Search Results

Search found 3424 results on 137 pages for 'perl critic'.

Page 106/137 | < Previous Page | 102 103 104 105 106 107 108 109 110 111 112 113  | Next Page >

• apt: how to search using package tags?

  - by depesz

  Some (most?) packages in Debian, have tags. For example: =# apt-cache show squirrelmail | perl -lne 'print if /^Tag:/.../^\S/' Tag: implemented-in::php, interface::web, mail::imap, mail::smtp, mail::user-agent, network::server, protocol::http, protocol::imap, protocol::smtp, role::program, scope::application, use::browsing, use::editing, use::searching, use::transmission, use::viewing, web::TODO, web::application, works-with::mail Section: web But, I can't find a way, to list all packages with given tag. Is it possible?

  Read the article

• How do you update an Excel file (Data Refresh and update formulas) WITHOUT opening the file?

  - by Alex

  I have an Excel file that want to update and save automatically with out having to open it or manually interact with. Manually, I open the file up and hit data refresh which goes and does a SQL query and then hit F9 for the formulas to update and then I just close/save. (I then would mail the file out to people using a perl script or use SAS JMP to run some numbers/charts and also mail them out. Basically I need to script some things which require the XLS file to be updated.)

  Read the article

• negative regexp in Squirm (for Squid). Possible ?

  - by alex8657

  Did someone achieve to do negative regexp (or part of) with Squirm ? I tried negative lookahead things and ifthenelse regexps, but Squirm 1.26 fails to understand them. What i want to do is simply: * If the url begins by 'http://' and contains 'account', then rewrite/redirect to 301:https:// * It the url begins by 'https://' and does NOT contains 'account, then rewrite/redirect to 301:http:// So far, i do that using 2 lines of perl, but squirm redirectors would take less memory

  Read the article

• Is there a setting to limit cgi processes by real time on Apache?

  - by user20936

  I'd like Apache to terminate my perl script after 1 minute if it doesn't complete naturally. Is there a setting in Apache (or other server software) to do this?

  Read the article

• Spamassassin command to tag mail & move mail with a spam score of over 10 to a new folder?

  - by ane

  Have a maildir with tens of thousands of messages in it, about 70% of which are spam. Would like to: Run /usr/local/bin/spamassassin against it, tagging each message if the score is 10 or greater Have a tcsh shell or perl one-liner grep all mails with a spam score of over 10 and move those mails to /tmp/spam What commands can I run to accomplish this? Pseudocode: /usr/local/bin/spamassassin ./Maildir/cur/* -tagscore10 grep "X-Spam-Score: [10-100]" ./Maildir/cur/* | mv %1 /tmp/spam

  Read the article

• Spamassassin one-liner to tag & move mail with an X-Spam-Flag: YES to a new directory?

  - by ane

  Say you have a directory with tens of thousands of messages in it. And you want to separate the spam from the non-spam. Specifically, you would like to: Run spamassassin against the directory, tagging each message with an X-Spam-Flag: YES if it thinks it's spam Have a tcsh shell or perl one-liner grep all mail with the flag and move those mails to /tmp/spam What command can you run to accomplish this? For example, some pseudocode: /usr/local/bin/spamassassin -eL ./Maildir/cur/* | grep "X-Spam-Flag: YES" | mv %1 /tmp/spam

  Read the article

• What is /com/host?

  - by grawity

  The Perl documentation for Sys::Hostname contains: Attempts several methods of getting the system hostname [...]. It tries the first available of [blah blah] , and the file /com/host. If all that fails it croaks. What systems is this /com/host used on? It's a very ungooglable filename, and this is the first time I have heard of it.

  Read the article

• Identify Deprecated Rules on Checkpoint Firewall

  - by Basa

  I've been asked to find the deprecated rules among the thousands of rules in our Checkpoint firewall. I could do it by writing a perl program to analyze the log and lists of objects & rules, but i wanted to know if anybody knows of an easier way before reinventing the wheel. I have access to SmartView Monitor et SmartView Tracker and i wanted to know if anybody knew of a way to achieve my goal with those tools.

  Read the article

• sed or grep or awk to match very very long lines

  - by yael

  more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

  Read the article

• how to change ext of a file in Windows?

  - by Tim

  I downloaded a perl file from some webpage by opening it in my browser and saving it. But the saved file has a file name xxx.pl.txt. How can I save it into a file with pl as its ext? Also how to change a file's ext? Can I do these in command line? Thanks and regards!

  Read the article

• Apache mod_proxy dynamic filter

  - by jrhicks

  How can I configure Apache to ProxyBlock content based on something dynamic such as time-of-day or max-use. Basicly I'm curious about the scriptability of Apache. My web-stumbling leads me to believe I can combine mod-proxy and mod-perl in interesting ways to do dynamic filtering. But I'm pretty lost. What are some general instructions, tutorials, books, technologies to begin scripting Apache (or any suitable proxy).

  Read the article

• cisco parse show command

  - by tintifaxx

  I want to write a perl script which logs into cisco switches via telnet and parses the output of show mac-address-table. The problem is that different switches show me a different field layout. The WS-C3548-XL shows the fields in the order Destination Address Address Type VLAN Destination Port while the C2960 shows it like Vlan Mac Address Type Ports is there a way to tell show to print the fields in a predefined order?

  Read the article

• Web based Apache VHost config dump

  - by childno.de

  Is there a native way to get a simple HTML / XML & XSD output for Apache VHost and Directives? On console I write: apachectl -S If there is no native one, is there an (open) Script / Tool (php, perl, etc.) managing this. I'm NOT looking for server management but just for a "server config overview" which might be (iframe) included in a wiki page for references on different development machines.

  Read the article

• LWJGL - Eclipse error [on hold]

  - by Zarkopafilis

  When I try to run my lwjgl project, an error pops . Here is the log file: # A fatal error has been detected by the Java Runtime Environment: # EXCEPTION_ACCESS_VIOLATION (0xc0000005) at pc=0x6d8fcc0a, pid=5612, tid=900 # JRE version: 6.0_16-b01 Java VM: Java HotSpot(TM) Client VM (14.2-b01 mixed mode windows-x86 ) Problematic frame: V [jvm.dll+0xfcc0a] # If you would like to submit a bug report, please visit: http://java.sun.com/webapps/bugreport/crash.jsp # --------------- T H R E A D --------------- Current thread (0x016b9000): JavaThread "main" [_thread_in_vm, id=900, stack(0x00160000,0x001b0000)] siginfo: ExceptionCode=0xc0000005, reading address 0x00000000 Registers: EAX=0x00000000, EBX=0x00000000, ECX=0x00000006, EDX=0x00000000 ESP=0x001af4d4, EBP=0x001af524, ESI=0x016b9000, EDI=0x016b9110 EIP=0x6d8fcc0a, EFLAGS=0x00010246 Top of Stack: (sp=0x001af4d4) 0x001af4d4: 6da44bd8 016b9110 00000000 001af668 0x001af4e4: ffffffff 22200000 001af620 76ec39c2 0x001af4f4: 001af524 6d801086 0000000b 001afd34 0x001af504: 016b9000 016dd990 016b9000 00000000 0x001af514: 001af5f4 6d9ee000 6d9ef2f0 ffffffff 0x001af524: 001af58c 10008c85 016b9110 00000000 0x001af534: 00000000 000a0554 00000000 00000024 0x001af544: 00000000 00000000 001af6ac 00000000 Instructions: (pc=0x6d8fcc0a) 0x6d8fcbfa: e8 e8 d0 1d 08 00 8b 45 10 c7 45 d8 0b 00 00 00 0x6d8fcc0a: 8b 00 8b 48 08 0f b7 51 26 8b 40 0c 8b 4c 90 20 Stack: [0x00160000,0x001b0000], sp=0x001af4d4, free space=317k Native frames: (J=compiled Java code, j=interpreted, Vv=VM code, C=native code) V [jvm.dll+0xfcc0a] C [lwjgl.dll+0x8c85] C [USER32.dll+0x18876] C [USER32.dll+0x170f4] C [USER32.dll+0x1119e] C [ntdll.dll+0x460ce] C [USER32.dll+0x10e29] C [USER32.dll+0x10e84] C [lwjgl.dll+0x1cf0] j org.lwjgl.opengl.WindowsDisplay.createWindow(Lorg/lwjgl/opengl/DrawableLWJGL;Lorg/lwjgl/opengl/DisplayMode;Ljava/awt/Canvas;II)V+102 j org.lwjgl.opengl.Display.createWindow()V+71 j org.lwjgl.opengl.Display.create(Lorg/lwjgl/opengl/PixelFormat;Lorg/lwjgl/opengl/Drawable;Lorg/lwjgl/opengl/ContextAttribs;)V+72 j org.lwjgl.opengl.Display.create(Lorg/lwjgl/opengl/PixelFormat;)V+12 j org.lwjgl.opengl.Display.create()V+7 j zarkopafilis.koding.io.javafx.Main.main([Ljava/lang/String;)V+16 v ~StubRoutines::call_stub V [jvm.dll+0xecf9c] V [jvm.dll+0x1741e1] V [jvm.dll+0xed01d] V [jvm.dll+0xf5be5] V [jvm.dll+0xfd83d] C [javaw.exe+0x2155] C [javaw.exe+0x833e] C [kernel32.dll+0x51154] C [ntdll.dll+0x5b2b9] C [ntdll.dll+0x5b28c] Java frames: (J=compiled Java code, j=interpreted, Vv=VM code) j org.lwjgl.opengl.WindowsDisplay.nCreateWindow(IIIIZZJ)J+0 j org.lwjgl.opengl.WindowsDisplay.createWindow(Lorg/lwjgl/opengl/DrawableLWJGL;Lorg/lwjgl/opengl/DisplayMode;Ljava/awt/Canvas;II)V+102 j org.lwjgl.opengl.Display.createWindow()V+71 j org.lwjgl.opengl.Display.create(Lorg/lwjgl/opengl/PixelFormat;Lorg/lwjgl/opengl/Drawable;Lorg/lwjgl/opengl/ContextAttribs;)V+72 j org.lwjgl.opengl.Display.create(Lorg/lwjgl/opengl/PixelFormat;)V+12 j org.lwjgl.opengl.Display.create()V+7 j zarkopafilis.koding.io.javafx.Main.main([Ljava/lang/String;)V+16 v ~StubRoutines::call_stub --------------- P R O C E S S --------------- Java Threads: ( = current thread ) 0x0179a400 JavaThread "Low Memory Detector" daemon [_thread_blocked, id=4460, stack(0x0b900000,0x0b950000)] 0x01795400 JavaThread "CompilerThread0" daemon [_thread_blocked, id=5264, stack(0x0b8b0000,0x0b900000)] 0x01790c00 JavaThread "Attach Listener" daemon [_thread_blocked, id=6080, stack(0x0b860000,0x0b8b0000)] 0x01786400 JavaThread "Signal Dispatcher" daemon [_thread_blocked, id=1204, stack(0x0b810000,0x0b860000)] 0x01759c00 JavaThread "Finalizer" daemon [_thread_blocked, id=5772, stack(0x0b7c0000,0x0b810000)] 0x01755000 JavaThread "Reference Handler" daemon [_thread_blocked, id=4696, stack(0x01640000,0x01690000)] =0x016b9000 JavaThread "main" [_thread_in_vm, id=900, stack(0x00160000,0x001b0000)] Other Threads: 0x01751c00 VMThread [stack: 0x015f0000,0x01640000] [id=4052] 0x0179c800 WatcherThread [stack: 0x0b950000,0x0b9a0000] [id=3340] VM state:not at safepoint (normal execution) VM Mutex/Monitor currently owned by a thread: None Heap def new generation total 960K, used 816K [0x037c0000, 0x038c0000, 0x03ca0000) eden space 896K, 91% used [0x037c0000, 0x0388c2c0, 0x038a0000) from space 64K, 0% used [0x038a0000, 0x038a0000, 0x038b0000) to space 64K, 0% used [0x038b0000, 0x038b0000, 0x038c0000) tenured generation total 4096K, used 0K [0x03ca0000, 0x040a0000, 0x077c0000) the space 4096K, 0% used [0x03ca0000, 0x03ca0000, 0x03ca0200, 0x040a0000) compacting perm gen total 12288K, used 2143K [0x077c0000, 0x083c0000, 0x0b7c0000) the space 12288K, 17% used [0x077c0000, 0x079d7e38, 0x079d8000, 0x083c0000) No shared spaces configured. Dynamic libraries: 0x00400000 - 0x00424000 C:\Program Files\Java\jre6\bin\javaw.exe 0x77550000 - 0x7768e000 C:\Windows\SYSTEM32\ntdll.dll 0x75a80000 - 0x75b54000 C:\Windows\system32\kernel32.dll 0x758d0000 - 0x7591b000 C:\Windows\system32\KERNELBASE.dll 0x759e0000 - 0x75a80000 C:\Windows\system32\ADVAPI32.dll 0x76070000 - 0x7611c000 C:\Windows\system32\msvcrt.dll 0x77250000 - 0x77269000 C:\Windows\SYSTEM32\sechost.dll 0x771a0000 - 0x77241000 C:\Windows\system32\RPCRT4.dll 0x76eb0000 - 0x76f79000 C:\Windows\system32\USER32.dll 0x76e60000 - 0x76eae000 C:\Windows\system32\GDI32.dll 0x77770000 - 0x7777a000 C:\Windows\system32\LPK.dll 0x75fd0000 - 0x7606e000 C:\Windows\system32\USP10.dll 0x770b0000 - 0x770cf000 C:\Windows\system32\IMM32.DLL 0x770d0000 - 0x7719c000 C:\Windows\system32\MSCTF.dll 0x7c340000 - 0x7c396000 C:\Program Files\Java\jre6\bin\msvcr71.dll 0x6d800000 - 0x6da8b000 C:\Program Files\Java\jre6\bin\client\jvm.dll 0x73a00000 - 0x73a32000 C:\Windows\system32\WINMM.dll 0x75610000 - 0x7565b000 C:\Windows\system32\apphelp.dll 0x6d7b0000 - 0x6d7bc000 C:\Program Files\Java\jre6\bin\verify.dll 0x6d330000 - 0x6d34f000 C:\Program Files\Java\jre6\bin\java.dll 0x6d290000 - 0x6d298000 C:\Program Files\Java\jre6\bin\hpi.dll 0x776e0000 - 0x776e5000 C:\Windows\system32\PSAPI.DLL 0x6d7f0000 - 0x6d7ff000 C:\Program Files\Java\jre6\bin\zip.dll 0x10000000 - 0x1004c000 C:\Users\theo\Desktop\workspace\JavaFX1\lib\natives\windows\lwjgl.dll 0x5d170000 - 0x5d238000 C:\Windows\system32\OPENGL32.dll 0x6e7b0000 - 0x6e7d2000 C:\Windows\system32\GLU32.dll 0x70620000 - 0x70707000 C:\Windows\system32\DDRAW.dll 0x70610000 - 0x70616000 C:\Windows\system32\DCIMAN32.dll 0x75b60000 - 0x75cfd000 C:\Windows\system32\SETUPAPI.dll 0x759b0000 - 0x759d7000 C:\Windows\system32\CFGMGR32.dll 0x76d70000 - 0x76dff000 C:\Windows\system32\OLEAUT32.dll 0x75db0000 - 0x75f0c000 C:\Windows\system32\ole32.dll 0x758b0000 - 0x758c2000 C:\Windows\system32\DEVOBJ.dll 0x74060000 - 0x74073000 C:\Windows\system32\dwmapi.dll 0x74b60000 - 0x74b69000 C:\Windows\system32\VERSION.dll 0x745f0000 - 0x7478e000 C:\Windows\WinSxS\x86_microsoft.windows.common-controls_6595b64144ccf1df_6.0.7600.16661_none_420fe3fa2b8113bd\COMCTL32.dll 0x75d50000 - 0x75da7000 C:\Windows\system32\SHLWAPI.dll 0x74370000 - 0x743b0000 C:\Windows\system32\uxtheme.dll 0x22200000 - 0x22206000 C:\Program Files\ESET\ESET Smart Security\eplgHooks.dll VM Arguments: jvm_args: -Djava.library.path=C:\Users\theo\Desktop\workspace\JavaFX1\lib\natives\windows -Dfile.encoding=Cp1253 java_command: zarkopafilis.koding.io.javafx.Main Launcher Type: SUN_STANDARD Environment Variables: PATH=C:/Program Files/Java/jre6/bin/client;C:/Program Files/Java/jre6/bin;C:/Program Files/Java/jre6/lib/i386;C:\Perl\site\bin;C:\Perl\bin;C:\Ruby200\bin;C:\Program Files\Common Files\Microsoft Shared\Windows Live;C:\Windows\system32;C:\Windows;C:\Windows\System32\Wbem;C:\Windows\System32\WindowsPowerShell\v1.0\;C:\Program Files\Windows Live\Shared;C:\Users\theo\Desktop\eclipse; USERNAME=theo OS=Windows_NT PROCESSOR_IDENTIFIER=x86 Family 6 Model 37 Stepping 5, GenuineIntel --------------- S Y S T E M --------------- OS: Windows 7 Build 7600 CPU:total 4 (8 cores per cpu, 2 threads per core) family 6 model 37 stepping 5, cmov, cx8, fxsr, mmx, sse, sse2, sse3, ssse3, sse4.1, sse4.2, ht Memory: 4k page, physical 2097151k(1257972k free), swap 4194303k(4194303k free) vm_info: Java HotSpot(TM) Client VM (14.2-b01) for windows-x86 JRE (1.6.0_16-b01), built on Jul 31 2009 11:26:58 by "java_re" with MS VC++ 7.1 time: Wed Oct 23 22:00:12 2013 elapsed time: 0 seconds Code: Display.setDisplayMode(new DisplayMode(800,600)); Display.create();//Error here I am using JDK 6

  Read the article

• If you had to reinvent a new syntax for regular expressions, what would it look like?

  - by Timwi

  Regular expressions as they are today are pretty much as concise and compact as they can be. Consequently, they are often criticised for being unreadable and hard to debug. If you had to reinvent a new syntax for regular expressions, what would it look like? Do you prefer the concise syntax they already have (or a different but similarly concise syntax)? If so, please justify why you think regular expressions deserve to be this concise, but your favourite programming language doesn’t (unless it’s Perl). Or do you think regular expressions should have a slightly more spaced-out syntax and look a bit more like operators and syntax elements normally do in programming languages? If so, provide examples of what you think the syntax should look like, and justify why it is better than the current syntax. Or do you think there shouldn’t even be a special syntax for regular expressions, and instead they should be constructed from syntax elements already present in the programming language? If so, give examples of a syntax that might be used to construct such regular expressions.

  Read the article

• Programming languages, positional languages and natural languages

  - by Vitalij Zadneprovskij

  Some programming languages are modeled on machine code, like assembly languages. Other languages are modeled on a natural language, the English language. Others are not modeled on either machine code or natural language. Languages such as PROLOG, for example, don't follow either model. I came across this Perl module Lingua::Romana::Perligata, that allows to write programs using a syntax that is very similar to Latin. Are there programming languages that have less positional syntax? Are there other languages or modules that allow you to write in syntaxes inspired by other natural languages, like French, Hebrew or Farsi? There is a very long list on Wikipedia, but most of those projects are dead. There is a related question on StackOverflow. The answer that was accepted is "Use Google".

  Read the article

• list of things to think about for hosting a potentially high traffic website

  - by SpashHit

  I do my own hosting for a few clients on my own VPS server (Lindode). Since my clients so far have been extremely low traffic, I have not had to really dig into some of the considerations that I would need for a higher traffic site. Now I am bidding on a client whose site will be potentially higher (not Facebook or twitter, but higher than Joe's ice cream shop). Is there a list of things I need to think about that I may be missing? I am going to assume, at least at first, that I will be able to handle them on my shared Linode, but I could move to a dedicated Linode if need be. I am not thinking so far of multiple servers, but short of that there are still considerations. For example, mod_perl instead of straight CGI, better backups, etc. What else? In case it matters, the stack will be debian-linux / apache / Perl / mysql / Template Toolkit.

  Read the article

• Know Your Audience, And/Or Your Customer

  - by steve.diamond

  Yesterday I gave an internal presentation to about 20 Oracle employees on "messaging," not messaging technology, but embarking on the process of building messages. One of the elements I covered was the importance of really knowing and understanding your audience. As a humorous reference I included two side-by-side photos of Oakland A's fans and Oakland Raiders fans. The Oakland A's fans looked like happy-go-lucky drunk types. The Oakland Raiders fans looked like angry extras from a low budget horror flick. I then asked my presentation attendees what these two groups had in common. Here's what I heard. --They're human (at least I THINK they're human). --They're from Oakland. --They're sports fans. After that, it was anyone's guess. A few days earlier we were putting the finishing touches on a sales presentation for one of our product lines. We had included an upfront "lead in" addressing how the economy is improving, yet that doesn't mean sales executives will have any more resources to add to their teams, invest in technology, etc. This "lead in" included miscellaneous news article headlines and statistics validating the slowly improving economy. When we subjected this presentation to internal review two days ago, this upfront section in particular was scrutinized. "Is the economy really getting better? I (exclamation point) don't think it's really getting better. Haven't you seen the headlines coming out of Greece and Europe?" Then the question TO ME became, "Who will actually be in the audience that sees and hears this presentation? Will s/he be someone like me? Or will s/he be someone like the critic who didn't like our lead-in?" We took the safe route and removed that lead in. After all, why start a "pitch" with a component that is arguably subjective? What if many of our audience members are individuals at organizations still facing a strong headwind? For reasons I won't go into here, it was the right decision to make. The moral of the story: Make sure you really know your audience. Harness the wisdom of the information your organization's CRM systems collect to get that fully informed "customer view." Conduct formal research. Conduct INFORMAL research. Ask lots of questions. Study industries and scenarios that have nothing to do with yours to see "how they do it." Stop strangers in coffee shops and on the street...seriously. Last week I caught up with an old friend from high school who recently retired from a 25 year career with the USMC. He said, "I can learn something from every single person I come into contact with." What a great way of approaching the world. Then, think about and write down what YOU like and dislike as a customer. But also remember that when it comes to your company's products, you are most likely NOT the customer, so don't go overboard in superimposing your own world view. Approaching the study of customers this way adds rhyme, reason and CONTEXT to lengthy blog posts like this one. Know your audience.

  Read the article

• Rendering CV template with XeLaTex

  - by jacob

  Installed kubuntu on thursday Installed LaTeX on my kubuntu machine, using full Compiled an old document and it worked fine Downloaded a CV template from http://www.latextemplates.com/template/two-column-one-page-cv Compiled it, got error Fatal fontspec error: "cannot-use-pdftex" The fontspec package requires either XeTeX or LuaTeX to function. You must change your typesetting engine to, e.g., "xelatex" or "lualatex" instead of plain "latex" or "pdflatex". See the fontspec documentation for further information. For immediate help type H . Installed XeLaTex using this guide http://ledgersmb.org/faq/xelatex i.e. 7 Installed texlive-xetex that includes xelatex apt-get install texlive-xetex apt-get install liblatex-{driver,encode,table}-perl apt-get install libtemplate-plugin-latex-per 8) Compiled CV template again, did not work. Related: No Xelatex in texlive 2012 Excuse me if my question is not clear enough, I'm new to linux.

  Read the article

• Editor's Notebook - Social Aura: Insights from the Oracle Social Media Summit

  - by user462779

  Panelists talk social marketing at the Oracle Social Media Summit On November 14, I traveled to Las Vegas for the first-ever Oracle Social Media Summit. The two day event featured an impressive collection of social media luminaries including: David Kirkpatrick (founder and CEO of Techonomy Media and author of The Facebook Effect), John Yi (Head of Marketing Partnerships, Facebook), Matt Dickman (EVP of Social Business Innovation, Weber Shandwick), and Lyndsay Iorio (Social Media & Communications Manager, NBC Sports Group) among others. It was also a great opportunity to talk shop with some of our new Vitrue and Involver colleagues who have been returning great social media results even before their companies were acquired by Oracle. I was live tweeting the event from @OracleProfit which was great for those who wanted to follow along with the proceedings from the comfort of their office or blackjack table. But I've also found over the years that live tweeting an event is a handy way to take notes: I can sift back through my record of what people said or thoughts I had at the time and organize the Twitter messages into some kind of summary account of the proceedings. I've had nearly a month to reflect on the presentations and conversations at the event and a few key topics have emerged: David Kirkpatrick's comment during the opening presentation really set the stage for the conversations that followed. Especially if you are a marketer or publisher, the idea that you are in a one-way broadcast relationship with your audience is a thing of the past. "Rising above the noise" does not mean reaching for a megaphone, ALL CAPS, or exclamation marks. Hype will not motivate social media denizens to do anything but unfollow and tune you out. But knowing your audience, creating quality content and/or offers for them, treating them with respect, and making an authentic effort to please them: that's what I believe is now necessary. And Kirkpatrick's comment early in the day really made the point. Later in the day, our friends @Vitrue demonstrated this point by elaborating on a comment by Facebook's John Yi. If a social strategy is comprised of nothing more than cutting/pasting the same message into different social media properties, you're missing the opportunity to have an actual conversation. That's not shouting at your audience, but it does feel like an empty gesture. Walter Benjamin, perplexed by auraless Twitter messages Not to get too far afield, but 20th century cultural critic Walter Benjamin has a concept that is useful for understanding the dynamics of the empty social media gesture: Aura. In his work The Work of Art in the Age of Mechanical Reproduction, Benjamin struggled to understand the difference he percieved between the value of a hand-made art object (a painting, wood cutting, sculpture, etc.) and a photograph. For Benjamin, aura is similar to the "soul" of an artwork--the intangible essence that is created when an artist picks up a tool and puts creative energy and effort into a work. I'll defer to Wikipedia: "He argues that the "sphere of authenticity is outside the technical" so that the original artwork is independent of the copy, yet through the act of reproduction something is taken from the original by changing its context. He also introduces the idea of the "aura" of a work and its absence in a reproduction." So make sure you put aura into your social interactions. Don't just mechanically reproduce them. Keeping aura in your interactions requires the intervention of an actual human being. That's why @NoahHorton's comment about content curation struck me as incredibly important. Maybe it's just my own prejudice, being in the content curation business myself. And it's not to totally discount machine-aided content management systems, content recommendation engines, and other tech-driven tools for building an exceptional content experience. It's just that without that human interaction--that editor who reviews the analytics and responds to user feedback--interactions over social media feel a bit empty. It is SOCIAL media, right? (We'll leave the conversation about social machines for another day). At the end of the day, experimentation is key. Just like trying to find that right joke to tell at the beginning of your presentation or that good opening like at a cocktail party, social media messages and interactions can take some trial and error. Don't be afraid to try things, tinker with incomplete ideas, abandon things that don't work, and engage in the conversation. And make sure your heart is in it, otherwise your audience can tell. And finally:

  Read the article

• Is it okay to be generalist?

  - by Londoner

  I work at a ~50 employee company (UK), where all the technical people do a bit of everything. Specialising in anything for very long (6 months) is discouraged. For example, last week, I built a new Debian webserver, refactored some Perl, sat on a sales phone call, did a tape backup, reviewed code, built and deployed an RPM, gave opinions about x, y, z... With such a work scheme, I have gained a general knowledge how many things work, and pretty specific knowledge. I maybe program for 5 hours a week, despite officially being a developer. Does anyone else work like this, (or is this company unique)? Is it a problem to have skills developed in this way? (i.e. know a bit about everything in a certain domain, rather than know everything about say, one programming language?) Is it okay to be a generalist?

  Read the article

• Concrete examples of Python's "only one way to do it" maxim

  - by Charles Roper

  I am learning Python and am intrigued by the following point in PEP 20 The Zen of Python: There should be one-- and preferably only one --obvious way to do it. Although that way may not be obvious at first unless you're Dutch. Could anyone offer any concrete examples of this maxim? I am particularly interested in the contrast to other languages such as Ruby. Part of the Ruby design philosophy (originating with Perl, I think?) is that multiple ways of doing it is A Good Thing. Can anyone offer some examples showing the pros and cons of each approach. Note, I'm not after an answer to which is better (which is probably too subjective to ever be answered), but rather an unbiased comparison of the two styles.

  Read the article

• Running scripts from another directory

  - by Desmond Hume

  Quite often, the script I want to execute is not located in my current working directory and I don't really want to leave it. Is it a good practice to run scripts (BASH, Perl etc.) from another directory? Will they usually find all the stuff they need to run properly? If so, what is the best way to run a "distant" script? Is it . /path/to/script or sh /path/to/script and how to use sudo in such cases? This, for example, doesn't work: sudo . /path/to/script

  Read the article

• Complexity of a web application

  - by Dominik G

  I am currently writing my Master's Thesis on maintainability of a web application. I found some methods like the "Maintainability Index" by Coleman et.al. or the "Software Maintainability Index" by Muthanna et.al. For both of them one needs to calculate the cyclomatic complexity. So my question is: Is it possible to measure the cyclomatic complexity of a web application? In my opinion there are three parts to a web application: Server code (PHP, C#, Python, Perl, etc.) Client code (JavaScript) HTML (links and forms as operators, GET-parameters and form fields as operands!?) What do you think? Is there another point of view on the complexity of web application? Did I miss something?

  Read the article

• Format numbers with css

  - by Luc M

  Is it possible to format numbers using css ? When I have 7000000.00, I would like it displayed as 7 000 000.00 I know I could write a backend (php, perl...) function or a javascript function that could return the formatted number but... The numbers that I want to format are into a cell. I would like to have something like <td class="myformat">7000000.00</td> or <td><span class="myformat">7000000.00<span></td>

  Read the article

< Previous Page | 102 103 104 105 106 107 108 109 110 111 112 113  | Next Page >