Search Results

Search found 1026 results on 42 pages for 'krishna kumar'.

Page 10/42 | < Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >

  • Impressions from VMworld - Clearing up Misconceptions

    - by Monica Kumar
    Gorgeous sunny weather…none of the usual summer fog…the Oracle Virtualization team has been busy at VMworld in San Francisco this week. From the time exhibits opened on Sunday, our booth staff was fully engaged with visitors. It was great to meet with customers and prospects, and there were many…most with promises to meet again in October at Oracle OpenWorld 2012. Interests and questions ran the gamut - from implementation details to consolidating applications to how does Oracle VM enable rapid application deployment to Oracle support and licensing. All good stuff! Some inquiries are poignant and really help us get at the customer pain points. Some are just based on misconceptions. We’d like to address a couple of common misconceptions that we heard: 1) Rapid deployment of enterprise applications is great but I don’t do this all the time. So why bother? While production applications don’t get updated or upgraded as often, development and QA staging environments are much more dynamic. Also, in today’s Cloud based computing environments, end users expect an entire solution, along with the virtual machine, to be provisioned instantly, on-demand, as and when they need to scale. Whether it’s adding a new feature to meet customer demands or updating applications to meet business/service compliance, these environments undergo change frequently. The ability to rapidly stand up an entire application stack with all the components such as database tier, mid-tier, OS, and applications tightly integrated, can offer significant value. Hand patching, installation of the OS, application and configurations to ensure the entire stack works well together can take days and weeks. Oracle VM Templates provide a much faster path to standing up a development, QA or production stack in a matter of hours or minutes. I see lots of eyes light up as we get to this point of the conversation. 2) Oracle Software licensing on VMware vSphere In the world of multi-vendor IT stacks, understanding license boundaries and terms and conditions for each product in the stack can be challenging.  Oracle’s licensing, though, is straightforward.  Oracle software is licensed per physical processor in the server or cluster where the Oracle software is installed and/or running.  The use of third party virtualization technologies such as VMware is not allowed as a means to change the way Oracle software is licensed.  Exceptions are spelled out in the licensing document labeled “Hard Partitioning". Here are some fun pictures! Visitors to our booth told us they loved the Oracle SUV courtesy shuttles that are helping attendees get to/from hotels. Also spotted were several taxicabs sporting an Oracle banner! Stay tuned for more highlights across desktop and server virtualization as we wrap up our participation at VMworld.

    Read the article

  • Oracle VM Moves into Challenger Position in the Latest Gartner Magic Quadrant

    - by Monica Kumar
    Oracle Innovations boost Oracle VM into Challenger Position in Gartner x86 Server Virtualization Infrastructure Magic Quadrant Oracle VM's placement in the just published Gartner x86 Server Virtualization Infrastructure Magic Quadrant affirms the Oracle strategy and is also supported by strong customer momentum gains. Optimizations delivered in Oracle VM releases during this last year along with easy software access and low cost licensing have moved Oracle’s placement into the Challenger quadrant in a very short time. Oracle continues to focus on delivering a strong integrated virtualization with Oracle VM and the managed stack in the following areas: Integrated management with Oracle VM and all layers of the Oracle stack from hardware to virtualization to cloud Application-Driven virtualization with Oracle VM templates for rapid enterprise application deployment Certified Oracle applications on Oracle VM Complete stack solution offering more values to customers Get a copy of the Magic Quadrant for x86 Server Virtualization Infrastructure report to read more about how Oracle VM rapidly moved up in its new position.

    Read the article

  • How to retrieve packages from an ISO?

    - by Santosh Kumar
    I have an ISO image of BackTrack and I want to try it, but I don't want to mess up my bootloader with installing 2 Linuxes and a Windows. As BackTrack is Debian based I want to use its packages in my current Ubuntu. I tried mounting the ISO with Archive Mounter but whole operating system seems to be in casper/filesystem.squashfs file. I have seen this answer but none of those methods work, because I can't find any pool directory. The only file I suspect is filesystem.squashfs which is 3.3 GB in size. Please help me install tools from BackTrack's ISO.

    Read the article

  • Google Cache showing wrong URL

    - by Sathiya Kumar
    I searched the cache details of the URL http://property.sulekha.com/pune-properties but the Google Cache showing details for property.sulekha.com. I don't know why it's showing like this. Not only for http://property.sulekha.com/pune-properties but also for all the Indian city relates URL's like http://property.sulekha.com/chennai-properties , http://property.sulekha.com/mumbai-properties , http://property.sulekha.com/kolkata-properties etc. Even i don't find these urls in the Google search result. If i search Chennai properties in Google, i find property.sulekha.com and not http://property.sulekha.com/chennai-properties . Why its happening like this? Please let me know

    Read the article

  • Help in decide the partition to install ubuntu

    - by G.Ashwin kumar
    I have a PC running with windows 7 ultimate 64 bit version with 4 gig Ram. I have a 320 gig hard disk , in which I have allocated 120 gig for windows 7, 100 gig for NY files(named ashwin in windows) and rest 80-90 gig partitioned but empty NTFS partition.Now where do I install Ubuntu so that windows and data is safe. I got the option install with windows I selected it , it then shows select drive(SCSI1 (0,0,0) (sda) -320.1 GB ATA WDC WD3200AAJS-6) and allocate driver by dragging the divider below which shows 66.5gb and 59.3 GB respectively. Which one do I go with? I clicked advance partitioning it shows five devices: device , type, m.point ,size.(mb), used(mb)......... /dev/sda1, NTFS, 104 , 35 (windows 7 loader) /dev/sda2, NTFS, 104752, 23604 /dev/sda3, NTFS, 125829, 10161 /dev/sda5, NTFS, 89382, 3221 when I checked size in properties it showed name of drive according to windows, used.Gb, free, total. ashwin, 10.2, 115.7, 125.8 c drive, 23.6, 81.1, 104.8 new volume, 92.6mb, 89.3, 89.4 except mentioned everything in gigabytes.ignore the last dots. I want to install it in new volume or using that space how do I do it? Explain in detail I'm a beginner.

    Read the article

  • How to implement a game launch counter in LibGDX

    - by Vishal Kumar
    I'm writing a game using LibGDX in which I want to save the number of launches of a game in a text file. So, In the create() of my starter class, I have the following code ..but it's not working public class MainStarter extends Game { private int count; @Override public void create() { // Set up the application AppSettings.setUp(); if(SettingsManager.isFirstLaunch()){ SettingsManager.createTextFileInLocalStorage("gamedata"); SettingsManager.writeLine("gamedata", "Launched:"+count ,FileType.LOCAL_FILE ); } else{ SettingsManager.writeLine("gamedata", "Not First launch :"+count++ ,FileType.LOCAL_FILE ); } // // Load assets before setting the screen // ##################################### Assets.loadAll(); // Set the tests screen setScreen(new MainMenuScreen(this, "Main Menu")); } } What is the proper way to do this?

    Read the article

  • How to connect to a WCF service using IP of the host machine where the service is hosted?

    - by Kumar
    I have a secured WCF service (https://<MachineName>:sslport/services) self hosted in a machine. Different instances of same service are deployed in differnt machines. From a client app, I am able to connect to theses services through code, i.e. using ChannelFactory() with the same endpoint address. But if I try to access the service using the endpoint address as https://<ipAddress>:sslport/services replacing machines name with machine IP address, I am getting some error stating "could not establish trust relationship". I know this is an error caused by SSL certificate that it could not establish a trust relationship. Are there any settings or any possibilities to make this work?

    Read the article

  • How to set up Google DFP (DoubleClick for Publishers) for a site?

    - by Manoj Kumar
    I have a website and I have an AdSense account as well. I have integrated AdSense and ads are also getting displayed (480 x 60). Somewhere I read that I can manage the ads that are being shown in my website (480 x 60) and filter out the ads on a CPM/CPC basis. NOTE: I don't have any ads to be displayed on other's websites. I just want to show other's ads on my website. Now, can I use Google DFP to manage the ads? I mean is Google DFP useful for me to filter the ads and get me more revenue?

    Read the article

  • How can I connect to wireless network using a wireless dongle in Ubuntu 11.10?

    - by Ajita Kumar Nayak
    i have dual operating system xp and ubuntu 11.10 and trying to connet internet by using HSDPA 3GPP Release5 Micromax Dongle but it is working in windows xp not in ubuntu.I am unable to connect internet even i have done my edit connection and all the setting using aircel network but unable to connect internet.plz give me a sugession how could i do manually. How can I connect to wireless network using a wireless dongle in Ubuntu 11.10?

    Read the article

  • Google Authorship Image of my blogspot has been disappeared in Google SERP. Why?

    - by Sathiya Kumar
    I have a blogspot and i used my image to appear on the Google SERP for my keywords using Google Authorship Markup. My image was showed for last 2 months but while checking SERP for my blog, i found that my authorship markup is not working. My image, name and G+ followers count is not appearing near my blogspot URL in SERP. I didn't made any changes in my google+ profile or in my blogspot header tag where i had put the authorship code. I tried to find the reason but i didn't find any value answer. May anyone answer this question. Please let me know if you had already experienced like this.

    Read the article

  • ADF How-To #4: Adding a View Criteria and a Search Panel

    - by Vik Kumar
    In this week's How-To we are explaining how to add a view criteria to VO and then use it to create a Search Panel via customization. The detailed steps can be found here . We have also prepared a video walking you through the steps, available via our Youtube Channel. For any questions or comments, please use the comments section below or visit our OTN forum. We are always looking for topic suggestions for additional How-Tos.

    Read the article

  • Which tools helps to start Ubuntu GUI when boot?

    - by Vimal Kumar
    I am on the way to create a Live CD from scratch. I used Virtual Box for this purpose. I installed Ubuntu base from ubuntumini.iso and installed gnome-shell. And installed Remastersys and created a backup.iso. Burned in a CD and boot from a PC. It end in CLI. Not lead to GUI. I tried the same ISO in VirtualBox. But it work properly there. I think I missed some packages which help to start GUI. Can you help me to identify the packages missed to include in the CD?

    Read the article

  • Oracle Virtualization Friday Spotlight - November 8, 2013

    - by Monica Kumar
    Hands-on Private Cloud Simulator In One Hour Submitted by: Doan Nguyen, Senior Principal Product Marketing Director My aeronautics instructor used to say, "you can’t appreciate flying until you take flight." To clarify, this is not about gearing up in a flying squirrel suit and hopping off a cliff (topic for another blog!) but rather about flying an airplane. The idea is to get hands-on with the controls at the cockpit and experience flight before you actually fly a real plane. After the initial 40 hours of flight time, the concept sank in and it really made sense.This concept is what inspired our technical experts to put together the hands-on lab for a private cloud deployment and management self-service model. Yes, we are comparing the lab to a flight simulator! Let’s look at the parallels: To get trained to fly, starting in the simulator gets you off the ground quicker. There is no need to have a real plane to begin with. In a hands-on lab, there is no need for a real server, with networking and real storage installed. All you need is your laptop The simulator is pre-configured, pre-flight check done. Similarly, in a hands-on lab, Oracle VM and Oracle Enterprise Manager are pre-configured and assembled using Oracle VM VirtualBox as the container. Software installations are not needed. After time spent training at the controls, you can really appreciate the practical experience of flying. Along the same lines, the hands-on lab is a guided learning path, without the encumbrances of hardware, software installation, so you can learn about cloud deployment and management.  However, unlike the simulator training, your time investment with the lab is only about an hour and not 40 hours! This hands-on lab takes you through private cloud deployment and management using Oracle VM and  Oracle Enterprise Manager Cloud Control 12c in an Infrastructure as a service IaaS model. You will first configure the IaaS cloud as the cloud administrator and then deploy guest virtual machines (VMs) as a self-service user. Then you are ready to take flight into the cloud! Why not step into the cockpit now!

    Read the article

  • How do I get Catalyst 11.10 with ATI Radeon Mobility HD 5470 working on an HP DV7?

    - by S Kumar
    I have a HP DV7 with a HD 5470 512M card. Installation of the Catalyst 11.10 is repeatedly failing on a fresh install of Ubuntu 11.10. Catalyst 11.8 proprietary drivers were working well with Ubuntu 11.04. I have tried installing directly from the .run and generating the distribution specific packages. Nothing has worked. After installation which goes through successfully, the system hangs on reboot after the flashing dots. I have to replace the /etc/X11/xorg.conf to get the X working. I have followed instructions as per the http://wiki.cchtml.com/index.php/Main_Page wiki. Request for support to ATI/AMD gives the response that this model is unsupported on Linux by HP :). Updated 14-Nov I have reverted back to the open source drivers which work well enough for me.

    Read the article

  • Sound card not detected in 13.04

    - by Ganessh Kumar R P
    I have a problem with my sound card. I don't have volume up or down option anywhere. In the setting -> Sound I don't have any card detected. But when I run the command sudo aplay -l, I get the following output **** List of PLAYBACK Hardware Devices **** Failed to create secure directory (/home/ganessh/.config/pulse): Permission denied card 0: MID [HDA Intel MID], device 0: STAC92xx Analog [STAC92xx Analog] Subdevices: 0/1 Subdevice #0: subdevice #0 card 1: NVidia [HDA NVidia], device 3: HDMI 0 [HDMI 0] Subdevices: 1/1 Subdevice #0: subdevice #0 card 1: NVidia [HDA NVidia], device 7: HDMI 0 [HDMI 0] Subdevices: 1/1 Subdevice #0: subdevice #0 card 1: NVidia [HDA NVidia], device 8: HDMI 0 [HDMI 0] Subdevices: 1/1 Subdevice #0: subdevice #0 card 1: NVidia [HDA NVidia], device 9: HDMI 0 [HDMI 0] Subdevices: 1/1 Subdevice #0: subdevice #0 And the command lspci -v | grep -A7 -i "audio" outputs 00:1b.0 Audio device: Intel Corporation 5 Series/3400 Series Chipset High Definition Audio (rev 06) Subsystem: Dell Device 02a2 Flags: bus master, fast devsel, latency 0, IRQ 48 Memory at f0f20000 (64-bit, non-prefetchable) [size=16K] Capabilities: <access denied> Kernel driver in use: snd_hda_intel 00:1c.0 PCI bridge: Intel Corporation 5 Series/3400 Series Chipset PCI Express Root Port 1 (rev 06) (prog-if 00 [Normal decode]) -- 02:00.1 Audio device: NVIDIA Corporation GF106 High Definition Audio Controller (rev a1) Subsystem: Dell Device 02a2 Flags: bus master, fast devsel, latency 0, IRQ 17 Memory at d3efc000 (32-bit, non-prefetchable) [size=16K] Capabilities: <access denied> Kernel driver in use: snd_hda_intel 07:00.0 Network controller: Intel Corporation Ultimate N WiFi Link 5300 So, I assume that the drivers are properly installed but still I don't get any option in the settings or volume control. The same card used to work well back in 2010 versions(04 and 10) Any help is appreciated. Thanks

    Read the article

  • How should I determine direction from a phone's orientation & accelerometer?

    - by Manoj Kumar
    I have an Android application which moves a ball based on the orientation of the phone. I've been using the following code to extract the data - but how do I use it to determine what direction the ball should actually travel in? public void onSensorChanged(int sensor, float[] values) { // TODO Auto-generated method stub synchronized (this) { Log.d("HIIIII :- ", "onSensorChanged: " + sensor + ", x: " + values[0] + ", y: " + values[1] + ", z: " + values[2]); if (sensor == SensorManager.SENSOR_ORIENTATION) { System.out.println("Orientation X: " + values[0]); System.out.println("Orientation Y: " + values[1]); System.out.println("Orientation Z: " + values[2]); } if (sensor == SensorManager.SENSOR_ACCELEROMETER) { System.out.println("Accel X: " + values[0]); System.out.println("Accel Y: " + values[1]); System.out.println("Accel Z: " + values[2]); } } }

    Read the article

  • Testing web applications written in java

    - by Vinoth Kumar
    How do you test the web applications (both server side and client side code)? The testing method has to work irrespective of the framework used (struts, spring web mvc) etc. I am using Java for the server side code, Javascript and HTML for the client side code. This is the sample test case of what I am talking about: 1. When you click on a link, the pop up opens. 2. Change some value in the pop up (say a drop down value) and it gets saved in the DB. 3. Click the popup again, you get the changed values. Can we simulate this kind of thing using unit test cases? Is JUnit enough for this?

    Read the article

  • How to use unused space in ubuntu

    - by Ravi.Kumar
    I installed ubuntu on my machine with only 80 GB of memory anticipating that I will remove it later but now I want to keep it forever (until I am frustrated with linux). I have 500 GB in my machine and now I want to use that raw 420 GB of space. How I can I do that ? with "space/memory" I am referring to secondary memory not Ram. Here is output of : sudo fdisk -l Disk /dev/sda: 500.1 GB, 500107862016 bytes 255 heads, 63 sectors/track, 60801 cylinders, total 976773168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x000dcb77 Device Boot Start End Blocks Id System /dev/sda1 * 2048 136718335 68358144 83 Linux

    Read the article

  • Attending MySQL Connect? Your Opinion Matters.

    - by Monica Kumar
    Take the MySQL Connect 2012 Survey Thanks to everyone who is at the first ever MySQL Connect Conference in San Francisco this weekend! Don't forget to take your Conference and Session Surveys. Your opinions help shape next year's conference. Take a survey for each of the sessions you attend and be entered into a drawing for one prize for $200 American Express Gift Certificate. Fill in the daily conference survey and be entered into a drawing for one prize for a $500 American Express Gift Card Surveys are located here. Make your opinion count! Take the survey now. Congratulations to Robin Schumacher from DataStax as he is the winner of the Saturday survey!

    Read the article

  • Object of type 'customObject' cannot be converted to type 'customObject'.

    - by Phani Kumar PV
    i am receiving the follwing error when i am invoking a custom object "Object of type 'customObject' cannot be converted to type 'customObject'." Following is the scenario when i am getting the error i am invoking a method in a dll dynamically. Load an assembly CreateInstance.... calling MethodInfo.Invoke() passing int, string as a parameter for my method is working fine = No exceptions are thrown. But if I try and pass a one of my own custom class objects as a parameter, then I get an ArgumentException exception, and it is not either an ArgumentOutOfRangeException or ArgumentNullException. "Object of type 'customObject' cannot be converted to type 'customObject'." I am doing this in a web application. The class file containing the method is in a different proj . also the custom object is a sepearte class in the same file. there is no such thing called a static aseembly in my code. I am trying to invoke a webmethod dynamically. this webmethod is having the customObject type as an input parameter. So when i invoke the webmethod i am dynamically creating the proxy assembly and all. From the same assembly i am trying to create an instance of the cusotm object assinging the values to its properties and then passing this object as a parameter and invoking the method. everything is dynamic and nothing is created static.. :( add reference is not used. Following is a sample code i tried to create it public static object CallWebService(string webServiceAsmxUrl, string serviceName, string methodName, object[] args) { System.Net.WebClient client = new System.Net.WebClient(); //-Connect To the web service using (System.IO.Stream stream = client.OpenRead(webServiceAsmxUrl + "?wsdl")) { //--Now read the WSDL file describing a service. ServiceDescription description = ServiceDescription.Read(stream); ///// LOAD THE DOM ///////// //--Initialize a service description importer. ServiceDescriptionImporter importer = new ServiceDescriptionImporter(); importer.ProtocolName = "Soap12"; // Use SOAP 1.2. importer.AddServiceDescription(description, null, null); //--Generate a proxy client. importer.Style = ServiceDescriptionImportStyle.Client; //--Generate properties to represent primitive values. importer.CodeGenerationOptions = System.Xml.Serialization.CodeGenerationOptions.GenerateProperties; //--Initialize a Code-DOM tree into which we will import the service. CodeNamespace nmspace = new CodeNamespace(); CodeCompileUnit unit1 = new CodeCompileUnit(); unit1.Namespaces.Add(nmspace); //--Import the service into the Code-DOM tree. This creates proxy code //--that uses the service. ServiceDescriptionImportWarnings warning = importer.Import(nmspace, unit1); if (warning == 0) //--If zero then we are good to go { //--Generate the proxy code CodeDomProvider provider1 = CodeDomProvider.CreateProvider("CSharp"); //--Compile the assembly proxy with the appropriate references string[] assemblyReferences = new string[5] { "System.dll", "System.Web.Services.dll", "System.Web.dll", "System.Xml.dll", "System.Data.dll" }; CompilerParameters parms = new CompilerParameters(assemblyReferences); CompilerResults results = provider1.CompileAssemblyFromDom(parms, unit1); //-Check For Errors if (results.Errors.Count > 0) { StringBuilder sb = new StringBuilder(); foreach (CompilerError oops in results.Errors) { sb.AppendLine("========Compiler error============"); sb.AppendLine(oops.ErrorText); } throw new System.ApplicationException("Compile Error Occured calling webservice. " + sb.ToString()); } //--Finally, Invoke the web service method Type foundType = null; Type[] types = results.CompiledAssembly.GetTypes(); foreach (Type type in types) { if (type.BaseType == typeof(System.Web.Services.Protocols.SoapHttpClientProtocol)) { Console.WriteLine(type.ToString()); foundType = type; } } object wsvcClass = results.CompiledAssembly.CreateInstance(foundType.ToString()); MethodInfo mi = wsvcClass.GetType().GetMethod(methodName); return mi.Invoke(wsvcClass, args); } else { return null; } } } I cant find anything static being done by me. any help is greatly appreciated. Regards, Phani Kumar PV

    Read the article

  • How to set BackGround color to a divider in JSplitPane

    - by Sunil Kumar Sahoo
    I have created a divider in JSplitPane. I am unable to set the color of divider. I want to set the color of divider. please help me how to set color of that divider import javax.swing.; import java.awt.; import java.awt.event.*; public class SplitPaneDemo { JFrame frame; JPanel left, right; JSplitPane pane; int lastDividerLocation = -1; public static void main(String[] args) { SplitPaneDemo demo = new SplitPaneDemo(); demo.makeFrame(); demo.frame.addWindowListener(new WindowAdapter() { public void windowClosing(WindowEvent e) { System.exit(0); } }); demo.frame.show(); } public JFrame makeFrame() { frame = new JFrame(); // Create a horizontal split pane. pane = new JSplitPane(JSplitPane.HORIZONTAL_SPLIT); left = new JPanel(); left.setBackground(Color.red); pane.setLeftComponent(left); right = new JPanel(); right.setBackground(Color.green); pane.setRightComponent(right); JButton showleft = new JButton("Left"); showleft.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(left, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showright = new JButton("Right"); showright.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(right, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showboth = new JButton("Both"); showboth.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); c.remove(pane); c.remove(left); c.remove(right); pane.setLeftComponent(left); pane.setRightComponent(right); c.add(pane, BorderLayout.CENTER); if (lastDividerLocation >= 0) { pane.setDividerLocation(lastDividerLocation); } c.validate(); c.repaint(); } }); JPanel buttons = new JPanel(); buttons.setLayout(new GridBagLayout()); buttons.add(showleft); buttons.add(showright); buttons.add(showboth); frame.getContentPane().add(buttons, BorderLayout.NORTH); pane.setPreferredSize(new Dimension(400, 300)); frame.getContentPane().add(pane, BorderLayout.CENTER); frame.pack(); pane.setDividerLocation(0.5); return frame; } } Thanks Sunil kumar Sahoo

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • SIM to OIM Migration: A How-to Guide to Avoid Costly Mistakes (SDG Corporation)

    - by Darin Pendergraft
    In the fall of 2012, Oracle launched a major upgrade to its IDM portfolio: the 11gR2 release.  11gR2 had four major focus areas: More simplified and customizable user experience Support for cloud, mobile, and social applications Extreme scalability Clear upgrade path For SUN migration customers, it is critical to develop and execute a clearly defined plan prior to beginning this process.  The plan should include initiation and discovery, assessment and analysis, future state architecture, review and collaboration, and gap analysis.  To help better understand your upgrade choices, SDG, an Oracle partner has developed a series of three whitepapers focused on SUN Identity Manager (SIM) to Oracle Identity Manager (OIM) migration. In the second of this series on SUN Identity Manager (SIM) to Oracle Identity Manager (OIM) migration, Santosh Kumar Singh from SDG  discusses the proper steps that should be taken during the planning-to-post implementation phases to ensure a smooth transition from SIM to OIM. Read the whitepaper for Part 2: Download Part 2 from SDGC.com In the last of this series of white papers, Santosh will talk about Identity and Access Management best practices and how these need to be considered when going through with an OIM migration. If you have not taken the opportunity, please read the first in this series which discusses the Migration Approach, Methodology, and Tools for you to consider when planning a migration from SIM to OIM. Read the white paper for part 1: Download Part 1 from SDGC.com About the Author: Santosh Kumar Singh Identity and Access Management (IAM) Practice Leader Santosh, in his capacity as SDG Identity and Access Management (IAM) Practice Leader, has direct senior management responsibility for the firm's strategy, planning, competency building, and engagement deliverance for this Practice. He brings over 12+ years of extensive IT, business, and project management and delivery experience, primarily within enterprise directory, single sign-on (SSO) application, and federated identity services, provisioning solutions, role and password management, and security audit and enterprise blueprint. Santosh possesses strong architecture and implementation expertise in all areas within these technologies and has repeatedly lead teams in successfully deploying complex technical solutions. About SDG: SDG Corporation empowers forward thinking companies to strategize their future, realize their vision, and minimize their IT risk. SDG distinguishes itself by offering flexible business models to fit their clients’ needs; faster time-to-market with its pre-built solutions and frameworks; a broad-based foundation of domain experts, and deep program management expertise. (www.sdgc.com)

    Read the article

  • Pourquoi réinventer la roue quand il y a Runnable ? La startup ambitionne de devenir le « YouTube du Code »

    Pourquoi réinventer la roue quand il y a Runnable ? La startup ambitionne de devenir le « YouTube du Code » Runnable, qui a récemment été lancé par une startup du même nom basée à Palo Alto avec pour objectif la facilitation de la découverte et de la réutilisation de portions de code, a annoncé qu'elle a soulevé une levée de fonds de 2 millions de dollars grâce à la participation de Sierra Ventures, Resolute VC, AngelPad et 500 startups.Yash Kumar Directeur Général et co-fondateur de la start-up...

    Read the article

  • Silverlight Cream for November 08, 2011 -- #1165

    - by Dave Campbell
    In this Issue: Brian Noyes, Michael Crump, WindowsPhoneGeek, Erno de Weerd, Jesse Liberty, Derik Whittaker, Sumit Dutta, Asim Sajjad, Dhananjay Kumar, Kunal Chowdhury, and Beth Massi. Above the Fold: Silverlight: "Working with Prism 4 Part 1: Getting Started" Brian Noyes WP7: "Getting Started with the Coding4Fun toolkit Tile Control" WindowsPhoneGeek LightSwitch: "How to Connect to and Diagram your SQL Express Database in Visual Studio LightSwitch" Beth Massi Shoutouts: Michael Palermo's latest Desert Mountain Developers is up Michael Washington's latest Visual Studio #LightSwitch Daily is up From SilverlightCream.com: Working with Prism 4 Part 1: Getting Started Brian Noyes has a series starting at SilverlightShow about Prism 4 ... this is the first one, so a good time to jump in and pick up on an intro and basic info about Prism plus building your first Prism app. 10 Laps around Silverlight 5 (Part 5 of 10) Michael Crump has Part 5 of his 10-part Silverlight 5 investigation up at SilverlightShow talking about all the various text features added in Silverlight 5 Beta: Text Tracking and Leading, Linked and MultiColumn, OpenType, etc. Getting Started with the Coding4Fun toolkit Tile Control WindowsPhoneGeek takes on the Tile control from the Coding4Fun toolkit... as usual, great tutorial... diagrams, code, explanation Using AppHarbor, Bitbucket and Mercurial with ASP.NET and Silverlight – Part 2 CouchDB, Cloudant and Hammock Erno de Weerd has Part 2 of his trilogy and he's trying to beat David Anson for the long title record :) ... in this episode, he's adding in cloud storage to the mix in a 35-step tutorial. Background Audio Jesse Liberty's talking about background Audio... and no not the Muzak in the elevator (do they still have that?) ... he's tlking about the WP7.1 BackgroundAudioPlayer Using the ToggleSwitch in WinRT/Metro (for C#) Derik Whittaker shows off the ToggleSwitch for WinRT/Metro... not a lot to be said about it, but he says it all :) Part 19 - Windows Phone 7 - Access Phone Contacts Sumit Dutta has Part 19! of his WP7 series up... talking today about getting a phone number from the directory using the PhoneNumberChooserTask ContextMenu using MVVM Asim Sajjad shows how to make the Context Menu ViewModel friendly in this short tutorial. Code to make call in Windows Phone 7 Dhananjay Kumar's latest WP7 post is explaining how to make a call programmatically using the PhoneCallTask launcher. Silverlight Page Navigation Framework - Basic Concept Kunal Chowdhury has a 3-part tutorial series on Silverlight Navigation up. This is the first in the series, and he hits the basics... what constitutes a Page, and how to get started with the navigation framework. How to Connect to and Diagram your SQL Express Database in Visual Studio LightSwitch Beth Massi's latest LightSwitch post is on using the Data Designer to easily crete and model database tables... during development this is in SQL Express, but can be deployed to most SQL server db you like Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

< Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >