported to a linux server, it was working there. Now importing back to my windows (xampp setup) fails. After wild goose chase looking at disks and permissions, I found that if I remove the lower_case_table_names=0, the import works! But I need the case sensitive command so that I can deploy on the linux server.

  Read the article

• SQL-Server 2008 : Table Insert and Range Check ?

  - by LB .

  I'm using the Table Value constructor to insert a bunch of rows at a time. However if i'm using sql replication, I run into a range check constraint on the publisher on my id column managed automatically. The reason is the fact that the id range doesn't seem to be increased during an insert of several values, meaning that the max id is reached before the actual range expansion could occur (or the id threshold). It looks like this problem for which the solution is either running the merge agent or run the sp_adjustpublisheridentityrange stored procedure. I'm litteraly doing something like : INSERT INTO dbo.MyProducts (Name, ListPrice) VALUES ('Helmet', 25.50), ('Wheel', 30.00), ((SELECT Name FROM Production.Product WHERE ProductID = 720), (SELECT ListPrice FROM Production.Product WHERE ProductID = 720)); GO What are my options (if I don't want or can't adopt any of the proposed solution) ? Expand the range ? Decrease the threshold ? Can I programmatically modify my request to circumvent this problem ? thanks.

  Read the article

• MS Word showing unwanted table borders on screen (but not on print preview)

  - by Jivlain

  I have a MS Word document with a number of tables. The other day when I created it, the tables all had no borders. Today, I opened it up to find that the tables did have borders. However, when I check the border properties on each table, it says that there are no borders. The tables are displayed with cell borders in all view modes except for the reading layout, and they do not show up on print preview. As this document is going to generally be for on-screen viewing, I need to get rid of the borders. How can I accomplish this? (this is a MS Word 2003 *.doc document, in MS Word 2003, which has been the only editor involved.)

  Read the article

• Filling up bounded form with information from another table while creating new record

  - by amir shadaab

  I have an excel sheet with information about each employee. I keep getting new updated spreadsheet every month. I have to create a database managing cases related to the employees. I have a database and the bounded form already created for the cases which also contain emp info fields. What I am trying to do is to only type in the emp id in the form and want the form to look up in the spreadsheet(which can be a table in the cases db) and populate other fields in the form and that information can go into the cases db. Can this be done?

  Read the article

• Hiding a directory through the FAT table

  - by hennobal

  I've looked into the FAT file system, trying to find a way to make a directory hidden from view of the user. This has been done with malware previously, so it should be possible. The SpyEye trojan hid inside a directory C:\cleansweep.exe\ which was only reachable through the command line. I know deletion is possible by substituting the first character of the directory in the FAT table with 0xE5, but then it will not be accessible. Any ideas on how the scenario from SpyEye can be recreated? Any filesystem is interesting, but ideally FAT or NTFS.

  Read the article

• Some strange things in the db table of mysql database

  - by 0al0

  I noticed some weird things in the db table of mysql database in a client's server, after having the Mysql service stopping for no reason what are the test, and test_% entries? Why are there two entries for the database AQUA? Why is there a entry with a blank name? Should I worry about any of those? What should I do for each specific case? Is it safe to just delete the ones that should not be there, after backing up?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

< Previous Page | 81 82 83 84 85 86 87 88 89 90 91 92  | Next Page >