Search Results

Search found 10966 results on 439 pages for 'kevin db'.

Page 98/439 | < Previous Page | 94 95 96 97 98 99 100 101 102 103 104 105  | Next Page >

• CPU running at full capacity when boot to DOS?

  - by Kevin H

  Does the CPU is run at 100% or near full capacity when the computer is booted into MS-DOS? Will the CPU temperature become higher even though we are not running any program in DOS mode? In Windows, we can see the CPU usage in % of utilization in Task Manager. From what I heard, CPU is running at near 100% capacity in DOS OS or in the BIOS MAIN screen. Is this caused by lack of CPU optimization in DOS OS?

  Read the article

• I am looking for a solution for moving around 3TB offsite? any ideas?

  - by Kevin

  I am looking for a solution for moving around 3TB offsite? any ideas? Tapes take too long to backup, and offsite solutions would cost in the range of around 1000$ per month. Are hardrives a solution? Any idea's even ones I have shot down would be appreciated. Thank you.

  Read the article

• Should I use nginx exclusively, or have it as a proxy to Tomcat (performance related)?

  - by Kevin

  I've planned to create a website that'll be pretty heavy on dynamic content, and want to know what would be the wisest choice for part of my webstack. Right now I'm trying to decide whether I should develop upon nginx, using PHP to deliver the dynamic content, or use nginx as a proxy to Tomcat and use servlets to deliver the dynamic content. I have a good amount of experience with Java, JSP, and servlets, so that's a plus right off the bat. Also, since it is a compiled language, it will execute faster than PHP (it is implied here that Java is around 37x faster than PHP) , and will create the web pages faster. I have no experience with PHP, however i'm under the impression that it is easy to pick up. It's slower than Java, but since the client will only be communicating with nginx, I'm thinking that serving the dynamically created web pages to the client will be faster this way. Considering these things, i'd like to know: Are my assumptions correct? Where does the bottleneck occur: creating pages or serving them back to the client? Will proxying Tomcat with nginx give me any of nginx performance benefits if I'm going to be using Tomcat to generate the dynamic content (keeping in mind my site is going to be heavy in this aspect)? I don't mind learning PHP if, in the end, its going to give me the best performance. I just want to know what would be the best choice from that standpoint.

  Read the article

• How to Set Up an SMTP Submission Server on Linux

  - by Kevin Cox

  I was trying to set up a mail server with no luck. I want it to accept mail from authenticated users only and deliver them. I want the users to be able to connect over the internet. Ideally the mail server wouldn't accept any incoming mail. Essentially I want it to accept messages on a receiving port and transfer them to the intended recipient out port 25. If anyone has some good links and guides that would be awesome. I am quite familiar with linux but have never played around with MTA's and am currently running debian 6. More Specific Problem! Sorry, that was general and postfix is complex. I am having trouble enabling the submission port with encryption and authentication. What Works: Sending mail from the local machine. (sendmail [email protected]). Ports are open. (25 and 587) Connecting to 587 appears to work, I get a "need to starttls" warning and starttls appears to work. But when I try to connect with the next command I get the error below. # openssl s_client -connect localhost:587 -starttls smtp CONNECTED(00000003) depth=0 /CN=localhost.localdomain verify error:num=18:self signed certificate verify return:1 depth=0 /CN=localhost.localdomain verify return:1 --- Certificate chain 0 s:/CN=localhost.localdomain i:/CN=localhost.localdomain --- Server certificate -----BEGIN CERTIFICATE----- MIICvDCCAaQCCQCYHnCzLRUoMTANBgkqhkiG9w0BAQUFADAgMR4wHAYDVQQDExVs b2NhbGhvc3QubG9jYWxkb21haW4wHhcNMTIwMjE3MTMxOTA1WhcNMjIwMjE0MTMx OTA1WjAgMR4wHAYDVQQDExVsb2NhbGhvc3QubG9jYWxkb21haW4wggEiMA0GCSqG SIb3DQEBAQUAA4IBDwAwggEKAoIBAQDEFA/S6VhJihP6OGYrhEtL+SchWxPZGbgb VkgNJ6xK2dhR7hZXKcDtNddL3uf1YYWF76efS5oJPPjLb33NbHBb9imuD8PoynXN isz1oQEbzPE/07VC4srbsNIN92lldbRruDfjDrAbC/H+FBSUA2ImHvzc3xhIjdsb AbHasG1XBm8SkYULVedaD7I7YbnloCx0sTQgCM0Vjx29TXxPrpkcl6usjcQfZHqY ozg8X48Xm7F9CDip35Q+WwfZ6AcEkq9rJUOoZWrLWVcKusuYPCtUb6MdsZEH13IQ rA0+x8fUI3S0fW5xWWG0b4c5IxuM+eXz05DvB7mLyd+2+RwDAx2LAgMBAAEwDQYJ KoZIhvcNAQEFBQADggEBAAj1ib4lX28FhYdWv/RsHoGGFqf933SDipffBPM6Wlr0 jUn7wler7ilP65WVlTxDW+8PhdBmOrLUr0DO470AAS5uUOjdsPgGO+7VE/4/BN+/ naXVDzIcwyaiLbODIdG2s363V7gzibIuKUqOJ7oRLkwtxubt4D0CQN/7GNFY8cL2 in6FrYGDMNY+ve1tqPkukqQnes3DCeEo0+2KMGuwaJRQK3Es9WHotyrjrecPY170 dhDiLz4XaHU7xZwArAhMq/fay87liHvXR860tWq30oSb5DHQf4EloCQK4eJZQtFT B3xUDu7eFuCeXxjm4294YIPoWl5pbrP9vzLYAH+8ufE= -----END CERTIFICATE----- subject=/CN=localhost.localdomain issuer=/CN=localhost.localdomain --- No client certificate CA names sent --- SSL handshake has read 1605 bytes and written 354 bytes --- New, TLSv1/SSLv3, Cipher is DHE-RSA-AES256-SHA Server public key is 2048 bit Secure Renegotiation IS supported Compression: NONE Expansion: NONE SSL-Session: Protocol : TLSv1 Cipher : DHE-RSA-AES256-SHA Session-ID: E07926641A5EF22B15EB1D0E03FFF75588AB6464702CF4DC2166FFDAC1CA73E2 Session-ID-ctx: Master-Key: 454E8D5D40380DB3A73336775D6911B3DA289E4A1C9587DDC168EC09C2C3457CB30321E44CAD6AE65A66BAE9F33959A9 Key-Arg : None Start Time: 1349059796 Timeout : 300 (sec) Verify return code: 18 (self signed certificate) --- 250 DSN read:errno=0 If I try to connect from evolution I get the following error: The reported error was "HELO command failed: TCP connection reset by peer".

  Read the article

• Change the title of a terminal (Gnome)

  - by Kevin

  I would like to customize the name of the tab in Tilda (I guess that it doesn't change anything from the Gnome-terminal's behavior), but I can't find the exact sequence ... so far, I figured out that Bash does it when displaying my PS1 prompt: echo $PS1 \[\e]0;HELLO\a\]\[\033[01;32m\]\u\[\033[00m\]@\[\033[1;35m\]\h\[\033[00m\]:\[\033[01;34m\]\[\033[00m\] I guess that \[\e]0;HELLO\a\] is responsible for the title to be set to 'HELLO', but when I start echo -ne "\[\e]0;HELLO WORLD\a\]" only writes '[]' what's wrong with my command ?

  Read the article

• Is there any way of preventing .csv files being converted into excel format

  - by Kevin Trainer

  I'm trying to work with an automated testing tool which can use .csv files as its data sourse. After saving a notepad file containing a number of fields and data seperated by commas as .csv it appears to have been converted to an excel file. When I run the test, only the first line of values is identified and can be run within the automated test. Not sure if this is expected with the testing product (www.badboy.co.au), but just wondered if there was a way of preventing excel from taking control of the .csv file? Any helpfull feedback would be great.

  Read the article

• ISA bus on newer computers

  - by Kevin Ivarsen

  Are there companies that sell new computers that support old ISA bus expansion cards? We have an aging computer running DOS that operates some machinery via an ISA interface board. Updated versions of this board (e.g. PCI, USB) are not available, and I am concerned about the long-term reliability of the 8+ year old computers we currently keep around as backups. If these newer ISA-capable machines exist, are there any general gotchas to be aware of in terms of compatibility with older expansion boards, ability to run DOS, etc.?

  Read the article

• Enabling "USB Printing Support" in Windows 7

  - by Kevin Dente

  I'm trying to use an old parallel-port based printer with a USB-to-parallel port adapter on Windows 7. When I plug it into the USB port on the computer it's listed as an unrecognized device. I know that these cables typically use the "USB Printing Support" driver with makes USB ports show up as printer ports in the printer dialog. Is there a way to manually add USB Printing Support to Windows 7, since it isn't being added automatically?

  Read the article

• Hardware for Capturing Packets

  - by Kevin

  One of my clients is a small school district in Texas. Like any school, they often have problems with network'd peripherals such as printers, et al. It would be nice to be able to simply "listen" to what the printer and PC are saying to each other (or not saying more importantly)... The problem is that I can't find old-style "hubs" anymore, and even if I could, it's not a long-term solution. All of the devices that I have found to replicate the purpose of a simple hub are either $100+ or are difficult to throw into a networking tool kit (aka my backpack)... Now that hubs are dead, what's the new low-cost standard for simple packet capture in the networking world?

  Read the article

• PC won't boot from IDE HDD when SATA data drive connected

  - by Kevin

  I have an old Pentium 4 system running XP. The machine is set up as an HTPC. It was set up and running well with 1 SATA drive as a boot drive, another SATA drive to store TV recordings, and an IDE drive to store more recordings. Last week the original boot drive (a SATA drive) failed. The BIOS would no longer recognize it. I had a disused IDE drive hanging around that was large enough for the OS, so I reformatted it and installed XP on it. Now the system will only boot if I do not connect the remaining healthy SATA data drive. All three drives are recognized by the BIOS, and I have set the boot order so that the IDE drive with XP on it has top priority, but after the BIOS recognizes the drives, etc. I just get a black screen. I know the SATA drive is functional, because if I hot plug the drive AFTER the system is booted (I know I'm not supposed to do this), I can go into the control panels and mount the drive, and see all the files and folders on it in Windows Explorer. Any suggestions on what is going on and how to fix it? Many thanks.

  Read the article

• What happens to missed writes after a zpool clear?

  - by Kevin

  I am trying to understand ZFS' behaviour under a specific condition, but the documentation is not very explicit about this so I'm left guessing. Suppose we have a zpool with redundancy. Take the following sequence of events: A problem arises in the connection between device D and the server. This causes a large number of failures and ZFS therefore faults the device, putting the pool in degraded state. While the pool is in degraded state, the pool is mutated (data is written and/or changed.) The connectivity issue is physically repaired such that device D is reliable again. Knowing that most data on D is valid, and not wanting to stress the pool with a resilver needlessly, the admin instead runs zpool clear pool D. This is indicated by Oracle's documentation as the appropriate action where the fault was due to a transient problem that has been corrected. I've read that zpool clear only clears the error counter, and restores the device to online status. However, this is a bit troubling, because if that's all it does, it will leave the pool in an inconsistent state! This is because mutations in step 2 will not have been successfully written to D. Instead, D will reflect the state of the pool prior to the connectivity failure. This is of course not the normative state for a zpool and could lead to hard data loss upon failure of another device - however, the pool status will not reflect this issue! I would at least assume based on ZFS' robust integrity mechanisms that an attempt to read the mutated data from D would catch the mistakes and repair them. However, this raises two problems: Reads are not guaranteed to hit all mutations unless a scrub is done; and Once ZFS does hit the mutated data, it (I'm guessing) might fault the drive again because it would appear to ZFS to be corrupting data, since it doesn't remember the previous write failures. Theoretically, ZFS could circumvent this problem by keeping track of mutations that occur during a degraded state, and writing them back to D when it's cleared. For some reason I suspect that's not what happens, though. I'm hoping someone with intimate knowledge of ZFS can shed some light on this aspect.

  Read the article

• Copy an existing OS X install from another drive

  - by Kevin Burke

  I just bought a new solid state drive, and I'd like to copy all of the files and setup from my current Mac OS X hard drive onto it. What is the best way to do this? I have a 1TB external hard drive, my drive backed up on Time Machine, and Snow Leopard on a DMG, but no external mount for the SSD, and no install DVD (it's at my parents house, promise). I'm familiar with the command line and booting up Mac OS X from a hard drive.

  Read the article

• Shortcuts located in "D:\Program Data\..." not working even though they're pointing to the right targets (Windows 7)

  - by Kevin

  I just made a fresh install of my windows 7 home premium using my laptop's recovery disks (HP Pavilion dv6-2151cl) using minimal settings. After install, I set up "Program Data" and "Users" to my D partition to save space changing the folders in the registry. Then I updated windows (including W7 SP1), and installed all other programs. After installing all other programs I noticed that the icons of all new programs (not included in the windows install) in "All Programs" had a blank sheet as icon and they don't do anything. Looked into "D:\Program Data\Microsoft\Windows\Start Menu\Programs" in the windows explorer and the same is true there. All the shortcuts in C: and "D:\Users..." work both in the "Windows Explorer" and "All Programs". Also I noticed that the shortcuts do display the right icons inside the "open" dialog boxes. And if I copy the shortcuts in "D:\Program Data..." to the desktop they also work as expected. I checked file association for .lnk and it was OK, but also tried the registry fixers for this file association and they had no effect. There are no missing programs that I can tell in the "All Programs" menu, the just don't do anything if they lay in "D:\Program Data...". Any thoughts on how to make Windows 7 treat shortcuts in "D:\Program Data..." as they should?

  Read the article

• Enabling "USB Printing Support" in Windows 7

  - by Kevin Dente

  I'm trying to use an old parallel-port based printer with a USB-to-parallel port adapter on Windows 7. When I plug it into the USB port on the computer it's listed as an unrecognized device. I know that these cables typically use the "USB Printing Support" driver with makes USB ports show up as printer ports in the printer dialog. Is there a way to manually add USB Printing Support to Windows 7, since it isn't being added automatically?

  Read the article

• Running multipul lines through a server.

  - by Kevin Roberson

  I am looking to buy numbers in bulk on DIDx.net. After I purchase the numbers in a particular area code, I want to forward those numbers to other numbers that are outside of that area code. This way it will be seen as a local call versus long distance. I have the customers but I don't have the system I need. I have read about Asterisk, VOIP, SIP, and BYOH. But I have no clue what will be the best system for me. Does anyone have any idea what my next step should be when it comes to hardware and software? Or what type of operating system I should use? I basically want to set up a system like GoogleVoice & Phonebooth.

  Read the article

• Compiling PHP with cURL and SSL support on Redhat EC5

  - by Kevin Sedgley

  I don't even know where to begin to be honest. Trying to use an external API that requires SSL connections, I discover that SSL in needed on cURL, but this (apparently) requires PHP to be reinstalled and compiled with cURL / SSL support. Not really experienced with compiling PHP, and I'm not sure if our server even has make or build, the only luck I've had is with rpm's before. This really isn't in my job description. Any help most most welcome!

  Read the article

• How can I change the amount and size of Linux ramdisks (/dev/ram0 - /dev/ram15)?

  - by Kevin S.

  Using Linux, when I boot I automatically have 16 16MB ramdisks, however, I would like to create one really large ramdisk to test some software. I found that I can adjust the size of the ramdisks already on the system with the kernel boot parameter ramdisk_size however, this makes all 16 ramdisks (/dev/ram0 - /dev/ram15) the size that is specified. So if I want to create a 1GB ramdisk, I would need 16GB of memory. Basically, I want to create one 10GB ramdisk which would be /dev/ram0. How would I go about doing that? I assume there is a kernel boot parameter, but I just haven't found it.

  Read the article

• How do you use Time Capsule for MAC controlled Internet?

  - by Kevin Perttula

  I'm using an Internet Provider that requires a username and password to log in; the prompt shows up as soon as you open a web browser. Because of this, I can only have one device online at a time. How can I get my Time Capsule to essentially log in as the user and allow other devices to connect through it. My Time Capsule has worked with other ISPs that don't require the user log in, but I recently moved. I may be wrong about how the ISP is allowing access, I wasn't sure how to describe the problem. Thanks.

  Read the article

• Is allowing remote Sql Server Management Studio safe?

  - by dave thieben

  I administer a website that runs on IIS on one box, and SQL Server 2008 Workgroup on another box. typically I remote into the DB box and run SSMS to work on the db, but I would like to be able to access the db directly with SSMS on my local box. I've seen the other questions about allowing remote access to the database, but my question is, is this safe? I'm concerned that I'm opening a hole in the firewall and potential for hack attempts. Is this just a bad idea in general?

  Read the article

• erratic response times with Apache 2.0.52 on redhat 4.

  - by Kevin

  Under load, we've noticed response times from Apache vary greatly for the same 7k image. It can range anywhere from .01 seconds to 25 seconds or greater. Unfortunately, due to corporate policy constraints we are pretty much stuck on Apache 2.0.52. I'm at best an Apache novice so I'm in over my head with this problem. My focus recently has turned to our choice of MPM modules. We use the worker model on a dual core hyper threaded blade. It doesn't appear that swapping is an issue, and I don't see any signs of a hardware problem. I've read that worker is optimal on hardware with many CPU's where prefork it more suitable for our specific hardware profile. I can see conceptually how choosing the wrong MPM could result in this erratic behavior, but I'm not confident that it's the root cause here. Has anyone else seen this type of range in your response times for simple static content? What else should I be looking into here?

  Read the article

• Ping reply not getting to LAN machines but getting in Linux router Gateway

  - by Kevin Parker

  I have configured Ubuntu 12.04 as Gateway machine.its having two interfaces eth0 with ip 192.168.122.39(Static) and eth1 connected to modem with ip address 192.168.2.3(through DHCP). ip-forwarding is enabled in router box. Client machine is configured as: ip address 192.168.122.5 and gateway 192.168.122.39 Client machines can ping router box(192.168.122.39).but when pinged 8.8.8.8 reply is not reaching Client machines but in the tcpdump output on gateway i can see echo request for 8.8.8.8 but never echo reply.Is this because of 122.5 not forwarding request to 2.0 network.Can u please help me in fixing this.

  Read the article

• So confused by these CPU Specs can someone please help me out? THanks!

  - by Kevin

  Intel® Core™ i7-640M (2.8~3.46GHz, 35W) w/4MB Cache - 2 Cores, 4 Threads - 2.5 GT/s SO i'm buying a new laptop, which i have not done in 6 years. So i am not familiar with any of these cpu specs. It was the highest option for intel for this laptop. So i am assuming it is somewhat fast. But i'd like to learn what these specs mean. Any help would be greatly appreciated. i am not really a computer guy but would love to learn about what I am buying. Thanks!

  Read the article

• MS Access 2007 end user access

  - by LtDan

  I need some good advise. I have used Access for many years and I use Sharepoint but never the two combined. My newly created Access db needs to be shared with many users across the organization. The back end is SQL and the old way to distribute the database would be placing the db on a shared drive, connecting their PC ODBC connections to the SQL db and then they would open the database and have at it. This has become the OLD way. What is the best (and simpliest) way to allow the end users to utilize a frontend for data entry/edit reporting etc. Can I create a link through SharePoint and the user just open it from there. Your good advise is greatly approciated.

  Read the article

• Limiting nproc in an upstart job

  - by Kevin Schmid

  What exactly does the stanza limit nproc 20 20 in an Upstart job do? I've read the documentation here (http://upstart.ubuntu.com/wiki/Stanzas#limit), and it seems like it would limit nproc for any process related to the job. However, I don't see this effect when I've added this to my job's conf file - in this specific case, I've confirmed that my test job's single process was able to fork more than 20 child processes. Any advice? Thanks.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

< Previous Page | 94 95 96 97 98 99 100 101 102 103 104 105  | Next Page >