Search Results

Search found 428 results on 18 pages for 'delimited'.

Page 9/18 | < Previous Page | 5 6 7 8 9 10 11 12 13 14 15 16  | Next Page >

  • What is the DNS root zone and domain?

    - by Nimmy Lebby
    This might seem like a silly question but I want to get my terminology correct. Please do not delete. I will be more than happy to delete the question myself once I (with the help of a few people I hope) get to a consensus: This was my understanding: DNS root zone = . DNS root domain = (nameless) However, after reading the Wikipedia article, I'm not so sure: A domain name consists of one or more parts, technically called labels, that are conventionally concatenated, and delimited by dots, such as example.com. So this would lead me to believe: DNS root zone = . DNS root domain = . DNS root label = (nameless) Does this make sense? What is your understanding?

    Read the article

  • Migrating data from Oracle database to Pervasive .DAT files

    - by kaychaks
    The requirement is to migrate some tables with data from a Oracle database server to Pervasive database's .DAT file. Then those .DAT files will be used by a Pervasive database server. The restriction is that Oracle DB can not directly migrate to the Pervasive DB. It has to generate the .DAT files and then the new .DAT files will replace the old one for the Pervasive DB which will then use them for the new data. I was trying this task with SSIS. Exporting the Oracle table to a delimited .txt file and then creating a .DAT file from that text file. I can export the data from Oracle to .txt but I am not finding any way to migrate .txt to Pervasive .DAT? Is this the right approach? If not then please help with my problem.

    Read the article

  • How do I execute find with GNU xargs to traverse a set of directories?

    - by wilhelmtell
    $ echo {a,b,c}.h d e.h |xargs -IA find A -name '*.h' find: `a.h b.h c.h d e.h': No such file or directory $ echo -e a.h\\nb.h c.h d e.h |xargs -IA find A -name '*.h' a.h find: `b.h c.h d e.h': No such file or directory The problem is that -I implies xargs will assume arguments are delimited by newline. I'm not sure why that is. I reckon I can solve this problem with sed, but I wonder if there's an xargs trick or idiom I'm not familiar with that people use to solve this. I'm looking for a solution that will also work on OS X. On OS X the xargs -J switch seems to work fine. The manpage claims this switch will just control where the arguments are placed for the executable -- which is exactly what I want.

    Read the article

  • Need to create street maps images with route plotted from address 1 to address 2

    - by daustin777
    I'm looking for software to create street map images that show the route from address 1 to address 2. It needs to be able to create the map images from either a database file that contains the addresses, a delimited text file that lists the addresses to route in each row, or an Excel file. I need to do this to create custom maps in bulk- 500 to 20,000 quantity from the data file. The purpose is to provide a map with a route from a location (address 1) to a retail store (address 2). The maps will be printed on a postcard. I have the data. I just need the mapping software. Is there software available that can do this?

    Read the article

  • Excel 2007: Exporting more than 100 columns to a .prn file but data is concatenated

    - by Don1
    I want to export an Excel worksheet to a space delimited (.prn) file. The worksheet is pretty big (187 columns) and when I set the column widths and try to export the worksheet to a .prn file, the data gets cut at the 98th column (i.e. about 200 characters wide for my data) and the rest is placed directly underneath. It's like I ripped a page in half from top to bottom and placed the right-hand side directly under the left-hand side. How would I get it to export everything without getting concatenated?

    Read the article

  • How to columnate text with tabs (in vim or on the shell)

    - by kine
    I have a frequent need to manually manipulate tab-delimited text for data entry and other purposes, and when i do this it helps if the text is aligned properly into columns. For example (assuming 4-space tabs): # original format abcdefghijklmnop field2 abcdefgh field2 abcdefghijkl field2 # ideal format abcdefghijklmnop field2 abcdefgh field2 abcdefghijkl field2 I am very familiar with using the column utility to columnate text this way, but the problem is that it uses spaces to align the columns, and i specifically need tabs. This requirement also appears to rule out the Tabularize plug-in. Is there any way that i can columnate text with tabs specifically, either within vim or at the shell? It looks like i might be able to do it with groff/tbl, but honestly i'd rather columnate it by hand than mess with that....

    Read the article

  • Excel - Disable AutoFormatting on Import

    - by Philip Wales
    How can I stop Microsoft Excel from auto formatting data when imported from a text file? Specifically, I want it to treat all of the values as text. I am auditing insurance data in excel before it is uploaded to the new database. The files come to me as tab delimited text files. When loaded, Excel auto-formats the data causing leading 0's on Zip Codes, Routing Numbers and other codes, to be chopped off. I don't have the patience to reformat all of the columns as text and guess how many zeros need to be replaced. Nor do I want to click through the import wizard an specify that each column is text. Ideally I just want to turn off Excel's Auto-Formatting completely, and just edit every cell as it were plain text. I don't do any formula's or charts, just grid plain text editing.

    Read the article

  • rename multiple files with unique name

    - by psaima
    I have a tab-delimited list of hundreds of names in the following format old_name new_name apple orange yellow blue All of my files have unique names and end with *.txt extension and these are in the same directory. I want to write a script that will rename the files by reading my list. So apple.txt should be renamed as orange.txt. I have searched around but I couldn't find a quick way to do this.I can change one file at a time with 'rename' or using perl "perl -p -i -e ’s///g’ *.txt", and few files with sed, but I don't know how I can use my list as input and write a shell script to make the changes for all files in a directory. I don't want to write hundreds of rename command for all files in a shell script. Any suggestions will be most welcome!

    Read the article

  • How can I do a bulk caller ID lookup (reverse phone lookup) on a list of phone numbers?

    - by rob
    I have a tab-delimited text file with all of the phone numbers I've called or received calls from in the past year. The phone numbers are all based in the US, so the format is ###-###-####. For tax purposes, I need to know which calls were personal and which ones were business-related. I could enter them all one-by-one into Google, but that will take forever because there are hundreds of numbers to check. Is there a program, MS Office plugin, or website that I can use to look up all of the numbers at once? If not, is there some way to create an Excel macro to do the lookups for me?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Failed to Install Xdebug

    - by burnt1ce
    've registered xdebug in php.ini (as per http://xdebug.org/docs/install) but it's not showing up when i run "php -m" or when i get a test page to run "phpinfo()". I've just installed the latest version of XAMPP. I've used both "zend_extention" and "zend_extention_ts" to specify the path of the xdebug dll. I ensured that my apache server restarted and used the latest change of my php.ini by executing "httpd -k restart". Can anyone provide any suggestions in getting xdebug to show up? Here are the contents of my php.ini file. [PHP] ;;;;;;;;;;;;;;;;;;; ; About php.ini ; ;;;;;;;;;;;;;;;;;;; ; PHP's initialization file, generally called php.ini, is responsible for ; configuring many of the aspects of PHP's behavior. ; PHP attempts to find and load this configuration from a number of locations. ; The following is a summary of its search order: ; 1. SAPI module specific location. ; 2. The PHPRC environment variable. (As of PHP 5.2.0) ; 3. A number of predefined registry keys on Windows (As of PHP 5.2.0) ; 4. Current working directory (except CLI) ; 5. The web server's directory (for SAPI modules), or directory of PHP ; (otherwise in Windows) ; 6. The directory from the --with-config-file-path compile time option, or the ; Windows directory (C:\windows or C:\winnt) ; See the PHP docs for more specific information. ; http://php.net/configuration.file ; The syntax of the file is extremely simple. Whitespace and Lines ; beginning with a semicolon are silently ignored (as you probably guessed). ; Section headers (e.g. [Foo]) are also silently ignored, even though ; they might mean something in the future. ; Directives following the section heading [PATH=/www/mysite] only ; apply to PHP files in the /www/mysite directory. Directives ; following the section heading [HOST=www.example.com] only apply to ; PHP files served from www.example.com. Directives set in these ; special sections cannot be overridden by user-defined INI files or ; at runtime. Currently, [PATH=] and [HOST=] sections only work under ; CGI/FastCGI. ; http://php.net/ini.sections ; Directives are specified using the following syntax: ; directive = value ; Directive names are *case sensitive* - foo=bar is different from FOO=bar. ; Directives are variables used to configure PHP or PHP extensions. ; There is no name validation. If PHP can't find an expected ; directive because it is not set or is mistyped, a default value will be used. ; The value can be a string, a number, a PHP constant (e.g. E_ALL or M_PI), one ; of the INI constants (On, Off, True, False, Yes, No and None) or an expression ; (e.g. E_ALL & ~E_NOTICE), a quoted string ("bar"), or a reference to a ; previously set variable or directive (e.g. ${foo}) ; Expressions in the INI file are limited to bitwise operators and parentheses: ; | bitwise OR ; ^ bitwise XOR ; & bitwise AND ; ~ bitwise NOT ; ! boolean NOT ; Boolean flags can be turned on using the values 1, On, True or Yes. ; They can be turned off using the values 0, Off, False or No. ; An empty string can be denoted by simply not writing anything after the equal ; sign, or by using the None keyword: ; foo = ; sets foo to an empty string ; foo = None ; sets foo to an empty string ; foo = "None" ; sets foo to the string 'None' ; If you use constants in your value, and these constants belong to a ; dynamically loaded extension (either a PHP extension or a Zend extension), ; you may only use these constants *after* the line that loads the extension. ;;;;;;;;;;;;;;;;;;; ; About this file ; ;;;;;;;;;;;;;;;;;;; ; PHP comes packaged with two INI files. One that is recommended to be used ; in production environments and one that is recommended to be used in ; development environments. ; php.ini-production contains settings which hold security, performance and ; best practices at its core. But please be aware, these settings may break ; compatibility with older or less security conscience applications. We ; recommending using the production ini in production and testing environments. ; php.ini-development is very similar to its production variant, except it's ; much more verbose when it comes to errors. We recommending using the ; development version only in development environments as errors shown to ; application users can inadvertently leak otherwise secure information. ;;;;;;;;;;;;;;;;;;; ; Quick Reference ; ;;;;;;;;;;;;;;;;;;; ; The following are all the settings which are different in either the production ; or development versions of the INIs with respect to PHP's default behavior. ; Please see the actual settings later in the document for more details as to why ; we recommend these changes in PHP's behavior. ; allow_call_time_pass_reference ; Default Value: On ; Development Value: Off ; Production Value: Off ; display_errors ; Default Value: On ; Development Value: On ; Production Value: Off ; display_startup_errors ; Default Value: Off ; Development Value: On ; Production Value: Off ; error_reporting ; Default Value: E_ALL & ~E_NOTICE ; Development Value: E_ALL | E_STRICT ; Production Value: E_ALL & ~E_DEPRECATED ; html_errors ; Default Value: On ; Development Value: On ; Production value: Off ; log_errors ; Default Value: Off ; Development Value: On ; Production Value: On ; magic_quotes_gpc ; Default Value: On ; Development Value: Off ; Production Value: Off ; max_input_time ; Default Value: -1 (Unlimited) ; Development Value: 60 (60 seconds) ; Production Value: 60 (60 seconds) ; output_buffering ; Default Value: Off ; Development Value: 4096 ; Production Value: 4096 ; register_argc_argv ; Default Value: On ; Development Value: Off ; Production Value: Off ; register_long_arrays ; Default Value: On ; Development Value: Off ; Production Value: Off ; request_order ; Default Value: None ; Development Value: "GP" ; Production Value: "GP" ; session.bug_compat_42 ; Default Value: On ; Development Value: On ; Production Value: Off ; session.bug_compat_warn ; Default Value: On ; Development Value: On ; Production Value: Off ; session.gc_divisor ; Default Value: 100 ; Development Value: 1000 ; Production Value: 1000 ; session.hash_bits_per_character ; Default Value: 4 ; Development Value: 5 ; Production Value: 5 ; short_open_tag ; Default Value: On ; Development Value: Off ; Production Value: Off ; track_errors ; Default Value: Off ; Development Value: On ; Production Value: Off ; url_rewriter.tags ; Default Value: "a=href,area=href,frame=src,form=,fieldset=" ; Development Value: "a=href,area=href,frame=src,input=src,form=fakeentry" ; Production Value: "a=href,area=href,frame=src,input=src,form=fakeentry" ; variables_order ; Default Value: "EGPCS" ; Development Value: "GPCS" ; Production Value: "GPCS" ;;;;;;;;;;;;;;;;;;;; ; php.ini Options ; ;;;;;;;;;;;;;;;;;;;; ; Name for user-defined php.ini (.htaccess) files. Default is ".user.ini" ;user_ini.filename = ".user.ini" ; To disable this feature set this option to empty value ;user_ini.filename = ; TTL for user-defined php.ini files (time-to-live) in seconds. Default is 300 seconds (5 minutes) ;user_ini.cache_ttl = 300 ;;;;;;;;;;;;;;;;;;;; ; Language Options ; ;;;;;;;;;;;;;;;;;;;; ; Enable the PHP scripting language engine under Apache. ; http://php.net/engine engine = On ; This directive determines whether or not PHP will recognize code between ; <? and ?> tags as PHP source which should be processed as such. It's been ; recommended for several years that you not use the short tag "short cut" and ; instead to use the full <?php and ?> tag combination. With the wide spread use ; of XML and use of these tags by other languages, the server can become easily ; confused and end up parsing the wrong code in the wrong context. But because ; this short cut has been a feature for such a long time, it's currently still ; supported for backwards compatibility, but we recommend you don't use them. ; Default Value: On ; Development Value: Off ; Production Value: Off ; http://php.net/short-open-tag short_open_tag = Off ; Allow ASP-style <% %> tags. ; http://php.net/asp-tags asp_tags = Off ; The number of significant digits displayed in floating point numbers. ; http://php.net/precision precision = 14 ; Enforce year 2000 compliance (will cause problems with non-compliant browsers) ; http://php.net/y2k-compliance y2k_compliance = On ; Output buffering is a mechanism for controlling how much output data ; (excluding headers and cookies) PHP should keep internally before pushing that ; data to the client. If your application's output exceeds this setting, PHP ; will send that data in chunks of roughly the size you specify. ; Turning on this setting and managing its maximum buffer size can yield some ; interesting side-effects depending on your application and web server. ; You may be able to send headers and cookies after you've already sent output ; through print or echo. You also may see performance benefits if your server is ; emitting less packets due to buffered output versus PHP streaming the output ; as it gets it. On production servers, 4096 bytes is a good setting for performance ; reasons. ; Note: Output buffering can also be controlled via Output Buffering Control ; functions. ; Possible Values: ; On = Enabled and buffer is unlimited. (Use with caution) ; Off = Disabled ; Integer = Enables the buffer and sets its maximum size in bytes. ; Note: This directive is hardcoded to Off for the CLI SAPI ; Default Value: Off ; Development Value: 4096 ; Production Value: 4096 ; http://php.net/output-buffering output_buffering = Off ; You can redirect all of the output of your scripts to a function. For ; example, if you set output_handler to "mb_output_handler", character ; encoding will be transparently converted to the specified encoding. ; Setting any output handler automatically turns on output buffering. ; Note: People who wrote portable scripts should not depend on this ini ; directive. Instead, explicitly set the output handler using ob_start(). ; Using this ini directive may cause problems unless you know what script ; is doing. ; Note: You cannot use both "mb_output_handler" with "ob_iconv_handler" ; and you cannot use both "ob_gzhandler" and "zlib.output_compression". ; Note: output_handler must be empty if this is set 'On' !!!! ; Instead you must use zlib.output_handler. ; http://php.net/output-handler ;output_handler = ; Transparent output compression using the zlib library ; Valid values for this option are 'off', 'on', or a specific buffer size ; to be used for compression (default is 4KB) ; Note: Resulting chunk size may vary due to nature of compression. PHP ; outputs chunks that are few hundreds bytes each as a result of ; compression. If you prefer a larger chunk size for better ; performance, enable output_buffering in addition. ; Note: You need to use zlib.output_handler instead of the standard ; output_handler, or otherwise the output will be corrupted. ; http://php.net/zlib.output-compression zlib.output_compression = Off ; http://php.net/zlib.output-compression-level ;zlib.output_compression_level = -1 ; You cannot specify additional output handlers if zlib.output_compression ; is activated here. This setting does the same as output_handler but in ; a different order. ; http://php.net/zlib.output-handler ;zlib.output_handler = ; Implicit flush tells PHP to tell the output layer to flush itself ; automatically after every output block. This is equivalent to calling the ; PHP function flush() after each and every call to print() or echo() and each ; and every HTML block. Turning this option on has serious performance ; implications and is generally recommended for debugging purposes only. ; http://php.net/implicit-flush ; Note: This directive is hardcoded to On for the CLI SAPI implicit_flush = Off ; The unserialize callback function will be called (with the undefined class' ; name as parameter), if the unserializer finds an undefined class ; which should be instantiated. A warning appears if the specified function is ; not defined, or if the function doesn't include/implement the missing class. ; So only set this entry, if you really want to implement such a ; callback-function. unserialize_callback_func = ; When floats & doubles are serialized store serialize_precision significant ; digits after the floating point. The default value ensures that when floats ; are decoded with unserialize, the data will remain the same. serialize_precision = 100 ; This directive allows you to enable and disable warnings which PHP will issue ; if you pass a value by reference at function call time. Passing values by ; reference at function call time is a deprecated feature which will be removed ; from PHP at some point in the near future. The acceptable method for passing a ; value by reference to a function is by declaring the reference in the functions ; definition, not at call time. This directive does not disable this feature, it ; only determines whether PHP will warn you about it or not. These warnings ; should enabled in development environments only. ; Default Value: On (Suppress warnings) ; Development Value: Off (Issue warnings) ; Production Value: Off (Issue warnings) ; http://php.net/allow-call-time-pass-reference allow_call_time_pass_reference = On ; Safe Mode ; http://php.net/safe-mode safe_mode = Off ; By default, Safe Mode does a UID compare check when ; opening files. If you want to relax this to a GID compare, ; then turn on safe_mode_gid. ; http://php.net/safe-mode-gid safe_mode_gid = Off ; When safe_mode is on, UID/GID checks are bypassed when ; including files from this directory and its subdirectories. ; (directory must also be in include_path or full path must ; be used when including) ; http://php.net/safe-mode-include-dir safe_mode_include_dir = ; When safe_mode is on, only executables located in the safe_mode_exec_dir ; will be allowed to be executed via the exec family of functions. ; http://php.net/safe-mode-exec-dir safe_mode_exec_dir = ; Setting certain environment variables may be a potential security breach. ; This directive contains a comma-delimited list of prefixes. In Safe Mode, ; the user may only alter environment variables whose names begin with the ; prefixes supplied here. By default, users will only be able to set ; environment variables that begin with PHP_ (e.g. PHP_FOO=BAR). ; Note: If this directive is empty, PHP will let the user modify ANY ; environment variable! ; http://php.net/safe-mode-allowed-env-vars safe_mode_allowed_env_vars = PHP_ ; This directive contains a comma-delimited list of environment variables that ; the end user won't be able to change using putenv(). These variables will be ; protected even if safe_mode_allowed_env_vars is set to allow to change them. ; http://php.net/safe-mode-protected-env-vars safe_mode_protected_env_vars = LD_LIBRARY_PATH ; open_basedir, if set, limits all file operations to the defined directory ; and below. This directive makes most sense if used in a per-directory ; or per-virtualhost web server configuration file. This directive is ; *NOT* affected by whether Safe Mode is turned On or Off. ; http://php.net/open-basedir ;open_basedir = ; This directive allows you to disable certain functions for security reasons. ; It receives a comma-delimited list of function names. This directive is ; *NOT* affected by whether Safe Mode is turned On or Off. ; http://php.net/disable-functions disable_functions = ; This directive allows you to disable certain classes for security reasons. ; It receives a comma-delimited list of class names. This directive is ; *NOT* affected by whether Safe Mode is turned On or Off. ; http://php.net/disable-classes disable_classes = ; Colors for Syntax Highlighting mode. Anything that's acceptable in ; <span style="color: ???????"> would work. ; http://php.net/syntax-highlighting ;highlight.string = #DD0000 ;highlight.comment = #FF9900 ;highlight.keyword = #007700 ;highlight.bg = #FFFFFF ;highlight.default = #0000BB ;highlight.html = #000000 ; If enabled, the request will be allowed to complete even if the user aborts ; the request. Consider enabling it if executing long requests, which may end up ; being interrupted by the user or a browser timing out. PHP's default behavior ; is to disable this feature. ; http://php.net/ignore-user-abort ;ignore_user_abort = On ; Determines the size of the realpath cache to be used by PHP. This value should ; be increased on systems where PHP opens many files to reflect the quantity of ; the file operations performed. ; http://php.net/realpath-cache-size ;realpath_cache_size = 16k ; Duration of time, in seconds for which to cache realpath information for a given ; file or directory. For systems with rarely changing files, consider increasing this ; value. ; http://php.net/realpath-cache-ttl ;realpath_cache_ttl = 120 ;;;;;;;;;;;;;;;;; ; Miscellaneous ; ;;;;;;;;;;;;;;;;; ; Decides whether PHP may expose the fact that it is installed on the server ; (e.g. by adding its signature to the Web server header). It is no security ; threat in any way, but it makes it possible to determine whether you use PHP ; on your server or not. ; http://php.net/expose-php expose_php = On ;;;;;;;;;;;;;;;;;;; ; Resource Limits ; ;;;;;;;;;;;;;;;;;;; ; Maximum execution time of each script, in seconds ; http://php.net/max-execution-time ; Note: This directive is hardcoded to 0 for the CLI SAPI max_execution_time = 60 ; Maximum amount of time each script may spend parsing request data. It's a good ; idea to limit this time on productions servers in order to eliminate unexpectedly ; long running scripts. ; Note: This directive is hardcoded to -1 for the CLI SAPI ; Default Value: -1 (Unlimited) ; Development Value: 60 (60 seconds) ; Production Value: 60 (60 seconds) ; http://php.net/max-input-time max_input_time = 60 ; Maximum input variable nesting level ; http://php.net/max-input-nesting-level ;max_input_nesting_level = 64 ; Maximum amount of memory a script may consume (128MB) ; http://php.net/memory-limit memory_limit = 128M ;;;;;;;;;;;;;;;;;;;;;;;;;;;;;; ; Error handling and logging ; ;;;;;;;;;;;;;;;;;;;;;;;;;;;;;; ; This directive informs PHP of which errors, warnings and notices you would like ; it to take action for. The recommended way of setting values for this ; directive is through the use of the error level constants and bitwise ; operators. The error level constants are below here for convenience as well as ; some common settings and their meanings. ; By default, PHP is set to take action on all errors, notices and warnings EXCEPT ; those related to E_NOTICE and E_STRICT, which together cover best practices and ; recommended coding standards in PHP. For performance reasons, this is the ; recommend error reporting setting. Your production server shouldn't be wasting ; resources complaining about best practices and coding standards. That's what ; development servers and development settings are for. ; Note: The php.ini-development file has this setting as E_ALL | E_STRICT. This ; means it pretty much reports everything which is exactly what you want during ; development and early testing. ; ; Error Level Constants: ; E_ALL - All errors and warnings (includes E_STRICT as of PHP 6.0.0) ; E_ERROR - fatal run-time errors ; E_RECOVERABLE_ERROR - almost fatal run-time errors ; E_WARNING - run-time warnings (non-fatal errors) ; E_PARSE - compile-time parse errors ; E_NOTICE - run-time notices (these are warnings which often result ; from a bug in your code, but it's possible that it was ; intentional (e.g., using an uninitialized variable and ; relying on the fact it's automatically initialized to an ; empty string) ; E_STRICT - run-time notices, enable to have PHP suggest changes ; to your code which will ensure the best interoperability ; and forward compatibility of your code ; E_CORE_ERROR - fatal errors that occur during PHP's initial startup ; E_CORE_WARNING - warnings (non-fatal errors) that occur during PHP's ; initial startup ; E_COMPILE_ERROR - fatal compile-time errors ; E_COMPILE_WARNING - compile-time warnings (non-fatal errors) ; E_USER_ERROR - user-generated error message ; E_USER_WARNING - user-generated warning message ; E_USER_NOTICE - user-generated notice message ; E_DEPRECATED - warn about code that will not work in future versions ; of PHP ; E_USER_DEPRECATED - user-generated deprecation warnings ; ; Common Values: ; E_ALL & ~E_NOTICE (Show all errors, except for notices and coding standards warnings.) ; E_ALL & ~E_NOTICE | E_STRICT (Show all errors, except for notices) ; E_COMPILE_ERROR|E_RECOVERABLE_ERROR|E_ERROR|E_CORE_ERROR (Show only errors) ; E_ALL | E_STRICT (Show all errors, warnings and notices including coding standards.) ; Default Value: E_ALL & ~E_NOTICE ; Development Value: E_ALL | E_STRICT ; Production Value: E_ALL & ~E_DEPRECATED ; http://php.net/error-reporting error_reporting = E_ALL & ~E_NOTICE & ~E_DEPRECATED ; This directive controls whether or not and where PHP will output errors, ; notices and warnings too. Error output is very useful during development, but ; it could be very dangerous in production environments. Depending on the code ; which is triggering the error, sensitive information could potentially leak ; out of your application such as database usernames and passwords or worse. ; It's recommended that errors be logged on production servers rather than ; having the errors sent to STDOUT. ; Possible Values: ; Off = Do not display any errors ; stderr = Display errors to STDERR (affects only CGI/CLI binaries!) ; On or stdout = Display errors to STDOUT ; Default Value: On ; Development Value: On ; Production Value: Off ; http://php.net/display-errors display_errors = On ; The display of errors which occur during PHP's startup sequence are handled ; separately from display_errors. PHP's default behavior is to suppress those ; errors from clients. Turning the display of startup errors on can be useful in ; debugging configuration problems. But, it's strongly recommended that you ; leave this setting off on production servers. ; Default Value: Off ; Development Value: On ; Production Value: Off ; http://php.net/display-startup-errors display_startup_errors = On ; Besides displaying errors, PHP can also log errors to locations such as a ; server-specific log, STDERR, or a location specified by the error_log ; directive found below. While errors should not be displayed on productions ; servers they should still be monitored and logging is a great way to do that. ; Default Value: Off ; Development Value: On ; Production Value: On ; http://php.net/log-errors log_errors = Off ; Set maximum length of log_errors. In error_log information about the source is ; added. The default is 1024 and 0 allows to not apply any maximum length at all. ; http://php.net/log-errors-max-len log_errors_max_len = 1024 ; Do not log repeated messages. Repeated errors must occur in same file on same ; line unless ignore_repeated_source is set true. ; http://php.net/ignore-repeated-errors ignore_repeated_errors = Off ; Ignore source of message when ignoring repeated messages. When this setting ; is On you will not log errors with repeated messages from different files or ; source lines. ; http://php.net/ignore-repeated-source ignore_repeated_source = Off ; If this parameter is set to Off, then memory leaks will not be shown (on ; stdout or in the log). This has only effect in a debug compile, and if ; error reporting includes E_WARNING in the allowed list ; http://php.net/report-memleaks report_memleaks = On ; This setting is on by default. ;report_zend_debug = 0 ; Store the last error/warning message in $php_errormsg (boolean). Setting this value ; to On can assist in debugging and is appropriate for development servers. It should ; however be disabled on production servers. ; Default Value: Off ; Development Value: On ; Production Value: Off ; http://php.net/track-errors track_errors = Off ; Turn off normal error reporting and emit XML-RPC error XML ; http://php.net/xmlrpc-errors ;xmlrpc_errors = 0 ; An XML-RPC faultCode ;xmlrpc_error_number = 0 ; When PHP displays or logs an error, it has the capability of inserting html ; links to documentation related to that error. This directive controls whether ; those HTML links appear in error messages or not. For performance and security ; reasons, it's recommended you disable this on production servers. ; Note: This directive is hardcoded to Off for the CLI SAPI ; Default Value: On ; Development Value: On ; Production value: Off ; http://php.net/html-errors html_errors = On ; If html_errors is set On PHP produces clickable error messages that direct ; to a page describing the error or function causing the error in detail. ; You can download a copy of the PHP manual from http://php.net/docs ; and change docref_root to the base URL of your local copy including the ; leading '/'. You must also specify the file extension being used including ; the dot. PHP's default behavior is to leave these settings empty. ; Note: Never use this feature for production boxes. ; http://php.net/docref-root ; Examples ;docref_root = "/phpmanual/" ; http://php.net/docref-ext ;docref_ext = .html ; String to output before an error message. PHP's default behavior is to leave ; this setting blank. ; http://php.net/error-prepend-string ; Example: ;error_prepend_string = "<font color=#ff0000>" ; String to output after an error message. PHP's default behavior is to leave ; this setting blank. ; http://php.net/error-append-string ; Example: ;error_append_string = "</font>" ; Log errors to specified file. PHP's default behavior is to leave this value ; empty. ; http://php.net/error-log ; Example: ;error_log = php_errors.log ; Log errors to syslog (Event Log on NT, not valid in Windows 95). ;error_log = syslog ;error_log = "C:\xampp\apache\logs\php_error.log" ;;;;;;;;;;;;;;;;; ; Data Handling ; ;;;;;;;;;;;;;;;;; ; Note - track_vars is ALWAYS enabled ; The separator used in PHP generated URLs to separate arguments. ; PHP's default setting is "&". ; http://php.net/arg-separator.output ; Example: arg_separator.output = "&amp;" ; List of separator(s) used by PHP to parse input URLs into variables. ; PHP's default setting is "&

    Read the article

  • Oracle SQL Developer version 3.2.2 Released

    - by thatjeffsmith
    This is another maintenance release, but I don’t want to minimize the work done in either the 3.2.1 or the 3.2.2 editions. The two releases include more than 400 bug fixes. Version 3.2 should be rocking and rolling and good to go while we work on the next major release! You can find the downloads and bug fixes in the normal places: Download 3.2.2 Bug fixes Connection Names If you downloaded and used version 3.2.1 and noticed some of your connection names were no longer valid due to ‘special’ characters, we’ve loosed our restrictions a bit for 3.2.2. You can now go back to using spaces and hyphens in your connection names. periods, spaces, hyphens should now all work More Copy & Paste Stuff While fixing a bug, the developer decided to also enhance the feature while he was in the code. I love seeing this happen organically. No one is sitting over their shoulder with the red magic marker. No, I’m too far away to do that except on very special days So here’s a ‘trick’ – if you want to copy cells from your grids, just drag the selected cells to the worksheet/editor. You’ll get a comma delimited list – very handy! Select cells, drag and drop up to the worksheet – Voila! Comma separated values

    Read the article

  • Running a simple integration scenario using the Oracle Big Data Connectors on Hadoop/HDFS cluster

    - by hamsun
    Between the elephant ( the tradional image of the Hadoop framework) and the Oracle Iron Man (Big Data..) an english setter could be seen as the link to the right data Data, Data, Data, we are living in a world where data technology based on popular applications , search engines, Webservers, rich sms messages, email clients, weather forecasts and so on, have a predominant role in our life. More and more technologies are used to analyze/track our behavior, try to detect patterns, to propose us "the best/right user experience" from the Google Ad services, to Telco companies or large consumer sites (like Amazon:) ). The more we use all these technologies, the more we generate data, and thus there is a need of huge data marts and specific hardware/software servers (as the Exadata servers) in order to treat/analyze/understand the trends and offer new services to the users. Some of these "data feeds" are raw, unstructured data, and cannot be processed effectively by normal SQL queries. Large scale distributed processing was an emerging infrastructure need and the solution seemed to be the "collocation of compute nodes with the data", which in turn leaded to MapReduce parallel patterns and the development of the Hadoop framework, which is based on MapReduce and a distributed file system (HDFS) that runs on larger clusters of rather inexpensive servers. Several Oracle products are using the distributed / aggregation pattern for data calculation ( Coherence, NoSql, times ten ) so once that you are familiar with one of these technologies, lets says with coherence aggregators, you will find the whole Hadoop, MapReduce concept very similar. Oracle Big Data Appliance is based on the Cloudera Distribution (CDH), and the Oracle Big Data Connectors can be plugged on a Hadoop cluster running the CDH distribution or equivalent Hadoop clusters. In this paper, a "lab like" implementation of this concept is done on a single Linux X64 server, running an Oracle Database 11g Enterprise Edition Release 11.2.0.4.0, and a single node Apache hadoop-1.2.1 HDFS cluster, using the SQL connector for HDFS. The whole setup is fairly simple: Install on a Linux x64 server ( or virtual box appliance) an Oracle Database 11g Enterprise Edition Release 11.2.0.4.0 server Get the Apache Hadoop distribution from: http://mir2.ovh.net/ftp.apache.org/dist/hadoop/common/hadoop-1.2.1. Get the Oracle Big Data Connectors from: http://www.oracle.com/technetwork/bdc/big-data-connectors/downloads/index.html?ssSourceSiteId=ocomen. Check the java version of your Linux server with the command: java -version java version "1.7.0_40" Java(TM) SE Runtime Environment (build 1.7.0_40-b43) Java HotSpot(TM) 64-Bit Server VM (build 24.0-b56, mixed mode) Decompress the hadoop hadoop-1.2.1.tar.gz file to /u01/hadoop-1.2.1 Modify your .bash_profile export HADOOP_HOME=/u01/hadoop-1.2.1 export PATH=$PATH:$HADOOP_HOME/bin export HIVE_HOME=/u01/hive-0.11.0 export PATH=$PATH:$HADOOP_HOME/bin:$HIVE_HOME/bin (also see my sample .bash_profile) Set up ssh trust for Hadoop process, this is a mandatory step, in our case we have to establish a "local trust" as will are using a single node configuration copy the new public keys to the list of authorized keys connect and test the ssh setup to your localhost: We will run a "pseudo-Hadoop cluster", in what is called "local standalone mode", all the Hadoop java components are running in one Java process, this is enough for our demo purposes. We need to "fine tune" some Hadoop configuration files, we have to go at our $HADOOP_HOME/conf, and modify the files: core-site.xml hdfs-site.xml mapred-site.xml check that the hadoop binaries are referenced correctly from the command line by executing: hadoop -version As Hadoop is managing our "clustered HDFS" file system we have to create "the mount point" and format it , the mount point will be declared to core-site.xml as: The layout under the /u01/hadoop-1.2.1/data will be created and used by other hadoop components (MapReduce = /mapred/...) HDFS is using the /dfs/... layout structure format the HDFS hadoop file system: Start the java components for the HDFS system As an additional check, you can use the GUI Hadoop browsers to check the content of your HDFS configurations: Once our HDFS Hadoop setup is done you can use the HDFS file system to store data ( big data : )), and plug them back and forth to Oracle Databases by the means of the Big Data Connectors ( which is the next configuration step). You can create / use a Hive db, but in our case we will make a simple integration of "raw data" , through the creation of an External Table to a local Oracle instance ( on the same Linux box, we run the Hadoop HDFS one node cluster and one Oracle DB). Download some public "big data", I use the site: http://france.meteofrance.com/france/observations, from where I can get *.csv files for my big data simulations :). Here is the data layout of my example file: Download the Big Data Connector from the OTN (oraosch-2.2.0.zip), unzip it to your local file system (see picture below) Modify your environment in order to access the connector libraries , and make the following test: [oracle@dg1 bin]$./hdfs_stream Usage: hdfs_stream locationFile [oracle@dg1 bin]$ Load the data to the Hadoop hdfs file system: hadoop fs -mkdir bgtest_data hadoop fs -put obsFrance.txt bgtest_data/obsFrance.txt hadoop fs -ls /user/oracle/bgtest_data/obsFrance.txt [oracle@dg1 bg-data-raw]$ hadoop fs -ls /user/oracle/bgtest_data/obsFrance.txt Found 1 items -rw-r--r-- 1 oracle supergroup 54103 2013-10-22 06:10 /user/oracle/bgtest_data/obsFrance.txt [oracle@dg1 bg-data-raw]$hadoop fs -ls hdfs:///user/oracle/bgtest_data/obsFrance.txt Found 1 items -rw-r--r-- 1 oracle supergroup 54103 2013-10-22 06:10 /user/oracle/bgtest_data/obsFrance.txt Check the content of the HDFS with the browser UI: Start the Oracle database, and run the following script in order to create the Oracle database user, the Oracle directories for the Oracle Big Data Connector (dg1 it’s my own db id replace accordingly yours): #!/bin/bash export ORAENV_ASK=NO export ORACLE_SID=dg1 . oraenv sqlplus /nolog <<EOF CONNECT / AS sysdba; CREATE OR REPLACE DIRECTORY osch_bin_path AS '/u01/orahdfs-2.2.0/bin'; CREATE USER BGUSER IDENTIFIED BY oracle; GRANT CREATE SESSION, CREATE TABLE TO BGUSER; GRANT EXECUTE ON sys.utl_file TO BGUSER; GRANT READ, EXECUTE ON DIRECTORY osch_bin_path TO BGUSER; CREATE OR REPLACE DIRECTORY BGT_LOG_DIR as '/u01/BG_TEST/logs'; GRANT READ, WRITE ON DIRECTORY BGT_LOG_DIR to BGUSER; CREATE OR REPLACE DIRECTORY BGT_DATA_DIR as '/u01/BG_TEST/data'; GRANT READ, WRITE ON DIRECTORY BGT_DATA_DIR to BGUSER; EOF Put the following in a file named t3.sh and make it executable, hadoop jar $OSCH_HOME/jlib/orahdfs.jar \ oracle.hadoop.exttab.ExternalTable \ -D oracle.hadoop.exttab.tableName=BGTEST_DP_XTAB \ -D oracle.hadoop.exttab.defaultDirectory=BGT_DATA_DIR \ -D oracle.hadoop.exttab.dataPaths="hdfs:///user/oracle/bgtest_data/obsFrance.txt" \ -D oracle.hadoop.exttab.columnCount=7 \ -D oracle.hadoop.connection.url=jdbc:oracle:thin:@//localhost:1521/dg1 \ -D oracle.hadoop.connection.user=BGUSER \ -D oracle.hadoop.exttab.printStackTrace=true \ -createTable --noexecute then test the creation fo the external table with it: [oracle@dg1 samples]$ ./t3.sh ./t3.sh: line 2: /u01/orahdfs-2.2.0: Is a directory Oracle SQL Connector for HDFS Release 2.2.0 - Production Copyright (c) 2011, 2013, Oracle and/or its affiliates. All rights reserved. Enter Database Password:] The create table command was not executed. The following table would be created. CREATE TABLE "BGUSER"."BGTEST_DP_XTAB" ( "C1" VARCHAR2(4000), "C2" VARCHAR2(4000), "C3" VARCHAR2(4000), "C4" VARCHAR2(4000), "C5" VARCHAR2(4000), "C6" VARCHAR2(4000), "C7" VARCHAR2(4000) ) ORGANIZATION EXTERNAL ( TYPE ORACLE_LOADER DEFAULT DIRECTORY "BGT_DATA_DIR" ACCESS PARAMETERS ( RECORDS DELIMITED BY 0X'0A' CHARACTERSET AL32UTF8 STRING SIZES ARE IN CHARACTERS PREPROCESSOR "OSCH_BIN_PATH":'hdfs_stream' FIELDS TERMINATED BY 0X'2C' MISSING FIELD VALUES ARE NULL ( "C1" CHAR(4000), "C2" CHAR(4000), "C3" CHAR(4000), "C4" CHAR(4000), "C5" CHAR(4000), "C6" CHAR(4000), "C7" CHAR(4000) ) ) LOCATION ( 'osch-20131022081035-74-1' ) ) PARALLEL REJECT LIMIT UNLIMITED; The following location files would be created. osch-20131022081035-74-1 contains 1 URI, 54103 bytes 54103 hdfs://localhost:19000/user/oracle/bgtest_data/obsFrance.txt Then remove the --noexecute flag and create the external Oracle table for the Hadoop data. Check the results: The create table command succeeded. CREATE TABLE "BGUSER"."BGTEST_DP_XTAB" ( "C1" VARCHAR2(4000), "C2" VARCHAR2(4000), "C3" VARCHAR2(4000), "C4" VARCHAR2(4000), "C5" VARCHAR2(4000), "C6" VARCHAR2(4000), "C7" VARCHAR2(4000) ) ORGANIZATION EXTERNAL ( TYPE ORACLE_LOADER DEFAULT DIRECTORY "BGT_DATA_DIR" ACCESS PARAMETERS ( RECORDS DELIMITED BY 0X'0A' CHARACTERSET AL32UTF8 STRING SIZES ARE IN CHARACTERS PREPROCESSOR "OSCH_BIN_PATH":'hdfs_stream' FIELDS TERMINATED BY 0X'2C' MISSING FIELD VALUES ARE NULL ( "C1" CHAR(4000), "C2" CHAR(4000), "C3" CHAR(4000), "C4" CHAR(4000), "C5" CHAR(4000), "C6" CHAR(4000), "C7" CHAR(4000) ) ) LOCATION ( 'osch-20131022081719-3239-1' ) ) PARALLEL REJECT LIMIT UNLIMITED; The following location files were created. osch-20131022081719-3239-1 contains 1 URI, 54103 bytes 54103 hdfs://localhost:19000/user/oracle/bgtest_data/obsFrance.txt This is the view from the SQL Developer: and finally the number of lines in the oracle table, imported from our Hadoop HDFS cluster SQL select count(*) from "BGUSER"."BGTEST_DP_XTAB"; COUNT(*) ---------- 1151 In a next post we will integrate data from a Hive database, and try some ODI integrations with the ODI Big Data connector. Our simplistic approach is just a step to show you how these unstructured data world can be integrated to Oracle infrastructure. Hadoop, BigData, NoSql are great technologies, they are widely used and Oracle is offering a large integration infrastructure based on these services. Oracle University presents a complete curriculum on all the Oracle related technologies: NoSQL: Introduction to Oracle NoSQL Database Using Oracle NoSQL Database Big Data: Introduction to Big Data Oracle Big Data Essentials Oracle Big Data Overview Oracle Data Integrator: Oracle Data Integrator 12c: New Features Oracle Data Integrator 11g: Integration and Administration Oracle Data Integrator: Administration and Development Oracle Data Integrator 11g: Advanced Integration and Development Oracle Coherence 12c: Oracle Coherence 12c: New Features Oracle Coherence 12c: Share and Manage Data in Clusters Oracle Coherence 12c: Oracle GoldenGate 11g: Fundamentals for Oracle Oracle GoldenGate 11g: Fundamentals for SQL Server Oracle GoldenGate 11g Fundamentals for Oracle Oracle GoldenGate 11g Fundamentals for DB2 Oracle GoldenGate 11g Fundamentals for Teradata Oracle GoldenGate 11g Fundamentals for HP NonStop Oracle GoldenGate 11g Management Pack: Overview Oracle GoldenGate 11g Troubleshooting and Tuning Oracle GoldenGate 11g: Advanced Configuration for Oracle Other Resources: Apache Hadoop : http://hadoop.apache.org/ is the homepage for these technologies. "Hadoop Definitive Guide 3rdEdition" by Tom White is a classical lecture for people who want to know more about Hadoop , and some active "googling " will also give you some more references. About the author: Eugene Simos is based in France and joined Oracle through the BEA-Weblogic Acquisition, where he worked for the Professional Service, Support, end Education for major accounts across the EMEA Region. He worked in the banking sector, ATT, Telco companies giving him extensive experience on production environments. Eugen currently specializes in Oracle Fusion Middleware teaching an array of courses on Weblogic/Webcenter, Content,BPM /SOA/Identity-Security/GoldenGate/Virtualisation/Unified Comm Suite) throughout the EMEA region.

    Read the article

  • Ban HTML comments from your pages and views

    - by Bertrand Le Roy
    Too many people don’t realize that there are other options than <!-- --> comments to annotate HTML. These comments are harmful because they are sent to the client and thus make your page heavier than it needs to be. When doing ASP.NET, a simple drop-in replacement is server comments, which are delimited by <%-- --%> instead of <!-- -->. Those server comments are visible in your source code, but will never be rendered to the client. Here’s a simple way to sanitize a web site. From Visual Studio, hit CTRL+H to bring the search and replace dialog. Choose “Replace in Files” from the second meny on top of the dialog. Open the find options, check “use” and make sure “Regular expressions” are selected. Use “*.aspx;*.ascx;” as the file types to examine. Choose “Entire Solution” under “Look in”. Here’s the expression to search for comments: \<!--{[^-]*}--\> And here’s the replacement string: <%--\1--%> I usually use the “Find Next” and “Replace” buttons rather than the more brutal “Replace All” in order to not apply the fix blindingly. Once this is done, I do a second manual pass of finds with the same expression to make sure I didn’t miss anything.

    Read the article

  • Aggregating Excel cell contents that match a label [migrated]

    - by Josh
    I'm sure this isn't a terribly difficult thing, but it's not the type of question that easily lends itself to internet searches. I've been assigned a project for work involving a complex spreadsheet. I've done the usual =SUM and other basic Excel formulas, and I've got enough coding background that I'm able to at least fudge my way through VBA, but I'm not certain how to proceed with one part of the task. Simple version: On Sheet 1 I have a list of people (one on each row, person's name in column A), on sheet 2 I have a list of groups (one on each row, group name in column A). Each name in Sheet 1 has its own row, and I have a "Data Validation" dropdown menu where you choose the group each person belongs to. That dropdown is sourced from Sheet 2, where each group has a row. So essentially the data validation source for Sheet 1's "Group" column is just "=Sheet2!$a1:a100" or whatever. The problem is this: I want each group row in Sheet 2 to have a formula which results in a list of all the users which have been assigned to that group on Sheet 1. What I mean is something the equivalent of "select * from PeopleTab where GROUP = ThisGroup". The resulting cell would just stick the names together like "Bob Smith, Joe Jones, Sally Sanderson" I've been Googling for hours but I can't think of a way to phrase my search query to get the results I want. Here's an example of desired result (Dash-delimited. Can't find a way to make it look nice, table tags don't seem to work here): (Sheet 1) Bob Smith - Group 1 (selected from dropdown) Joe Jones - Group 2 (selected from dropdown) Sally Sanderson - Group 1 (selected from dropdown) (Sheet 2) Group 1 - Bob Smith, Sally Sanderson (result of formula) Group 2 - Joe Jones (result of formula) What formula (or even what function) do I use on that second column of sheet 2 to make a flat list out of the members of that group?

    Read the article

  • How to handle editing a large file for a non-technical user

    - by Luke
    I have a client who is given a tab delimited .txt file containing hundreds of thousands of rows. I have a user story as follows: As a user I want to take the text file and add a new value at the end of each line which contains the concatenated value of two of the columns. for example if the file read text_one text_two I need to output the following (preferably to a .txt file) text_one text_two text_onetext_two My first approach was to ask the vendor supplying the file to do the concatenation before providing the file, the easiest way to solve a problem is to eliminate it right? however they are very uncooperative and have point blank refused. I've looked at building a simple javascript application that does this client side so a non-technical user could select the file using a file selector. This approach has a few problems The file could be over a GB in size and so can't be loaded straight into memory, I've tried and the browser crashes There is no means to write a file in javascript so I'd need to output the content to the screen and have the user save it (somehow) I was thinking if I could get around the filesize limitations I could just output the edited content to the page and have the user save the page as a .txt file, however I think there is a better way than using javascript that will still accommodate the users lack of technical know-how. Please consider this question to be stack agnostic, but bear in mind that a nice little shell script or python script would be deemed unsuitable for a non technical user unless there is a way of "packaging" it nicely for a non-technical user. Updates The file is too large to open in excel. The process needs to be run weekly, but it doesn't require scheduling or automation...(yet)

    Read the article

  • Welcome!

    - by mannamal
    Welcome to the Oracle Big Data Connectors blog, which will focus on posts related to integrating data on a Hadoop cluster with Oracle Database. In particular the blog will focus on best practices, usage notes, and performance tips for using Oracle Loader for Hadoop and Oracle Direct Connector for HDFS, which are part of Oracle Big Data Connectors. Oracle Big Data Connectors 1.0 also includes Oracle R Connector for Hadoop and Oracle Data Integrator Application Adapters for Hadoop. Oracle Loader for Hadoop: Oracle Loader for Hadoop loads data from Hadoop to Oracle Database. It runs as a MapReduce job on Hadoop to partition, sort, and convert the data into an Oracle-ready format, offloading to Hadoop the processing that is typically done using database CPUs. The data is thenloaded to the database by the Oracle Loader for Hadoop job (online load) or written out as Oracle Data Pump files for load and access later (offline load) with Oracle Direct Connector for HDFS. Oracle Direct Connector for HDFS: Oracle Direct Connector for HDFS is a connector for high speed access of data on HDFS from Oracle Database. With this connector Oracle SQL can be used to directly query data on HDFS. The data can be Oracle Data Pump files generated by Oracle Loader for Hadoop or delimited text files. The connector can also be used to load data into the database using SQL.

    Read the article

  • CodePlex Daily Summary for Monday, June 27, 2011

    CodePlex Daily Summary for Monday, June 27, 2011Popular ReleasesSQL Compact Bulk Insert Library: beta 2.0: Update, with ColumnMappings and support for IEnumerable implemented (for most data types, anyway).MiniTwitter: 1.71: MiniTwitter 1.71 ???? ?? OAuth ???????????? ????????、??????????????????? ???????????????????????SizeOnDisk: 1.0.10.0: Fix: issue 327: size format error when save settings Fix: some UI bindings trouble (sorting, refresh) Fix: user settings file deletion when corrupted Feature: TreeView virtualization (better speed with many folders) Feature: New file type DataGrid column Feature: In KByte view, show size of file < 1024B and > 0 with 3 decimal Feature: New language: Italian Task: Cleanup for speedRawr: Rawr 4.2.0: This is the Downloadable WPF version of Rawr!For web-based version see http://elitistjerks.com/rawr.php You can find the version notes at: http://rawr.codeplex.com/wikipage?title=VersionNotes Rawr AddonWe now have a Rawr Official Addon for in-game exporting and importing of character data hosted on Curse. The Addon does not perform calculations like Rawr, it simply shows your exported Rawr data in wow tooltips and lets you export your character to Rawr (including bag and bank items) like Char...HD-Trailers.NET Downloader: HD-Trailer.net Downloader 1.86: This version implements a new config flag "ConsiderTheatricalandNumberedTrailersasIdentical" that for the purposes of Exclusions only Teaser Trailer and one Trailer (named Trailer, Theatrical Traler Trailer No. 1, Trailer 1, Trailer No. 2, etc) will be downloaded. This also includes a bug fix where the .nfo file did not include the -trailer if configured for XBMC.N2 CMS: 2.2: * Web platform installer support available ** Nuget support available What's newDinamico Templates (beta) - an MVC3 & Razor based template pack using the template-first! development paradigm Boilerplate CSS & HTML5 Advanced theming with css comipilation (concrete, dark, roadwork, terracotta) Template-first! development style Content, news, listing, slider, image sizes, search, sitemap, globalization, youtube, google map Display Tokens - replaces text tokens with rendered content (usag...TerrariViewer: TerrariViewer v4.0 [Terraria Inventory Editor]: Version 4.0 Changelog Continued support for Terraria v1.0.5 Fixed image display problem (Major Issue) Added Buff tabs to allowed editing character buffs Added support for displays whose DPI is set to 120 (Major Issue) Added support for screen resolutions that are horizontally smaller than 1280 (Major Issue) Changed the way users will select replacement items on multiple tabs Added items that were missing in the latest Terraria update Fixed various other bugsCoding4Fun Tools: Coding4Fun.Phone.Toolkit v1.4.2: All color pickers can have value set now and UX updates Bunch of fixes - see check-in notes and associated bugsMosaic Project: Mosaic Alpha Build 256: - Improved support for HTML widgets - Added options support for HTML widgets - Added hubs support for all widgets - Added Lock widget which shows Windows 8 like lock screen when you click on it - Added HTML Today widget (by Daniel Steiner)NCalc - Mathematical Expressions Evaluator for .NET: NCalc - 1.3.7: Fixing overflow when comparing long values Circuit Diagram: Circuit Diagram v0.5 Beta: New in this release: New components: Ammeter (meter) Voltmeter (meter) Undo/redo functionality for placing/moving components Choose resolution when exporting PNG image New logothinktecture WSCF.blue: WSCF.blue V1 Update (1.0.12): Features Added a new AutoSetSpecifiedPropertiesDecorator to automatically set the _Specified property to true when setter on matching property is called. Obviously this will only work when the Properties option is used. Bug Fixes Reduced the number of times menu visibility is updated in the SelectionEvents.OnChange event to help prevent OutOfMemoryException inside EnvDTE. Fixed NullReferenceException in OnTypeNameChanged method of MessageContractConverter. Improved validation of namespac....Net Image Processor: v1.0: Initial release of the library containing the core architecture and two filters. To install, extract the library to somewhere sensible then reference as a file from your project in Visual Studio.KinectNUI: Jun 25 Alpha Release: Initial public version. No installer needed, just run the EXE.Media Companion: MC 3.409b-1 Weekly: This weeks release is part way through a major rewrite of the TVShow code. This means that a few TV related features & functions are not fully operational at the moment. The reason for this release is so that people can see if their particular issue has been fixed during the week. Some issues may not be able to be fully checked due to the ongoing TV code refactoring. So, I would strongly suggest that you put this version into a separate folder, copy your settings folder across & test MC that...Terraria World Viewer: Version 1.5: Update June 24th Made compatible with the new tiles found in Terraria 1.0.5CuttingEdge.Conditions: CuttingEdge.Conditions v1.2: CuttingEdge.Conditions is a library that helps developers to write pre- and postcondition validations in their C# 3.0 and VB.NET 9 code base. Writing these validations is easy and it improves the readability and maintainability of code. This release adds IsNullOrWhiteSpace and IsNotNullOrWhiteSpace extension methods for string arguments and a adds a WithExceptionOnFailure<TException>() method on the Condition class which allows users to specify the type of exception that will be thrown. Fo...patterns & practices: Project Silk: Project Silk Community Drop 12 - June 22, 2011: Changes from previous drop: Minor code changes. New "Introduction" chapter. New "Modularity" chapter. Updated "Architecture" chapter. Updated "Server-Side Implementation" chapter. Updated "Client Data Management and Caching" chapter. Guidance Chapters Ready for Review The Word documents for the chapters are included with the source code in addition to the CHM to help you provide feedback. The PDF is provided as a separate download for your convenience. Installation Overview To ins...DotNetNuke® Community Edition: 06.00.00 Beta: Beta 1 (Build 2300) includes many important enhancements to the user experience. The control panel has been updated for easier access to the most important features and additional forms have been adapted to the new pattern. This release also includes many bug fixes that make it more stable than previous CTP releases. Beta ForumsAcDown????? - Anime&Comic Downloader: AcDown????? v3.0 Beta7: ??AcDown???????????????,?????????????????????。????????????????????,??Acfun、Bilibili、???、???、?????,???????????、???????。 AcDown???????????????????????????,???,???????????????????。 AcDown???????C#??,?????"Acfun?????"。 ????32??64? Windows XP/Vista/7 ????????????? ??:????????Windows XP???,?????????.NET Framework 2.0???(x86)?.NET Framework 2.0???(x64),?????"?????????"??? ??????????????,??????????: ??"AcDown?????"????????? ??v3.0 Beta7 ????????????? ???? ?? ????????????????? "??????"?????"?...New Projects.Net Micro Framework Contrib Library: Contrib library for the .Net Micro Framework..NET Notepad: this is my version of notepadAntLifeISEN: Projet de Découverte MISN P54 Simulation du comportement des fourmisApuracao AG: Estudos asp.net com MCV3apuracaoIK: estudos asp.net desenvolvimento manual;Bikirom BikiSoft: BikiRom BikiSoft windows interface to the BikiRom Megaboard series of real-time ecu retuning hardware.BlogSource: Blog Source.Carmilla Learning: Lessons for Camille Dollé, sup in Epita.Debug Single Thread: This Visual Studio 2010 extension adds two shortcuts and toolbar buttons to allow developers to easily focus on single threads while debugging multi-threaded applications. It dramatically reduces the need to manually go into the Threads window to freeze/thaw all threads but the one that needs to be followed, and therefore helps improve productivity. Features: - Restrict further execution to the current thread only. Will freeze all other threads. Shortcut: CTRL+T+T or snowflake button. -...Excel Viewer: Excel Viewer is a .net component that allows programmers to load excel application and also excel spreadsheets in our windows form. This component is useful for viewing excel reports in applications. This component is written in C# 2.0.Image Processor: The Image Processor in C#jQuery Mobile Extensions for ASP.Net MVC: jQMvc is a collection of extensions built on jQuery Mobile (currently in beta) that can be used with ASP.Net MVC to produce HTML5 based mobile applications. With jQMvc we'll be able to do the neat and powerful MVC stuff but for the emerging world of mobile HTML5 applications.just Think: This is about how to use ***** data for make a application on *****.Kinkuma Framework F# (Prism based F# MVVM Support Library): Kinkuma Framework?????F#?ViewModel?Model??????????????????????。Leuphana MyStudy Mobile: MyStudy schedule at your finger tips. Brings your Leuphana MyStudy schedule to your windows phone 7.maxtor1234test: this is my testMayhemModules: This project contains the modules from the Mayhem repository.PlaOrganizer: PLA Organizer helps create and manage playlist that is based on the PLA format. PowerSys: My Super PowerSystemSilverlight out-of-browser Contoso Dashboard: This is a small demonstration of the capabilities of Silverlight's out of browser mode. This projet includes : - Notification Windows - Unrestricted access to network (netTcpBinding) - Automatic updates (provided that you create your own trusted certificate) - Excel and Outlook Interop - Access to file system - Fullscreen modeSimple Binding Framework: Simple binding frameworkSimply BackUp Tool: A simple tool for backing up personal folders that is built in .Net with WPF. The tool will be updated for using latest techniques and technologies. In partnership with: http://www.ganahtech.comSoftware Botany Ivy - String Utils with CSV, Delimited, & Positional Text Parser: The Software Botany Ivy project is a library containing various string utilities. Included in the library are fluent APIs for parsing and creating delimited and fixed width positional text. Quoted CSV is supported. The library is built on .NET 4.0 using the C# language.Software Botany Sunlight - Word Aligned Hybrid Bit Vector Search Framework: The Software Botany Sunlight project is a search framework built using Word Aligned Hybrid Bit Vectors. Its sole purpose is to provide high performance in-memory searching of data using unknown combinations of indices. It is developed with .NET 4.0 using C#.Torrent file parsing, editing, and writing library: A fully functional library for reading and parsing bencode'd files (ie .torrent) into a fully editable DOM. Work with custom bencode'd file formats, or use strongly typed torrent file reading, modification, and writing. Written in C#.Tweeting Attendant: The Tweeting Attendant is a project created for the Adafruit Make It Tweet Challenge.UBL Larsen: UBL Larsen is a C# .NET 4.0 Class Library for reading/writing Universal Business Language (UBL) xml documents. No xml parsing is required. XmlSerializer will take care of the streaming for you. The library is custom generated from the "UBL 2.0 updated" xsd files to resemble the layout of the Oasis xsd file hierarchy. Some optimizations have been made in order to improve streaming speed and ease the job of for the developer. All of the types in Common Basic Components have been replaced. O...WenbianAsk: Ask system using WPF WP7 Transfer Data Tool: This tool is used to transfer data from PC to WP7. ???????: ?????

    Read the article

  • Oracle Data Integrator 11.1.1.5 Complex Files as Sources and Targets

    - by Alex Kotopoulis
    Overview ODI 11.1.1.5 adds the new Complex File technology for use with file sources and targets. The goal is to read or write file structures that are too complex to be parsed using the existing ODI File technology. This includes: Different record types in one list that use different parsing rules Hierarchical lists, for example customers with nested orders Parsing instructions in the file data, such as delimiter types, field lengths, type identifiers Complex headers such as multiple header lines or parseable information in header Skipping of lines  Conditional or choice fields Similar to the ODI File and XML File technologies, the complex file parsing is done through a JDBC driver that exposes the flat file as relational table structures. Complex files are mapped to one or more table structures, as opposed to the (simple) file technology, which always has a one-to-one relationship between file and table. The resulting set of tables follows the same concept as the ODI XML driver, table rows have additional PK-FK relationships to express hierarchy as well as order values to maintain the file order in the resulting table.   The parsing instruction format used for complex files is the nXSD (native XSD) format that is already in use with Oracle BPEL. This format extends the XML Schema standard by adding additional parsing instructions to each element. Using nXSD parsing technology, the native file is converted into an internal XML format. It is important to understand that the XML is streamed to improve performance; there is no size limitation of the native file based on memory size, the XML data is never fully materialized.  The internal XML is then converted to relational schema using the same mapping rules as the ODI XML driver. How to Create an nXSD file Complex file models depend on the nXSD schema for the given file. This nXSD file has to be created using a text editor or the Native Format Builder Wizard that is part of Oracle BPEL. BPEL is included in the ODI Suite, but not in standalone ODI Enterprise Edition. The nXSD format extends the standard XSD format through nxsd attributes. NXSD is a valid XML Schema, since the XSD standard allows extra attributes with their own namespaces. The following is a sample NXSD schema: <?xml version="1.0"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:nxsd="http://xmlns.oracle.com/pcbpel/nxsd" elementFormDefault="qualified" xmlns:tns="http://xmlns.oracle.com/pcbpel/demoSchema/csv" targetNamespace="http://xmlns.oracle.com/pcbpel/demoSchema/csv" attributeFormDefault="unqualified" nxsd:encoding="US-ASCII" nxsd:stream="chars" nxsd:version="NXSD"> <xsd:element name="Root">         <xsd:complexType><xsd:sequence>       <xsd:element name="Header">                 <xsd:complexType><xsd:sequence>                         <xsd:element name="Branch" type="xsd:string" nxsd:style="terminated" nxsd:terminatedBy=","/>                         <xsd:element name="ListDate" type="xsd:string" nxsd:style="terminated" nxsd:terminatedBy="${eol}"/>                         </xsd:sequence></xsd:complexType>                         </xsd:element>                 </xsd:sequence></xsd:complexType>         <xsd:element name="Customer" maxOccurs="unbounded">                 <xsd:complexType><xsd:sequence>                 <xsd:element name="Name" type="xsd:string" nxsd:style="terminated" nxsd:terminatedBy=","/>                         <xsd:element name="Street" type="xsd:string" nxsd:style="terminated" nxsd:terminatedBy="," />                         <xsd:element name="City" type="xsd:string" nxsd:style="terminated" nxsd:terminatedBy="${eol}" />                         </xsd:sequence></xsd:complexType>                         </xsd:element>                 </xsd:sequence></xsd:complexType> </xsd:element> </xsd:schema> The nXSD schema annotates elements to describe their position and delimiters within the flat text file. The schema above uses almost exclusively the nxsd:terminatedBy instruction to look for the next terminator chars. There are various constructs in nXSD to parse fixed length fields, look ahead in the document for string occurences, perform conditional logic, use variables to remember state, and many more. nXSD files can either be written manually using an XML Schema Editor or created using the Native Format Builder Wizard. Both Native Format Builder Wizard as well as the nXSD language are described in the Application Server Adapter Users Guide. The way to start the Native Format Builder in BPEL is to create a new File Adapter; in step 8 of the Adapter Configuration Wizard a new Schema for Native Format can be created:   The Native Format Builder guides through a number of steps to generate the nXSD based on a sample native file. If the format is complex, it is often a good idea to “approximate” it with a similar simple format and then add the complex components manually.  The resulting *.xsd file can be copied and used as the format for ODI, other BPEL constructs such as the file adapter definition are not relevant for ODI. Using this technique it is also possible to parse the same file format in SOA Suite and ODI, for example using SOA for small real-time messages, and ODI for large batches. This nXSD schema in this example describes a file with a header row containing data and 3 string fields per row delimited by commas, for example: Redwood City Downtown Branch, 06/01/2011 Ebeneezer Scrooge, Sandy Lane, Atherton Tiny Tim, Winton Terrace, Menlo Park The ODI Complex File JDBC driver exposes the file structure through a set of relational tables with PK-FK relationships. The tables for this example are: Table ROOT (1 row): ROOTPK Primary Key for root element SNPSFILENAME Name of the file SNPSFILEPATH Path of the file SNPSLOADDATE Date of load Table HEADER (1 row): ROOTFK Foreign Key to ROOT record ROWORDER Order of row in native document BRANCH Data BRANCHORDER Order of Branch within row LISTDATE Data LISTDATEORDER Order of ListDate within row Table ADDRESS (2 rows): ROOTFK Foreign Key to ROOT record ROWORDER Order of row in native document NAME Data NAMEORDER Oder of Name within row STREET Data STREETORDER Order of Street within row CITY Data CITYORDER Order of City within row Every table has PK and/or FK fields to reflect the document hierarchy through relationships. In this example this is trivial since the HEADER and all CUSTOMER records point back to the PK of ROOT. Deeper nested documents require this to identify parent elements. All tables also have a ROWORDER field to define the order of rows, as well as order fields for each column, in case the order of columns varies in the original document and needs to be maintained. If order is not relevant, these fields can be ignored. How to Create an Complex File Data Server in ODI After creating the nXSD file and a test data file, and storing it on the local file system accessible to ODI, you can go to the ODI Topology Navigator to create a Data Server and Physical Schema under the Complex File technology. This technology follows the conventions of other ODI technologies and is very similar to the XML technology. The parsing settings such as the source native file, the nXSD schema file, the root element, as well as the external database can be set in the JDBC URL: The use of an external database defined by dbprops is optional, but is strongly recommended for production use. Ideally, the staging database should be used for this. Also, when using a complex file exclusively for read purposes, it is recommended to use the ro=true property to ensure the file is not unnecessarily synchronized back from the database when the connection is closed. A data file is always required to be present  at the filename path during design-time. Without this file, operations like testing the connection, reading the model data, or reverse engineering the model will fail.  All properties of the Complex File JDBC Driver are documented in the Oracle Fusion Middleware Connectivity and Knowledge Modules Guide for Oracle Data Integrator in Appendix C: Oracle Data Integrator Driver for Complex Files Reference. David Allan has created a great viewlet Complex File Processing - 0 to 60 which shows the creation of a Complex File data server as well as a model based on this server. How to Create Models based on an Complex File Schema Once physical schema and logical schema have been created, the Complex File can be used to create a Model as if it were based on a database. When reverse-engineering the Model, data stores(tables) for each XSD element of complex type will be created. Use of complex files as sources is straightforward; when using them as targets it has to be made sure that all dependent tables have matching PK-FK pairs; the same applies to the XML driver as well. Debugging and Error Handling There are different ways to test an nXSD file. The Native Format Builder Wizard can be used even if the nXSD wasn’t created in it; it will show issues related to the schema and/or test data. In ODI, the nXSD  will be parsed and run against the existing test XML file when testing a connection in the Dataserver. If either the nXSD has an error or the data is non-compliant to the schema, an error will be displayed. Sample error message: Error while reading native data. [Line=1, Col=5] Not enough data available in the input, when trying to read data of length "19" for "element with name D1" from the specified position, using "style" as "fixedLength" and "length" as "". Ensure that there is enough data from the specified position in the input. Complex File FAQ Is the size of the native file limited by available memory? No, since the native data is streamed through the driver, only the available space in the staging database limits the size of the data. There are limits on individual field sizes, though; a single large object field needs to fit in memory. Should I always use the complex file driver instead of the file driver in ODI now? No, use the file technology for all simple file parsing tasks, for example any fixed-length or delimited files that just have one row format and can be mapped into a simple table. Because of its narrow assumptions the ODI file driver is easy to configure within ODI and can stream file data without writing it into a database. The complex file driver should be used whenever the use case cannot be handled through the file driver. Are we generating XML out of flat files before we write it into a database? We don’t materialize any XML as part of parsing a flat file, either in memory or on disk. The data produced by the XML parser is streamed in Java objects that just use XSD-derived nXSD schema as its type system. We use the nXSD schema because is the standard for describing complex flat file metadata in Oracle Fusion Middleware, and enables users to share schemas across products. Is the nXSD file interchangeable with SOA Suite? Yes, ODI can use the same nXSD files as SOA Suite, allowing mixed use cases with the same data format. Can I start the Native Format Builder from the ODI Studio? No, the Native Format Builder has to be started from a JDeveloper with BPEL instance. You can get BPEL as part of the SOA Suite bundle. Users without SOA Suite can manually develop nXSD files using XSD editors. When is the database data written back to the native file? Data is synchronized using the SYNCHRONIZE and CREATE FILE commands, and when the JDBC connection is closed. It is recommended to set the ro or read_only property to true when a file is exclusively used for reading so that no unnecessary write-backs occur. Is the nXSD metadata part of the ODI Master or Work Repository? No, the data server definition in the master repository only contains the JDBC URL with file paths; the nXSD files have to be accessible on the file systems where the JDBC driver is executed during production, either by copying or by using a network file system. Where can I find sample nXSD files? The Application Server Adapter Users Guide contains nXSD samples for various different use cases.

    Read the article

  • A jQuery Plug-in to monitor Html Element CSS Changes

    - by Rick Strahl
    Here's a scenario I've run into on a few occasions: I need to be able to monitor certain CSS properties on an HTML element and know when that CSS element changes. The need for this arose out of wanting to build generic components that could 'attach' themselves to other objects and monitor changes on the ‘parent’ object so the dependent object can adjust itself accordingly. What I wanted to create is a jQuery plug-in that allows me to specify a list of CSS properties to monitor and have a function fire in response to any change to any of those CSS properties. The result are the .watch() and .unwatch() jQuery plug-ins. Here’s a simple example page of this plug-in that demonstrates tracking changes to an element being moved with draggable and closable behavior: http://www.west-wind.com/WestWindWebToolkit/samples/Ajax/jQueryPluginSamples/WatcherPlugin.htm Try it with different browsers – IE and FireFox use the DOM event handlers and Chrome, Safari and Opera use setInterval handlers to manage this behavior. It should work in all of them but all but IE and FireFox will show a bit of lag between the changes in the main element and the shadow. The relevant HTML for this example is this fragment of a main <div> (#notebox) and an element that is to mimic a shadow (#shadow). <div class="containercontent"> <div id="notebox" style="width: 200px; height: 150px;position: absolute; z-index: 20; padding: 20px; background-color: lightsteelblue;"> Go ahead drag me around and close me! </div> <div id="shadow" style="background-color: Gray; z-index: 19;position:absolute;display: none;"> </div> </div> The watcher plug in is then applied to the main <div> and shadow in sync with the following plug-in code: <script type="text/javascript"> $(document).ready(function () { var counter = 0; $("#notebox").watch("top,left,height,width,display,opacity", function (data, i) { var el = $(this); var sh = $("#shadow"); var propChanged = data.props[i]; var valChanged = data.vals[i]; counter++; showStatus("Prop: " + propChanged + " value: " + valChanged + " " + counter); var pos = el.position(); var w = el.outerWidth(); var h = el.outerHeight(); sh.css({ width: w, height: h, left: pos.left + 5, top: pos.top + 5, display: el.css("display"), opacity: el.css("opacity") }); }) .draggable() .closable() .css("left", 10); }); </script> When you run this page as you drag the #notebox element the #shadow element will maintain and stay pinned underneath the #notebox element effectively keeping the shadow attached to the main element. Likewise, if you hide or fadeOut() the #notebox element the shadow will also go away – show the #notebox element and the shadow also re-appears because we are assigning the display property from the parent on the shadow. Note we’re attaching the .watch() plug-in to the #notebox element and have it fire whenever top,left,height,width,opacity or display CSS properties are changed. The passed data element contains a props[] and vals[] array that holds the properties monitored and their current values. An index passed as the second parm tells you which property has changed and what its current value is (propChanged/valChanged in the code above). The rest of the watcher handler code then deals with figuring out the main element’s position and recalculating and setting the shadow’s position using the jQuery .css() function. Note that this is just an example to demonstrate the watch() behavior here – this is not the best way to create a shadow. If you’re interested in a more efficient and cleaner way to handle shadows with a plug-in check out the .shadow() plug-in in ww.jquery.js (code search for fn.shadow) which uses native CSS features when available but falls back to a tracked shadow element on browsers that don’t support it, which is how this watch() plug-in came about in the first place :-) How does it work? The plug-in works by letting the user specify a list of properties to monitor as a comma delimited string and a handler function: el.watch("top,left,height,width,display,opacity", function (data, i) {}, 100, id) You can also specify an interval (if no DOM event monitoring isn’t available in the browser) and an ID that identifies the event handler uniquely. The watch plug-in works by hooking up to DOMAttrModified in FireFox, to onPropertyChanged in Internet Explorer, or by using a timer with setInterval to handle the detection of changes for other browsers. Unfortunately WebKit doesn’t support DOMAttrModified consistently at the moment so Safari and Chrome currently have to use the slower setInterval mechanism. In response to a changed property (or a setInterval timer hit) a JavaScript handler is fired which then runs through all the properties monitored and determines if and which one has changed. The DOM events fire on all property/style changes so the intermediate plug-in handler filters only those hits we’re interested in. If one of our monitored properties has changed the specified event handler function is called along with a data object and an index that identifies the property that’s changed in the data.props/data.vals arrays. The jQuery plugin to implement this functionality looks like this: (function($){ $.fn.watch = function (props, func, interval, id) { /// <summary> /// Allows you to monitor changes in a specific /// CSS property of an element by polling the value. /// when the value changes a function is called. /// The function called is called in the context /// of the selected element (ie. this) /// </summary> /// <param name="prop" type="String">CSS Properties to watch sep. by commas</param> /// <param name="func" type="Function"> /// Function called when the value has changed. /// </param> /// <param name="interval" type="Number"> /// Optional interval for browsers that don't support DOMAttrModified or propertychange events. /// Determines the interval used for setInterval calls. /// </param> /// <param name="id" type="String">A unique ID that identifies this watch instance on this element</param> /// <returns type="jQuery" /> if (!interval) interval = 100; if (!id) id = "_watcher"; return this.each(function () { var _t = this; var el$ = $(this); var fnc = function () { __watcher.call(_t, id) }; var data = { id: id, props: props.split(","), vals: [props.split(",").length], func: func, fnc: fnc, origProps: props, interval: interval, intervalId: null }; // store initial props and values $.each(data.props, function (i) { data.vals[i] = el$.css(data.props[i]); }); el$.data(id, data); hookChange(el$, id, data); }); function hookChange(el$, id, data) { el$.each(function () { var el = $(this); if (typeof (el.get(0).onpropertychange) == "object") el.bind("propertychange." + id, data.fnc); else if ($.browser.mozilla) el.bind("DOMAttrModified." + id, data.fnc); else data.intervalId = setInterval(data.fnc, interval); }); } function __watcher(id) { var el$ = $(this); var w = el$.data(id); if (!w) return; var _t = this; if (!w.func) return; // must unbind or else unwanted recursion may occur el$.unwatch(id); var changed = false; var i = 0; for (i; i < w.props.length; i++) { var newVal = el$.css(w.props[i]); if (w.vals[i] != newVal) { w.vals[i] = newVal; changed = true; break; } } if (changed) w.func.call(_t, w, i); // rebind event hookChange(el$, id, w); } } $.fn.unwatch = function (id) { this.each(function () { var el = $(this); var data = el.data(id); try { if (typeof (this.onpropertychange) == "object") el.unbind("propertychange." + id, data.fnc); else if ($.browser.mozilla) el.unbind("DOMAttrModified." + id, data.fnc); else clearInterval(data.intervalId); } // ignore if element was already unbound catch (e) { } }); return this; } })(jQuery); Note that there’s a corresponding .unwatch() plug-in that can be used to stop monitoring properties. The ID parameter is optional both on watch() and unwatch() – a standard name is used if you don’t specify one, but it’s a good idea to use unique names for each element watched to avoid overlap in event ids especially if you’re monitoring many elements. The syntax is: $.fn.watch = function(props, func, interval, id) props A comma delimited list of CSS style properties that are to be watched for changes. If any of the specified properties changes the function specified in the second parameter is fired. func The function fired in response to a changed styles. Receives this as the element changed and an object parameter that represents the watched properties and their respective values. The first parameter is passed in this structure: { id: watcherId, props: [], vals: [], func: thisFunc, fnc: internalHandler, origProps: strPropertyListOnWatcher }; A second parameter is the index of the changed property so data.props[i] or data.vals[i] gets the property and changed value. interval The interval for setInterval() for those browsers that don't support property watching in the DOM. In milliseconds. id An optional id that identifies this watcher. Required only if multiple watchers might be hooked up to the same element. The default is _watcher if not specified. It’s been a Journey I started building this plug-in about two years ago and had to make many modifications to it in response to changes in jQuery and also in browser behaviors. I think the latest round of changes made should make this plug-in fairly future proof going forward (although I hope there will be better cross-browser change event notifications in the future). One of the big problems I ran into had to do with recursive change notifications – it looks like starting with jQuery 1.44 and later, jQuery internally modifies element properties on some calls to some .css()  property retrievals and things like outerHeight/Width(). In IE this would cause nasty lock up issues at times. In response to this I changed the code to unbind the events when the handler function is called and then rebind when it exits. This also makes user code less prone to stack overflow recursion as you can actually change properties on the base element. It also means though that if you change one of the monitors properties in the handler the watch() handler won’t fire in response – you need to resort to a setTimeout() call instead to force the code to run outside of the handler: $("#notebox") el.watch("top,left,height,width,display,opacity", function (data, i) { var el = $(this); … // this makes el changes work setTimeout(function () { el.css("top", 10) },10); }) Since I’ve built this component I’ve had a lot of good uses for it. The .shadow() fallback functionality is one of them. Resources The watch() plug-in is part of ww.jquery.js and the West Wind West Wind Web Toolkit. You’re free to use this code here or the code from the toolkit. West Wind Web Toolkit Latest version of ww.jquery.js (search for fn.watch) watch plug-in documentation © Rick Strahl, West Wind Technologies, 2005-2011Posted in ASP.NET  JavaScript  jQuery  

    Read the article

  • Help with string manipulation function

    - by MusiGenesis
    I have a set of strings that contain within them one or more question marks delimited by a comma, a comma plus one or more spaces, or potentially both. So these strings are all possible: BOB AND ? BOB AND ?,?,?,?,? BOB AND ?, ?, ? ,? BOB AND ?,? , ?,? ?, ? ,? AND BOB I need to replace the question marks with @P#, so that the above samples would become: BOB AND @P1 BOB AND @P1,@P2,@P3,@P4,@P5 BOB AND @P1,@P2,@P3,@P4 BOB AND @P1,@P2,@P3,@P4 @P1,@P2,@P3 AND BOB What's the best way to do this without regex or Linq?

    Read the article

  • WCF Cant find server certificate using FindBYSubjectName

    - by AJM
    I have a certificate installed in my test environment. The subject of this is delimited by commas e.g. S80, My Company Name, Country The code below worked when the subject name was just S80 but now there are more details in the subject it no longer works. <serviceCredentials> <serviceCertificate findValue="S80, My Company Name, Country" storeLocation="LocalMachine" storeName="My" x509FindType="FindBySubjectName"/> </serviceCredentials> I get an error Cannot find the X.509 certificate using the following search criteria: StoreName 'My', StoreLocation 'LocalMachine', FindType 'FindBySubjectName', FindValue 'S80, My Company Name, Country'. If I just use S80 as the subject I get an error Keyset does not exist Any idea?

    Read the article

  • Python: split files using mutliple split delimiters

    - by donalmg
    Hi, I have multiple CSV files which I need to parse in a loop to gather information. The problem is that while they are the same format, some are delimited by '\t' and others by ','. After this, I want to remove the double-quote from around the string. Can python split via multiple possible delimiters? At the minute, I can split the line with one by using: f = open(filename, "r") fields = f.readlines() for fs in fields: sf = fs.split('\t') tf = [fi.strip ('"') for fi in sf] Any suggestions are welcome.

    Read the article

  • SSIS parsing of an irregular flat file?

    - by ElHaix
    I'm pretty familiar with SSIS parsing of regular delimited text data files, however, I'm looking for some advice on an approach to tackle a file that looks like this test file: ISA*00* *00* *01*220220220 *ZZ*RL CODE 01*060327*1212*U*00300*000008859*0*P*:~ GS*RA*CPA-BPT*LOCALUTILITY*060319*1212*970819003*X*003030~ ST*820*000000001~ BPR*C*321.91*C*X12*CBC*04*000300488**9918939***04*000300002**1598564*070319~ TRN*1*00075319970819105029~ REF*RR*0003199708190000174858~ DTM*097*070318~ DTM*107*070318~ N1*PR*DIRECT PAYMENT~ N1*PE*ABC CORPORATE BILLER*ZZ*90005836~ ENT*1~ N1*PR*BILLING - TEST - NATTRASS~ RMR*CR*0009381082105011**142.15~ REF*TN*000303965~ DTM*109*070316~ ENT*2~ N1*PR*BILL FREID TEST~ RMR*CR*0011010451800011**179.76~ REF*TN*000304189~ The 321.91 is the total of the transaction. I would prefer to do this with SSIS, but could also do create a C# parser. Suggestions would be appreciated. Thank you.

    Read the article

  • Complete if statement with strings and array of strings

    - by RandomBen
    I have a page that has 3 variables. They look like this: String[] Headers = new String[] { "Max Width", "Max Length", "Max Height" }; String currentHeader = (String)HttpContext.Current.Request.QueryString["ItemHas"] ?? ""; String checkString = (String)HttpContext.Current.Request.QueryString["ItemIn"] ?? ""; The checkString is a list of Headers delimited by a "|". What is the easiest way to check if my currentHeader is in my Headers array and in my checkString String? I can do it but not in less than 20 lines of code. That seems like a less than optimal solution.

    Read the article

< Previous Page | 5 6 7 8 9 10 11 12 13 14 15 16  | Next Page >