Search Results

Search found 205 results on 9 pages for 'rohit garg'.

Page 9/9 | < Previous Page | 5 6 7 8 9 

  • Oracle Product Hub: Customer Perspectives at the OpenWorld

    - by Mala Narasimharajan
     By Rohit Tandon The Oracle Product Hub (OPH) Product Strategy team will be hosting a customer session dedicated to OPH at Oracle Openworld. Oracle Product Information Management strategy team will have the pleasure to present this session with Motorola Mobility Solutions.  . In this session, you will hear how Motorola Solutions utilizes OPH to meet their IT and business needs. Arif Girniwala, (MDM Lead, Motorola) and Chirag Jariwala (Manager, Deloitte Consulting) will cover the following topics amongst others: How does Motorola Solutions decide on what is Product Master Data for their enterprise? What are the Data Governance structures, Users, User roles, User Security etc. within Motorola Solutions?  How does Motorola Solutions integrate, synchronize and leverage OPH with Agile PLM?       4.  What is the Oracle Product Hub strategy and roadmap (Speaker - Sachin Patel, Director Oracle Product Hub Strategy)       5.  What are the implementation best practices for Oracle Product Hub (Speaker - Srikant Bevara, Sr. Manager, Oracle   Product Hub product management) If you're interested in hearing more about the above then I recommend attending this session: Customer Perspectives: Master Product Data: Strategies for Effective Product Information Management with Motorola Mobility Solutions (CON8834) Tuesday October, 2nd 10:15am - 11:15am Moscone West - 3001 We hope to see you at OOW 2012 and stay in touch via our future blogs!  For a list of all Oracle MDM sessions click here. 

    Read the article

  • OBJC_CLASS_$_MTSCRA", referenced from

    - by user1078841
    I was trying to make a sample code run download by the link http://www.magtek.com/support/software/downloads/sw/99510108.zip This is a card reader api ,here is a sample code.When I run this code I got the error: ld: warning: ignoring file /Users/gaurav.garg/Downloads/99510108/SampleCode/Lib/libMTSCRA.a, missing required architecture i386 in file Undefined symbols for architecture i386: "_OBJC_CLASS_$_MTSCRA", referenced from: objc-class-ref in MagTekDemoAppDelegate.o ld: symbol(s) not found for architecture i386 clang: error: linker command failed with exit code 1 (use -v to see invocation) The class MTSCRA is only a header file,And the solution that I have cheked That we have to add the .m file in compiled source path of build build phase of target...but unfortunately I don't have the MTSCRA.m file.MTscra.h have the AudioToolBox and externalAccesory framework.

    Read the article

  • Tomcat Application Generating too many logs

    - by rohitgu
    Hi, I have an application which runs on tomcat 6.0.20 server on linux ubuntu server. It generates a huge amount of logs in the catalina.out folder, most of these are generated while using the application, but are not generated by the application. Some of the logs it generates are given below, Apr 16, 2010 2:55:24 PM org.apache.tomcat.util.digester.Digester startElement FINE: startElement(,,mime-type) Apr 16, 2010 2:55:24 PM org.apache.tomcat.util.digester.Digester startElement FINE: Pushing body text ' ' Apr 16, 2010 2:55:24 PM org.apache.tomcat.util.digester.Digester startElement FINE: New match='web-app/mime-mapping/mime-type' Apr 16, 2010 2:55:24 PM org.apache.tomcat.util.digester.Digester startElement FINE: Fire begin() for CallParamRule[paramIndex=1, attributeName=null, from stack=false] Apr 16, 2010 2:55:24 PM org.apache.tomcat.util.digester.Digester characters FINE: characters(audio/x-mpeg) Apr 16, 2010 2:55:24 PM org.apache.tomcat.util.digester.Digester endElement FINE: endElement(,,mime-type) Apr 16, 2010 2:55:24 PM org.apache.tomcat.util.digester.Digester endElement FINE: match='web-app/mime-mapping/mime-type' Apr 16, 2010 2:55:24 PM org.apache.tomcat.util.digester.Digester endElement FINE: bodyText='audio/x-mpeg' Apr 16, 2010 2:55:24 PM org.apache.tomcat.util.digester.Digester endElement FINE: Fire body() for CallParamRule[paramIndex=1, attributeName=null, from stack=false] Apr 16, 2010 2:55:24 PM org.apache.tomcat.util.digester.Digester endElement FINE: Popping body text ' How can I turn them off? This is very important, since this a production application. Regards, Rohit

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why is Java EE 6 better than Spring ?

    - by arungupta
    Java EE 6 was released over 2 years ago and now there are 14 compliant application servers. In all my talks around the world, a question that is frequently asked is Why should I use Java EE 6 instead of Spring ? There are already several blogs covering that topic: Java EE wins over Spring by Bill Burke Why will I use Java EE instead of Spring in new Enterprise Java projects in 2012 ? by Kai Waehner (more discussion on TSS) Spring to Java EE migration (Part 1 and 2, 3 and 4 coming as well) by David Heffelfinger Spring to Java EE - A Migration Experience by Lincoln Baxter Migrating Spring to Java EE 6 by Bert Ertman and Paul Bakker at NLJUG Moving from Spring to Java EE 6 - The Age of Frameworks is Over at TSS Java EE vs Spring Shootout by Rohit Kelapure and Reza Rehman at JavaOne 2011 Java EE 6 and the Ewoks by Murat Yener Definite excuse to avoid Spring forever - Bert Ertman and Arun Gupta I will try to share my perspective in this blog. First of all, I'd like to start with a note: Thank you Spring framework for filling the interim gap and providing functionality that is now included in the mainstream Java EE 6 application servers. The Java EE platform has evolved over the years learning from frameworks like Spring and provides all the functionality to build an enterprise application. Thank you very much Spring framework! While Spring was revolutionary in its time and is still very popular and quite main stream in the same way Struts was circa 2003, it really is last generation's framework - some people are even calling it legacy. However my theory is "code is king". So my approach is to build/take a simple Hello World CRUD application in Java EE 6 and Spring and compare the deployable artifacts. I started looking at the official tutorial Developing a Spring Framework MVC Application Step-by-Step but it is using the older version 2.5. I wasn't able to find any updated version in the current 3.1 release. Next, I downloaded Spring Tool Suite and thought that would provide some template samples to get started. A least a quick search did not show any handy tutorials - either video or text-based. So I searched and found a link to their SVN repository at src.springframework.org/svn/spring-samples/. I tried the "mvc-basic" sample and the generated WAR file was 4.43 MB. While it was named a "basic" sample it seemed to come with 19 different libraries bundled but it was what I could find: ./WEB-INF/lib/aopalliance-1.0.jar./WEB-INF/lib/hibernate-validator-4.1.0.Final.jar./WEB-INF/lib/jcl-over-slf4j-1.6.1.jar./WEB-INF/lib/joda-time-1.6.2.jar./WEB-INF/lib/joda-time-jsptags-1.0.2.jar./WEB-INF/lib/jstl-1.2.jar./WEB-INF/lib/log4j-1.2.16.jar./WEB-INF/lib/slf4j-api-1.6.1.jar./WEB-INF/lib/slf4j-log4j12-1.6.1.jar./WEB-INF/lib/spring-aop-3.0.5.RELEASE.jar./WEB-INF/lib/spring-asm-3.0.5.RELEASE.jar./WEB-INF/lib/spring-beans-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-support-3.0.5.RELEASE.jar./WEB-INF/lib/spring-core-3.0.5.RELEASE.jar./WEB-INF/lib/spring-expression-3.0.5.RELEASE.jar./WEB-INF/lib/spring-web-3.0.5.RELEASE.jar./WEB-INF/lib/spring-webmvc-3.0.5.RELEASE.jar./WEB-INF/lib/validation-api-1.0.0.GA.jar And it is not even using any database! The app deployed fine on GlassFish 3.1.2 but the "@Controller Example" link did not work as it was missing the context root. With a bit of tweaking I could deploy the application and assume that the account got created because no error was displayed in the browser or server log. Next I generated the WAR for "mvc-ajax" and the 5.1 MB WAR had 20 JARs (1 removed, 2 added): ./WEB-INF/lib/aopalliance-1.0.jar./WEB-INF/lib/hibernate-validator-4.1.0.Final.jar./WEB-INF/lib/jackson-core-asl-1.6.4.jar./WEB-INF/lib/jackson-mapper-asl-1.6.4.jar./WEB-INF/lib/jcl-over-slf4j-1.6.1.jar./WEB-INF/lib/joda-time-1.6.2.jar./WEB-INF/lib/jstl-1.2.jar./WEB-INF/lib/log4j-1.2.16.jar./WEB-INF/lib/slf4j-api-1.6.1.jar./WEB-INF/lib/slf4j-log4j12-1.6.1.jar./WEB-INF/lib/spring-aop-3.0.5.RELEASE.jar./WEB-INF/lib/spring-asm-3.0.5.RELEASE.jar./WEB-INF/lib/spring-beans-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-support-3.0.5.RELEASE.jar./WEB-INF/lib/spring-core-3.0.5.RELEASE.jar./WEB-INF/lib/spring-expression-3.0.5.RELEASE.jar./WEB-INF/lib/spring-web-3.0.5.RELEASE.jar./WEB-INF/lib/spring-webmvc-3.0.5.RELEASE.jar./WEB-INF/lib/validation-api-1.0.0.GA.jar 2 more JARs for just doing Ajax. Anyway, deploying this application gave the following error: Caused by: java.lang.NoSuchMethodError: org.codehaus.jackson.map.SerializationConfig.<init>(Lorg/codehaus/jackson/map/ClassIntrospector;Lorg/codehaus/jackson/map/AnnotationIntrospector;Lorg/codehaus/jackson/map/introspect/VisibilityChecker;Lorg/codehaus/jackson/map/jsontype/SubtypeResolver;)V    at org.springframework.samples.mvc.ajax.json.ConversionServiceAwareObjectMapper.<init>(ConversionServiceAwareObjectMapper.java:20)    at org.springframework.samples.mvc.ajax.json.JacksonConversionServiceConfigurer.postProcessAfterInitialization(JacksonConversionServiceConfigurer.java:40)    at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.applyBeanPostProcessorsAfterInitialization(AbstractAutowireCapableBeanFactory.java:407) Seems like some incorrect repos in the "pom.xml". Next one is "mvc-showcase" and the 6.49 MB WAR now has 28 JARs as shown below: ./WEB-INF/lib/aopalliance-1.0.jar./WEB-INF/lib/aspectjrt-1.6.10.jar./WEB-INF/lib/commons-fileupload-1.2.2.jar./WEB-INF/lib/commons-io-2.0.1.jar./WEB-INF/lib/el-api-2.2.jar./WEB-INF/lib/hibernate-validator-4.1.0.Final.jar./WEB-INF/lib/jackson-core-asl-1.8.1.jar./WEB-INF/lib/jackson-mapper-asl-1.8.1.jar./WEB-INF/lib/javax.inject-1.jar./WEB-INF/lib/jcl-over-slf4j-1.6.1.jar./WEB-INF/lib/jdom-1.0.jar./WEB-INF/lib/joda-time-1.6.2.jar./WEB-INF/lib/jstl-api-1.2.jar./WEB-INF/lib/jstl-impl-1.2.jar./WEB-INF/lib/log4j-1.2.16.jar./WEB-INF/lib/rome-1.0.0.jar./WEB-INF/lib/slf4j-api-1.6.1.jar./WEB-INF/lib/slf4j-log4j12-1.6.1.jar./WEB-INF/lib/spring-aop-3.1.0.RELEASE.jar./WEB-INF/lib/spring-asm-3.1.0.RELEASE.jar./WEB-INF/lib/spring-beans-3.1.0.RELEASE.jar./WEB-INF/lib/spring-context-3.1.0.RELEASE.jar./WEB-INF/lib/spring-context-support-3.1.0.RELEASE.jar./WEB-INF/lib/spring-core-3.1.0.RELEASE.jar./WEB-INF/lib/spring-expression-3.1.0.RELEASE.jar./WEB-INF/lib/spring-web-3.1.0.RELEASE.jar./WEB-INF/lib/spring-webmvc-3.1.0.RELEASE.jar./WEB-INF/lib/validation-api-1.0.0.GA.jar The app at least deployed and showed results this time. But still no database! Next I tried building "jpetstore" and got the error: [ERROR] Failed to execute goal on project org.springframework.samples.jpetstore:Could not resolve dependencies for project org.springframework.samples:org.springframework.samples.jpetstore:war:1.0.0-SNAPSHOT: Failed to collect dependencies for [commons-fileupload:commons-fileupload:jar:1.2.1 (compile), org.apache.struts:com.springsource.org.apache.struts:jar:1.2.9 (compile), javax.xml.rpc:com.springsource.javax.xml.rpc:jar:1.1.0 (compile), org.apache.commons:com.springsource.org.apache.commons.dbcp:jar:1.2.2.osgi (compile), commons-io:commons-io:jar:1.3.2 (compile), hsqldb:hsqldb:jar:1.8.0.7 (compile), org.apache.tiles:tiles-core:jar:2.2.0 (compile), org.apache.tiles:tiles-jsp:jar:2.2.0 (compile), org.tuckey:urlrewritefilter:jar:3.1.0 (compile), org.springframework:spring-webmvc:jar:3.0.0.BUILD-SNAPSHOT (compile), org.springframework:spring-orm:jar:3.0.0.BUILD-SNAPSHOT (compile), org.springframework:spring-context-support:jar:3.0.0.BUILD-SNAPSHOT (compile), org.springframework.webflow:spring-js:jar:2.0.7.RELEASE (compile), org.apache.ibatis:com.springsource.com.ibatis:jar:2.3.4.726 (runtime), com.caucho:com.springsource.com.caucho:jar:3.2.1 (compile), org.apache.axis:com.springsource.org.apache.axis:jar:1.4.0 (compile), javax.wsdl:com.springsource.javax.wsdl:jar:1.6.1 (compile), javax.servlet:jstl:jar:1.2 (runtime), org.aspectj:aspectjweaver:jar:1.6.5 (compile), javax.servlet:servlet-api:jar:2.5 (provided), javax.servlet.jsp:jsp-api:jar:2.1 (provided), junit:junit:jar:4.6 (test)]: Failed to read artifact descriptor for org.springframework:spring-webmvc:jar:3.0.0.BUILD-SNAPSHOT: Could not transfer artifact org.springframework:spring-webmvc:pom:3.0.0.BUILD-SNAPSHOT from/to JBoss repository (http://repository.jboss.com/maven2): Access denied to: http://repository.jboss.com/maven2/org/springframework/spring-webmvc/3.0.0.BUILD-SNAPSHOT/spring-webmvc-3.0.0.BUILD-SNAPSHOT.pom It appears the sample is broken - maybe I was pulling from the wrong repository - would be great if someone were to point me at a good target to use here. With a 50% hit on samples in this repository, I started searching through numerous blogs, most of which have either outdated information (using XML-heavy Spring 2.5), some piece of configuration (which is a typical "feature" of Spring) is missing, or too much complexity in the sample. I finally found this blog that worked like a charm. This blog creates a trivial Spring MVC 3 application using Hibernate and MySQL. This application performs CRUD operations on a single table in a database using typical Spring technologies.  I downloaded the sample code from the blog, deployed it on GlassFish 3.1.2 and could CRUD the "person" entity. The source code for this application can be downloaded here. More details on the application statistics below. And then I built a similar CRUD application in Java EE 6 using NetBeans wizards in a couple of minutes. The source code for the application can be downloaded here and the WAR here. The Spring Source Tool Suite may also offer similar wizard-driven capabilities but this blog focus primarily on comparing the runtimes. The lack of STS tutorials was slightly disappointing as well. NetBeans however has tons of text-based and video tutorials and tons of material even by the community. One more bit on the download size of tools bundle ... NetBeans 7.1.1 "All" is 211 MB (which includes GlassFish and Tomcat) Spring Tool Suite  2.9.0 is 347 MB (~ 65% bigger) This blog is not about the tooling comparison so back to the Java EE 6 version of the application .... In order to run the Java EE version on GlassFish, copy the MySQL Connector/J to glassfish3/glassfish/domains/domain1/lib/ext directory and create a JDBC connection pool and JDBC resource as: ./bin/asadmin create-jdbc-connection-pool --datasourceclassname \\ com.mysql.jdbc.jdbc2.optional.MysqlDataSource --restype \\ javax.sql.DataSource --property \\ portNumber=3306:user=mysql:password=mysql:databaseName=mydatabase \\ myConnectionPool ./bin/asadmin create-jdbc-resource --connectionpoolid myConnectionPool jdbc/myDataSource I generated WARs for the two projects and the table below highlights some differences between them: Java EE 6 Spring WAR File Size 0.021030 MB 10.87 MB (~516x) Number of files 20 53 (> 2.5x) Bundled libraries 0 36 Total size of libraries 0 12.1 MB XML files 3 5 LoC in XML files 50 (11 + 15 + 24) 129 (27 + 46 + 16 + 11 + 19) (~ 2.5x) Total .properties files 1 Bundle.properties 2 spring.properties, log4j.properties Cold Deploy 5,339 ms 11,724 ms Second Deploy 481 ms 6,261 ms Third Deploy 528 ms 5,484 ms Fourth Deploy 484 ms 5,576 ms Runtime memory ~73 MB ~101 MB Some points worth highlighting from the table ... 516x WAR file, 10x deployment time - With 12.1 MB of libraries (for a very basic application) bundled in your application, the WAR file size and the deployment time will naturally go higher. The WAR file for Spring-based application is 516x bigger and the deployment time is double during the first deployment and ~ 10x during subsequent deployments. The Java EE 6 application is fully portable and will run on any Java EE 6 compliant application server. 36 libraries in the WAR - There are 14 Java EE 6 compliant application servers today. Each of those servers provide all the functionality like transactions, dependency injection, security, persistence, etc typically required of an enterprise or web application. There is no need to bundle 36 libraries worth 12.1 MB for a trivial CRUD application. These 14 compliant application servers provide all the functionality baked in. Now you can also deploy these libraries in the container but then you don't get the "portability" offered by Spring in that case. Does your typical Spring deployment actually do that ? 3x LoC in XML - The number of XML files is about 1.6x and the LoC is ~ 2.5x. So much XML seems circa 2003 when the Java language had no annotations. The XML files can be further reduced, e.g. faces-config.xml can be replaced without providing i18n, but I just want to compare stock applications. Memory usage - Both the applications were deployed on default GlassFish 3.1.2 installation and any additional memory consumed as part of deployment/access was attributed to the application. This is by no means scientific but at least provides an initial ballpark. This area definitely needs more investigation. Another table that compares typical Java EE 6 compliant application servers and the custom-stack created for a Spring application ... Java EE 6 Spring Web Container ? 53 MB (tcServer 2.6.3 Developer Edition) Security ? 12 MB (Spring Security 3.1.0) Persistence ? 6.3 MB (Hibernate 4.1.0, required) Dependency Injection ? 5.3 MB (Framework) Web Services ? 796 KB (Spring WS 2.0.4) Messaging ? 3.4 MB (RabbitMQ Server 2.7.1) 936 KB (Java client 936) OSGi ? 1.3 MB (Spring OSGi 1.2.1) GlassFish and WebLogic (starting at 33 MB) 83.3 MB There are differentiating factors on both the stacks. But most of the functionality like security, persistence, and dependency injection is baked in a Java EE 6 compliant application server but needs to be individually managed and patched for a Spring application. This very quickly leads to a "stack explosion". The Java EE 6 servers are tested extensively on a variety of platforms in different combinations whereas a Spring application developer is responsible for testing with different JDKs, Operating Systems, Versions, Patches, etc. Oracle has both the leading OSS lightweight server with GlassFish and the leading enterprise Java server with WebLogic Server, both Java EE 6 and both with lightweight deployment options. The Web Container offered as part of a Java EE 6 application server not only deploys your enterprise Java applications but also provide operational management, diagnostics, and mission-critical capabilities required by your applications. The Java EE 6 platform also introduced the Web Profile which is a subset of the specifications from the entire platform. It is targeted at developers of modern web applications offering a reasonably complete stack, composed of standard APIs, and is capable out-of-the-box of addressing the needs of a large class of Web applications. As your applications grow, the stack can grow to the full Java EE 6 platform. The GlassFish Server Web Profile starting at 33MB (smaller than just the non-standard tcServer) provides most of the functionality typically required by a web application. WebLogic provides battle-tested functionality for a high throughput, low latency, and enterprise grade web application. No individual managing or patching, all tested and commercially supported for you! Note that VMWare does have a server, tcServer, but it is non-standard and not even certified to the level of the standard Web Profile most customers expect these days. Customers who choose this risk proprietary lock-in since VMWare does not seem to want to formally certify with either Java EE 6 Enterprise Platform or with Java EE 6 Web Profile but of course it would be great if they were to join the community and help their customers reduce the risk of deploying on VMWare software. Some more points to help you decide choose between Java EE 6 and Spring ... Freedom to choose container - There are 14 Java EE 6 compliant application servers today, with a variety of open source and commercial offerings. A Java EE 6 application can be deployed on any of those containers. So if you deployed your application on GlassFish today and would like to scale up with your demands then you can deploy the same application to WebLogic. And because of the portability of a Java EE 6 application, you can even take it a different vendor altogether. Spring requires a runtime which could be any of these app servers as well. But why use Spring when all the required functionality is already baked into the application server itself ? Spring also has a different definition of portability where they claim to bundle all the libraries in the WAR file and move to any application server. But we saw earlier how bloated that archive could be. The equivalent features in Spring runtime offerings (mainly tcServer) are not all open source, not as mature, and often require manual assembly.  Vendor choice - The Java EE 6 platform is created using the Java Community Process where all the big players like Oracle, IBM, RedHat, and Apache are conritbuting to make the platform successful. Each application server provides the basic Java EE 6 platform compliance and has its own competitive offerings. This allows you to choose an application server for deploying your Java EE 6 applications. If you are not happy with the support or feature of one vendor then you can move your application to a different vendor because of the portability promise offered by the platform. Spring is a set of products from a single company, one price book, one support organization, one sustaining organization, one sales organization, etc. If any of those cause a customer headache, where do you go ? Java EE, backed by multiple vendors, is a safer bet for those that are risk averse. Production support - With Spring, typically you need to get support from two vendors - VMWare and the container provider. With Java EE 6, all of this is typically provided by one vendor. For example, Oracle offers commercial support from systems, operating systems, JDK, application server, and applications on top of them. VMWare certainly offers complete production support but do you really want to put all your eggs in one basket ? Do you really use tcServer ? ;-) Maintainability - With Spring, you are likely building your own distribution with multiple JAR files, integrating, patching, versioning, etc of all those components. Spring's claim is that multiple JAR files allow you to go à la carte and pick the latest versions of different components. But who is responsible for testing whether all these versions work together ? Yep, you got it, its YOU! If something does not work, who patches and maintains the JARs ? Of course, you! Commercial support for such a configuration ? On your own! The Java EE application servers manage all of this for you and provide a well-tested and commercially supported bundle. While it is always good to realize that there is something new and improved that updates and replaces older frameworks like Spring, the good news is not only does a Java EE 6 container offer what is described here, most also will let you deploy and run your Spring applications on them while you go through an upgrade to a more modern architecture. End result, you get the best of both worlds - keeping your legacy investment but moving to a more agile, lightweight world of Java EE 6. A message to the Spring lovers ... The complexity in J2EE 1.2, 1.3, and 1.4 led to the genesis of Spring but that was in 2004. This is 2012 and the name has changed to "Java EE 6" :-) There are tons of improvements in the Java EE platform to make it easy-to-use and powerful. Some examples: Adding @Stateless on a POJO makes it an EJB EJBs can be packaged in a WAR with no special packaging or deployment descriptors "web.xml" and "faces-config.xml" are optional in most of the common cases Typesafe dependency injection is now part of the Java EE platform Add @Path on a POJO allows you to publish it as a RESTful resource EJBs can be used as backing beans for Facelets-driven JSF pages providing full MVC Java EE 6 WARs are known to be kilobytes in size and deployed in milliseconds Tons of other simplifications in the platform and application servers So if you moved away from J2EE to Spring many years ago and have not looked at Java EE 6 (which has been out since Dec 2009) then you should definitely try it out. Just be at least aware of what other alternatives are available instead of restricting yourself to one stack. Here are some workshops and screencasts worth trying: screencast #37 shows how to build an end-to-end application using NetBeans screencast #36 builds the same application using Eclipse javaee-lab-feb2012.pdf is a 3-4 hours self-paced hands-on workshop that guides you to build a comprehensive Java EE 6 application using NetBeans Each city generally has a "spring cleanup" program every year. It allows you to clean up the mess from your house. For your software projects, you don't need to wait for an annual event, just get started and reduce the technical debt now! Move away from your legacy Spring-based applications to a lighter and more modern approach of building enterprise Java applications using Java EE 6. Watch this beautiful presentation that explains how to migrate from Spring -> Java EE 6: List of files in the Java EE 6 project: ./index.xhtml./META-INF./person./person/Create.xhtml./person/Edit.xhtml./person/List.xhtml./person/View.xhtml./resources./resources/css./resources/css/jsfcrud.css./template.xhtml./WEB-INF./WEB-INF/classes./WEB-INF/classes/Bundle.properties./WEB-INF/classes/META-INF./WEB-INF/classes/META-INF/persistence.xml./WEB-INF/classes/org./WEB-INF/classes/org/javaee./WEB-INF/classes/org/javaee/javaeemysql./WEB-INF/classes/org/javaee/javaeemysql/AbstractFacade.class./WEB-INF/classes/org/javaee/javaeemysql/Person.class./WEB-INF/classes/org/javaee/javaeemysql/Person_.class./WEB-INF/classes/org/javaee/javaeemysql/PersonController$1.class./WEB-INF/classes/org/javaee/javaeemysql/PersonController$PersonControllerConverter.class./WEB-INF/classes/org/javaee/javaeemysql/PersonController.class./WEB-INF/classes/org/javaee/javaeemysql/PersonFacade.class./WEB-INF/classes/org/javaee/javaeemysql/util./WEB-INF/classes/org/javaee/javaeemysql/util/JsfUtil.class./WEB-INF/classes/org/javaee/javaeemysql/util/PaginationHelper.class./WEB-INF/faces-config.xml./WEB-INF/web.xml List of files in the Spring 3.x project: ./META-INF ./META-INF/MANIFEST.MF./WEB-INF./WEB-INF/applicationContext.xml./WEB-INF/classes./WEB-INF/classes/log4j.properties./WEB-INF/classes/org./WEB-INF/classes/org/krams ./WEB-INF/classes/org/krams/tutorial ./WEB-INF/classes/org/krams/tutorial/controller ./WEB-INF/classes/org/krams/tutorial/controller/MainController.class ./WEB-INF/classes/org/krams/tutorial/domain ./WEB-INF/classes/org/krams/tutorial/domain/Person.class ./WEB-INF/classes/org/krams/tutorial/service ./WEB-INF/classes/org/krams/tutorial/service/PersonService.class ./WEB-INF/hibernate-context.xml ./WEB-INF/hibernate.cfg.xml ./WEB-INF/jsp ./WEB-INF/jsp/addedpage.jsp ./WEB-INF/jsp/addpage.jsp ./WEB-INF/jsp/deletedpage.jsp ./WEB-INF/jsp/editedpage.jsp ./WEB-INF/jsp/editpage.jsp ./WEB-INF/jsp/personspage.jsp ./WEB-INF/lib ./WEB-INF/lib/antlr-2.7.6.jar ./WEB-INF/lib/aopalliance-1.0.jar ./WEB-INF/lib/c3p0-0.9.1.2.jar ./WEB-INF/lib/cglib-nodep-2.2.jar ./WEB-INF/lib/commons-beanutils-1.8.3.jar ./WEB-INF/lib/commons-collections-3.2.1.jar ./WEB-INF/lib/commons-digester-2.1.jar ./WEB-INF/lib/commons-logging-1.1.1.jar ./WEB-INF/lib/dom4j-1.6.1.jar ./WEB-INF/lib/ejb3-persistence-1.0.2.GA.jar ./WEB-INF/lib/hibernate-annotations-3.4.0.GA.jar ./WEB-INF/lib/hibernate-commons-annotations-3.1.0.GA.jar ./WEB-INF/lib/hibernate-core-3.3.2.GA.jar ./WEB-INF/lib/javassist-3.7.ga.jar ./WEB-INF/lib/jstl-1.1.2.jar ./WEB-INF/lib/jta-1.1.jar ./WEB-INF/lib/junit-4.8.1.jar ./WEB-INF/lib/log4j-1.2.14.jar ./WEB-INF/lib/mysql-connector-java-5.1.14.jar ./WEB-INF/lib/persistence-api-1.0.jar ./WEB-INF/lib/slf4j-api-1.6.1.jar ./WEB-INF/lib/slf4j-log4j12-1.6.1.jar ./WEB-INF/lib/spring-aop-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-asm-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-beans-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-context-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-context-support-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-core-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-expression-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-jdbc-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-orm-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-tx-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-web-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-webmvc-3.0.5.RELEASE.jar ./WEB-INF/lib/standard-1.1.2.jar ./WEB-INF/lib/xml-apis-1.0.b2.jar ./WEB-INF/spring-servlet.xml ./WEB-INF/spring.properties ./WEB-INF/web.xml So, are you excited about Java EE 6 ? Want to get started now ? Here are some resources: Java EE 6 SDK (including runtime, samples, tutorials etc) GlassFish Server Open Source Edition 3.1.2 (Community) Oracle GlassFish Server 3.1.2 (Commercial) Java EE 6 using WebLogic 12c and NetBeans (Video) Java EE 6 with NetBeans and GlassFish (Video) Java EE with Eclipse and GlassFish (Video)

    Read the article

< Previous Page | 5 6 7 8 9