Search Results

Search found 49521 results on 1981 pages for 'text size'.

Page 103/1981 | < Previous Page | 99 100 101 102 103 104 105 106 107 108 109 110  | Next Page >

  • Does the size of monitor Matters ?

    - by Arsheep
    I have a old computer , i want to buy a big LCD now the best i can found is Viewsonic's 24" lcd TFT monitor . So will it run without any problems or i need to upgrade the video cards or something too ? The computer is not that much old it has P4 bord and celeron processor with 128 graphics memory . And in properties it shows i can maximum use 1280 x 1024 resolution. I am noob hardware wise So need help on this stuff. Thanks

    Read the article

  • Text template or tool for documentation of computer configurations

    - by mjustin
    I regularly write and update technical documentation which will be used to set up a new virtual machine, or to have a lookup for system dependencies in networks with around 20-50 (server-side) computers. At the moment I use OpenOffice Writer with text tables, and create one document per intranet domain. To improve this documentation, I would like to collect some examples to identify areas where my documents can be improved, regarding general structure and content, to make it easy to read and use not only for me but also for technical staff, helpdesk etc. Are there simple text templates (for example for OpenOffice Writer) or tools (maybe database-driven) for structured documentation of a computer configuration? Such a template / tool should provide required and optional configuration sections, like 'operating system', 'installed services', 'mapped network drives', 'scheduled tasks', 'remote servers', 'logon user account', 'firewall settings', 'hard disk size' ... It is not so much low-level hardware docs but more infrastructure / integration information in these documents (no BIOS settings, MAC addresses).

    Read the article

  • Expanding RAID 1 array size (Adaptec 1420SA controller)

    - by cincura.net
    I have an Adaptec 1420SA controller in server and RAID 1 array created. The old disks slowly started to report S.M.A.R.T errors so I replaced first one, rebuild array and then other one and rebuild the array again. But the new drives are bigger, so I'd like to expand the array to use full disk capacity. Is it somehow possible? In the Adaptec configuration utility, after POST, I didn't found anything that could do it. I still have the old drives, if it helps. The array is used for system (Windows 2008 R2 SP1) booting. Thanks.

    Read the article

  • Optimal Instance Size for EC2 Sharepoint Server

    - by Rob Wilkerson
    I'm surprised that I can't find any info about this, but I'm not a Windows admin and just a novice EC2 user. I have a client who wants to stand up a Sharepoint server on EC2 for internal use. The team is small (10-20) folks and traffic will be light. Mostly, the client is looking for one place to store documents (and revisions of documents) while making access easy for authenticated users anywhere in the world. They've settled on Sharepoint and have other EC2 instances so that seems like the natural fit, but I'm trying to figure out what to recommend for them. I'm currently thinking about a Medium instance. I'm afraid to go smaller because I think Windows would need a fair amount of memory just to run, but I'm very open to suggestions. Any advice would be much appreciated. I expect that the storage itself would happen in an EBS mount, but again, suggestions welcome. Thanks for your input.

    Read the article

  • How to color highlight text in a black/white document easily

    - by Lateron
    I am editing a 96 chapter book. The text is in normal black letters on a white background. What I want to be able to do is: I want to have any changes or additions automatically shown in another (per-selected) color. Without having to a)high lite a word or phrase to be changed or added and then b)going to the toolbar and clicking on the font color In other words I want the original color of the text to remain as it is and any additions or changes to be visible in another color without having to use the toolbar. Can this be done? I use OpenOffice or Word 2007 in Windows 7.

    Read the article

  • Java JRE: Setting default heap size

    - by AndiDog
    I'm having trouble with Java on a virtual server, it always gives me the following error: # java Error occurred during initialization of VM Could not reserve enough space for object heap Could not create the Java virtual machine. I first solved this by using the CACAO virtual machine (of OpenJDK, by putting it first in jvm.cfg), but then I run into problems with my web application (Play! framework based, gives me nasty LinkageErrors). So I cannot use that VM. Instead I'd like to just use the normal server VM and set -Xmx128M by default. How can I do that? Related: this question

    Read the article

  • Text on Cisco ASA console is garbled/missing letters

    - by Some Linux Nerd
    I've actually looked up a number of solutions for this problem and none of them work. There's this Cisco ASA 5505 that I'd like to use, that outputs mildly garbled text with missing characters. I did some googling and found that the most likely problem is a bad baud rate, so I tried all the baud rates, 7N1, 8N2... basically every possibility minicom had. Then I figured (since I can type ok, just not read) that if I factory reset it that it would fix whatever is set wrong with the terminal. That didn't work either. This usb-db9 adapter and console cable work fine on the catalyst switch in our office. My serial settings are 9600 8N1 with no flow control. Anyone know how to fix this? I have an example of the text on pastebin: http://pastebin.com/MAJF0mVU - it's just lots of "Dfaut cnfiuraionfil cotais 1enty." instead of "Default configuration blah blah"

    Read the article

  • Extending hard disk size after hard drive regrow without losing data

    - by Albert Widjaja
    Hi All, I wonder if this is possible to extend or regrow the Linux hard disk partition from 8 GB to 20 GB without losing the existing data on the partition ? at the moment this Ubuntu Linux is deployed on top of VMware and I've just regrow the hard drive from 8 GB into 20 GB but can't see the effect immediately. can anyone suggest how to do this without losing the data ? and I found some strange error message when i do the fdisk -l ?

    Read the article

  • SQL Server 2008 R2 Writing To Text File

    - by zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz
    I used to write to text files from SQL Server using the code listed below: DECLARE @FS INT --File System Object DECLARE @OLEResult INT --Result message/code DECLARE @FileID INT --Pointer to file --Create file system object (OLE Object) EXECUTE @OLEResult = sp_OACreate 'Scripting.FileSystemObject', @FS OUT IF @OLEResult <> 0 PRINT 'Scripting.FileSystemObject.Failed' -----OPEN FILE----- EXECUTE @OLEResult = sp_OAMethod @FS, 'OpenTextFile', @FileID OUT, @FileName, 8, 1 IF @OLEResult <> 0 PRINT 'OpenTextFile.Failed' It appears this is no longer supported in sql server 2008 r2. How should I export to text files in sql server 2008 r2? Link claiming this is no longer supported: http://social.msdn.microsoft.com/Forums/en/transactsql/thread/f8512bec-915c-44a2-ba9d-e679f98ba313

    Read the article

  • finding files that match a precise size: a multiple of 4096 bytes

    - by doub1ejack
    I have several drupal sites running on my local machine with WAMP installed (apache 2.2.17, php 5.3.4, and mysql 5.1.53). Whenever I try to visit the administrative page, the php process seems to die. From apache_error.log: [Fri Nov 09 10:43:26 2012] [notice] Parent: child process exited with status 255 -- Restarting. [Fri Nov 09 10:43:26 2012] [notice] Apache/2.2.17 (Win32) PHP/5.3.4 configured -- resuming normal operations [Fri Nov 09 10:43:26 2012] [notice] Server built: Oct 24 2010 13:33:15 [Fri Nov 09 10:43:26 2012] [notice] Parent: Created child process 9924 [Fri Nov 09 10:43:26 2012] [notice] Child 9924: Child process is running [Fri Nov 09 10:43:26 2012] [notice] Child 9924: Acquired the start mutex. [Fri Nov 09 10:43:26 2012] [notice] Child 9924: Starting 64 worker threads. [Fri Nov 09 10:43:26 2012] [notice] Child 9924: Starting thread to listen on port 80. Some research has led me to a php bug report on the '4096 byte bug'. I would like to see if I have any files whose filesize is a multiple of 4096 bytes, but I don't know how to do that. I have gitBash installed and can use most of the typical linux tools through that (find, grep, etc), but I'm not familiar enough with linux to figure it out on my own. Little help?

    Read the article

  • Nginx: Loopback connection via PHP's getimage size crashes server (Magento's CMS)

    - by Alex
    We were able to trace down a problem that is crashing our NGINX server running Magento until the following point: Background info: Magento Backend has a CMS function with a WYSIWYG editor. This editor loads some pictures via a controller in magento (cms/directive). When we set the NGINX error_log level to info, we get the following lines (line break inserted for better readability): 2012/10/22 18:05:40 [info] 14105#0: *1 client closed prematurely connection, so upstream connection is closed too while sending request to upstream, client: XXXXXXXXX, server: test.local, request: "GET index.php/admin/cms_wysiwyg/directive/___directive/BASEENCODEDIMAGEURL,,/ HTTP/1.1", upstream: "fastcgi://127.0.0.1:9024", host: "test.local" When checking the code in the debugger, the following call does never return (in ´Varien_Image_Adapter_Abstract::getMimeType()` # $this->_fileName is http://test.local/skin/adminhtml/base/default/images/demo-image-not-existing.gif` # $_SERVER['REQUEST_URI'] = http://test.local/admin/cms_wysiwyg/directive/___directive/BASEENCODEDIMAGEURL list($this->_imageSrcWidth, $this->_imageSrcHeight, $this->_fileType, ) = getimagesize($this->_fileName); The filename requests is an URL to the same server which is requesting the script a link to a static .gif that is not existing. Sample URL: http://test.local/skin/adminhtml/base/default/images/demo-image-not-existing.gif When the above line executed, any subsequent request to the NGNIX server does not respond any more. After waiting for around 10 minutes, the NGINX server starts answering requests again. I tried to reproduce the error with a simple test script that only calls getimagesize() with the given URL - but this not crash. It simple leads to an exception saying that the URL could not be loaded (which is fine as the URL is wrong)

    Read the article

  • Event log message size 31885? Windows 2008

    - by testuser
    We recently upgraded our production boxes to Windows 2008 from Windows 2003 servers. Everything works fine except the event logging. We log at max 32000 bytes of data for each message On 2008 servers, event logging fails if number of characters is greater than 31885. Is this new limit on Windows 2008 R2 servers? Any help appreciated. On Win 2003 servers, I am able to log 32000 bytes of data for each log entry.

    Read the article

  • Converting PDF portfolios to plain text (pdftotext?)

    - by Andrea
    I am trying to convert a large number of PDFs (~15000) to plain text using pdftotext. This is working pretty well except for a few of the PDFs (~600) which, I guess, are "PDF portfolios." When I run these PDFs through pdftotext, it just outputs: For the best experience, open this PDF portfolio in Acrobat 9 or Adobe Reader 9, or later. Get Adobe Reader Now! If I do open these PDFs in Adobe Reader, they look like two or more PDFs inside a single file. Has anyone encountered this issue before? Is there any tool I can use to convert these PDFs automatically? (Either directly to text or at least to regular PDFs that pdftotext can then understand.)

    Read the article

  • Why the huge discrepancy in size between two similar zip files

    - by twpc
    I use WinZip to zip entire directories of code and send them to a fellow programmer. He makes changes and sends the directories of code back to me. Ignoring the fact that this is not a good way to keep the code clean when we are both working on it, I notice that his zip files are far smaller than mine, with basically the same data inside (mine range around 36,000 KB, his 2,000 KB). I believe he is also using WinZip. What's going on here, and how can I make mine "more compressed"?

    Read the article

  • Virtually adjusting screen size and position

    - by Mishari
    Hi, I'm working on a display piece which is an LCD monitor that is partially covered and needs to be running an application in full screen in the uncovered portion of the screen. I have tried xvidtune on linux which gives me mode errors and switchresx on macosx which only seems to change resolution but not reposition nor resize (it stretches to full screen anyways). I'm wondering if there's anyway to do this? Practically, I have access to any OS.

    Read the article

  • Printing Booklet Page Size in Adobe Reader 4-in-1

    - by Justin Nathanael Waters
    So I have a 70 page pdf document that I'm trying to condense to a small booklet. I tried creating a formula to manually to perform it but it got ugly fast. 35,36,34,37,17,54,16,55,33,38,32,39,15,56,14,57,31,40,30,41,13,58,12,59 29,42,28,43,11,60,10,61,27,44,26,45,9,62,8,63,25,46,24,47,7,64,6,65 23,48,22,49,5,66,4,67,21,50,20,51,3,68,2,69,19,52,18,53,1,70 Once I print the booklet I should be able to cut the sheets in half and set the bottom half behind the top and staple it for a simple book. Which means Page 1 should have pages 35,36,17,54,34,37,16,55 Page 2 should have pages 33,38,15,56,32,39,14,57 And several pages later Page 9 should have pages 19,52,1,70,18,53 But manually doing this is a headache and it seems like the booklet function should contain functionality that can perform this. I'm using a commercial Konica Minolta C452

    Read the article

  • Replace special text with sed?

    - by user143822
    I'm using CMD on Windows Xp to replace special text with Sed. I'm using this command for replace special characters like $ or * : sed -i "s/\*/123/g;" 1.txt But how command must i use to replace this strings with ciao! in my text files? Is possible? \\ \\\ "" sed.exe -i "s/{\*)(//123/ sed -i "s/\\/123/g;" 1.txt the previous command does not work because i have \, " and other special strings that sed use to make regex.

    Read the article

  • less maximum buffer size?

    - by Tyzoid
    I was messing around with my system and found a novel way to use up memory, but it seems that the less command only holds a limited amount of data before stopping/killing the command. To test, run (careful! uses lots of system memory very fast!) $ cat /dev/zero | less From my testing, it looks like the command is killed after less reaches 2.5 gigabytes of memory, but I can't find anything in the man page that suggests that it would limit it in such a way. In addition, I couldn't find any documentation via the google on the subject. Any light to this quite surprising discovery would be great! System Information: Quad core intel i7, 8gb ram. $ uname -a Linux Tyler-Work 3.13.0-32-generic #57-Ubuntu SMP Tue Jul 15 03:51:08 UTC 2014 x86_64 x86_64 x86_64 GNU/Linux $ less --version less 458 (GNU regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less $ lsb_release -a No LSB modules are available. Distributor ID: Ubuntu Description: Ubuntu 14.04 LTS Release: 14.04 Codename: trusty

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Microsoft Outlook 2007 Limit attachment size

    - by tasmanian_devil
    I have qmail server and authetication on Active Directory. All clients use Microsoft Outlook 2007 as default mail client. A have one central location and several remote location wich are connected with slow link speed connection. I have attachment limit on qmail, but i have problem when client attach file localy and send mail, attachment is been uploaded to qmail server and rejected because exceeded limit. Is it possible to limit attachment localy on MS Outlook 2007? I know that Office 2010 have attachment limitation but i think that is not working on Office 2007.

    Read the article

  • Create text file named after a cell containing other cell data

    - by user143041
    I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

    Read the article

  • Does the size of the monitor Matter?

    - by Arsheep
    I have a old computer, and I want to buy a big LCD. The best I've found so far is Viewsonic's 24" LCD TFT monitor. So will it run without any problems, or do I need to upgrade the video cards or something as well? The computer is not too old: it has P4 board and celeron processor, with 128 graphics memory. And in display properties, it says that the maxium that I can use is 1280 x 1024 resolution. I am noob hardware-wise, so need help on this stuff. Thanks

    Read the article

  • Does the size of the monitor Matter?

    - by Arsheep
    I have a old computer, and I want to buy a big LCD. The best I've found so far is Viewsonic's 24" LCD TFT monitor. So will it run without any problems, or do I need to upgrade the video cards or something as well? The computer is not too old: it has P4 board and celeron processor, with 128 graphics memory. And in display properties, it says that the maxium that I can use is 1280 x 1024 resolution. I am noob hardware-wise, so need help on this stuff. Thanks

    Read the article

  • Does the size of the monitor Matter?

    - by Arsheep
    I have a old computer, and I want to buy a big LCD. The best I've found so far is Viewsonic's 24" LCD TFT monitor. So will it run without any problems, or do I need to upgrade the video cards or something as well? The computer is not too old: it has P4 board and celeron processor, with 128 graphics memory. And in display properties, it says that the maxium that I can use is 1280 x 1024 resolution. I am noob hardware-wise, so need help on this stuff. Thanks

    Read the article

< Previous Page | 99 100 101 102 103 104 105 106 107 108 109 110  | Next Page >