Search Results

Search found 8875 results on 355 pages for 'optimized solutions'.

Page 102/355 | < Previous Page | 98 99 100 101 102 103 104 105 106 107 108 109  | Next Page >

  • Recommendations for remote server management software, similar to Puppet or Canonical Landscape?

    - by rmh
    We currently have five Ubuntu 10.04 LTS servers, and keeping them all up-to-date is starting to be a pain. I've been looking into solutions like Puppet and Canonical Landscape. Out of the two I prefer Puppet -- it would be useful to be able to ensure the permissions of various directories on the machines, and define groups and users on the server which are then propagated to clients. Is there any other software in this vein that I should be taking a look at?

    Read the article

  • Monitor File Changes On Windows System

    - by user10487
    I am looking for a utility that can take a snapshot of the files in directories that I am interested in and then compare that snapshot to the current state of the system and show me any files that have been added, changed, or deleted. Does anyone know of solutions that provide this functionality? Thanks, Nate

    Read the article

  • Virtual session on windows xp

    - by dotnet-practitioner
    What is the easiest way to install , setup, and run virtual session on my fresh install on my windows xp computer? I want to be able to browse , install a new software in a new virtual session instead of machine itself. What is available out there? What kind of software it would take and are there any free solutions out there? Easiest solution would be very helpful for me.

    Read the article

  • How do you protect your <appid>.appspot.com domain from DDOS attack?

    - by jacob
    If I want to use CloudFlare to help protect my GAE app via it's custom domain, I still am vulnerable to attacks directly on the .appspot.com domain. How do I mitigate that? I could force redirect appspot.com host requests, such as discussed here: http://stackoverflow.com/questions/1364733/block-requests-from-appspot-com-and-force-custom-domain-in-google-app-engine/ But I would still suffer the load of processing the redirect in my app. Are there any other solutions?

    Read the article

  • How can virtualization be efficient?

    - by pestaa
    As I understand, the virtual machine and the guest OS doubles the amount of abstraction layers (that are computationally relevant) between the user interface and the pure power of the hardware. Some of the said abstraction layers are (emulated) hardware, drivers, IO interfaces, etc. Top-notch virtualization solutions like Xen probably eliminate a few of these complexities, but I still wonder how efficiency is achieved in these environments; and whether manageable cloud servers are really worth the performance price.

    Read the article

  • Show floor-plans online like a map

    - by Quora Feans
    Given a floor-plan, which is too big for any screen, even if it is a 17" one, how can I show it online like a map? It would need further functionality that a browser alone does not have (just zoom in/out the entire image won't do the trick). The image will be breaked down into smaller jpgs, so the user will not have to download the whole floorplan at once.It will need some zoom in/zoom out button, and some way or bookmarking position (x,y). open-source solutions prefered.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • How to prevent dual booted OSes from damaging each other?

    - by user1252434
    For better compatibility and performance in games I'm thinking about installing Windows additionally to Linux. I have security concerns about this, though. Note: "Windows" in the remaining text includes not only the OS but also any software running on it. Regardless of whether it comes included or is additionally installed, whether it is started intentionally or unintentionally (virus, malware). Is there an easy way to achieve the following requirements: Windows MUST NOT be able to kill my linux partition or my data disk neither single files (virus infection) nor overwriting the whole disk Windows MUST NOT be able to read data disk (- extra protection against spyware) Linux may or may not have access to the windows partition both Linux and Windows should have full access to the graphics card this rules out desktop VM solutions for gaming I want the manufacturer's windows graphics card driver Regarding Windows to be unable to destroy my linux install: this is not just the usual paranoia, that has happened to me in the past. So I don't accept "no ext4 driver" as an argument. Once bitten, twice shy. And even if destruction targeted at specific (linux) files is nearly impossible, there should be no way to shred the whole partition. I may accept the risk of malware breaking out of a barrier (e.g. VM) around the whole windows box, though. Currently I have a system disk (SSD) and a data disk (HDD), both SATA. I expect I have to add another disk. If i don't: even better. My CPU is a Intel Core i5, with VT-x and VT-d available, though untested. Ideas I've had so far: deactivate or hide other HDs until reboot at low level possible? can the boot loader (grub) do this for me? tiny VM layer: load windows in a VM that provides access to almost all hardware, except the HDs any ready made software solution for this? Preferably free. as I said: the main problem seems to be to provide full access to the graphics card hardware switch to cut power to disks commercial products expensive and lots of warnings against cheap home built solutions preferably all three hard disks with one switch (one push) mobile racks - won't wear of daily swapping be a problem?

    Read the article

  • Hardware for multipurpose home server

    - by Michael Dmitry Azarkevich
    Hi guys, I'm looking to set up a multipurpose home server and hoped you could help me with the hardware selection. First of all, the services it will provide: Hosting a MySQL database (for training and testing purposes) FTP server Personal Mail Server Home media server So with this in mind I've done some research, and found some viable solutions: A standard PC with the appropriate software (Either second hand or new) A non-solid state mini-ITX system A solid state, fanless mini-ITX system I've also noted the pros and cons of each system: A standard second hand PC with old hardware would be the cheapest option. It could also have lacking processing power, not enough RAM and generally faulty hardware. Also, huge power consumption heat generation and noise levels. A standard new PC would have top-notch hardware and will stay that way for quite some time, so it's a good investment. But again, the main problem is power consumption, heat generation and noise levels. A non-solid state mini-ITX system would have the advantages of lower power consumption, lower cost (as far as I can see) and long lasting hardware. But it will generate noise and heat which will be even worse because of the size. A solid state, fanless mini-ITX system would have all the advantages of a non-solid state mini-ITX but with minimal noise and heat. The main disadvantage is the read\write problems of flash memory. All in all I'm leaning towards a non-solid state mini-ITX because of the read\write issues of flash memory. So, after this overview of what I do know, my questions are: Are all these services even providable from a single server? To my best understanding they are, but then again, I might be wrong. Is any of these solutions viable? If yes, which one is the best for my purposes? If not, what would you suggest? Also, on a more software oriented note: OS wise, I'm planning to run Linux. I'm currently thinking of four options I've been recommended: CentOS, Gentoo, DSL (Damn Small Linux) and LFS (Linux From Scratch). Any thoughts on this? Any other distro you would recomend? Regarding FTP services, I've herd good things about FileZila. Anyone has any experience with that? Do you recommend it? Do you recommend something else? Regarding the Mail service, I know nothing about this except that it exists. Any software you recommend for this task? Home media, same as mail service. Any recommended software? Thank you very much.

    Read the article

  • Circumvent proxy filter that disables the download of EXE files

    - by elgrego
    Do you know of a way to download exe files although the web proxy has a filter in place not to allow this? I have searched for a feature web site that does automatic file renaming. That should certainly make it possible. The solution would take a URL and then change the extension so that it would look to my proxy as I was downloading a .dat file (or similar). There are perhaps other solutions to this problem.

    Read the article

  • unable to type in web browser ubuntu 64bit

    - by mononym
    Hi Guys, I upgraded to 64bit ubuntu and every now and again (quite often though) i am unable to to type into the search box for google in chrome and firefox, i havent tried other browsers as these are the 2 i primarily use. Has anyone else experienced this? any solutions? also i'm unable to drag the slider in youtube (in firefox) to scan through videos.

    Read the article

  • Blocking IP addresses Load Balanced Cluster

    - by Dom
    Hi We're using HAproxy as a front end load balancer / proxy and are looking for solutions to block random IP addresses from jamming the cluster. Is anyone familiar with a conf for HAProxy that can block requests if they exceed a certain threshold from a single IP within a defined period of time. Or can anyone suggest a software solution which could be placed in front of HAProxy to handle this kind of blocking. Thanks Dom--

    Read the article

  • Any way to Sync Google Bookmarks to iPhone OTA?

    - by BenA
    Does anybody know if its possible to sync Google Bookmarks over the air to my iPhone? Either natively or with an App? Googling it only seems to yield solutions involving importing my bookmarks to IE, and then syncing through iTunes. I'd like to skip both of these middlemen if thats at all possible.

    Read the article

  • How do you monitor and react when some scheduled job fails? - general question

    - by Dzida
    Hi, In many projects my team faced problems with 'silent fails' of some important components. There are lot of tasks executed behind the scenes and if somethings fails (either by errors in logic or hardware problems) in most cases responsible person is not notified (or not notified instantly). I know about heavy-weight monitoring tools that could solve some of that problems but there over-complicated and too expensive for our team. I am interested what are your solutions for such problems.

    Read the article

  • Website & Forum sharing the same login credentials ?

    - by Brian
    I am going to be running a small site (100 hits a week maybe) and I am looking for a quick and easy way to share login information between the main website, a control panel (webmin, cpanel, or something), and the forum. One login needed to access any of the three. The website won't have use for the login, per say. But it will display "logged in" when you are on the website. Any custom solutions, any thoughts, logic, examples?

    Read the article

  • Any free Exchange hosts out there?

    - by Pure.Krome
    Hi folks, Are there any free Microsoft Exchange hosted solutions? I understand that Microsoft Exchange is a paid/licensed product, but I was curious if there might be a host that has a free hosting model (e.g. for <= 3 mailboxes per domain)? Larger mail boxes per domain == cost. ?? Finally, please refrain from suggesting other mail services (eg. sendmail, etc).

    Read the article

  • Free web gallery installation that can use existing directory hierarchy in filesystem?

    - by user1338062
    There are several different free software gallery projects (Gallery, Coppermine, etc), but as far as I know each of those creates a copy of imported images in their internal storage, be it directory structure or database). Is there any gallery software that would allow keeping existing directory hierarchy of media files (images, videos), as-is, and just store the meta-data of them in a database? I guess at least various NAS solutions ship with software like this.

    Read the article

  • ffdshow h.264 audio desync

    - by Core Xii
    When I encode video with ffdshow with h.264, the audio is out of sync. At the very beginning of the video, the picture freezes for about 1 second, while the audio plays fine, resulting in the audio being that 1 second ahead of the picture throughout the entire video. Any ideas on possible causes or, obviously, solutions?

    Read the article

  • How to prevent Vista from entering Sleep mode when certain conditions exist?

    - by idyllhands
    Mainly, I would like to prevent my laptop from entering Sleep mode when I am playing music or streaming video. This is on my laptop, so another option that would work would be to prevent sleep mode whenever the laptop is plugged into my tv via HDMI (ie when HDMI port is in use). Or prevent sleep mode whenever there is audio playing.. I am soon upgrading to Windows 7, so solutions using 7 would be great also/instead. Thanks!

    Read the article

  • Virtualization Solution

    - by Xeross
    I have a home server I use for various things, and have recently switched over to using VMs, however I can't seem to find a decent VM solution that does what I want. Xen Connection keeps dropping every few minutes (So this means it's practically unusable), but with ParaVirtOps faster than VMWare ESXi, and I can use software RAID VMWare ESXi Works fine, no connection drops, but I have to run it from USB stick, modify some archive file and I can't use software RAID -- So are there any other solutions out there that do allow me to use software raid, that have a stable network connection, and that also offer paravirtualization

    Read the article

  • Mercurial repositories hosting with different user access levels

    - by kender
    I want to set a few Mercurial 'central' repositories on one machine. There are few things I need to have working though: Each repository should have its own ACL, with different users allowed to push/pull It shouldn't be ssh-based (it shouldn't require users to have shell accounts on that machine) So, I guess that leaves me with some https with basic authentication, right? Are there any working solutions that provide this kind of functions?

    Read the article

< Previous Page | 98 99 100 101 102 103 104 105 106 107 108 109  | Next Page >