Search Results

Search found 518 results on 21 pages for 'brij raj singh'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 11/21 | < Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >

  • Use Of Android NDK

    - by Shalini Singh
    Hi!!!! i am new for NDK. i want to know what is the benefit of native code in android . By this can we improve our application performance. and main thing exactly when we will use this native code. please clear it. and from where i can get more information............

    Read the article

  • Pass HTML-DOM to Flex's actionscript.

    - by raj
    Hi, All i want is to pass a HTML-Form (DOM object) from javascript to Actionscript. i saw this article on the net and tried a similar code. But when i execute the code in IE, it alerts : "Out of memory at line 18". I'm stuck here from yesterday. i'll post the mxml and html here.. The MXML : <?xml version="1.0" encoding="utf-8"?> <mx:Application xmlns:mx="http://www.adobe.com/2006/mxml" layout="absolute" creationComplete="init()"> <mx:Script> <![CDATA[ public function init() : void { if (ExternalInterface.available) { try { ExternalInterface.addCallback("populateFlashFile", populateFlashFile); } catch (error:SecurityError) { } catch (error:Error) { } } } public function populateFlashFile(window:*) : void { log.text = window.toString(); // just for checking if window has come to the function. window.document.write("Hello"); } ]]> </mx:Script> <mx:TextArea x="10" y="23" width="712" height="581" id="log"/> </mx:Application> The HTML : <html lang="en"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> </head> <body scroll="no"> <input type="button" onclick="document.getElementById('Test').populateFlashFile(window);"/> <object classid="clsid:D27CDB6E-AE6D-11cf-96B8-444553540000" id="Test" width="100%" height="100%" codebase="http://fpdownload.macromedia.com/get/flashplayer/current/swflash.cab"> <param name="movie" value="Test.swf" /> <param name="quality" value="high" /> <param name="bgcolor" value="#869ca7" /> <param name="allowScriptAccess" value="sameDomain" /> </object> </body> </html> The problem occors only when i pass some DOM object, if i pass some String it works.!!! i.e : <input type="button" onclick="document.getElementById('Test').populateFlashFile('some text here');"/> works great!

    Read the article

  • Sorting manually generated index using perl script

    - by Pradeep Singh
    \item Bernoulli measure, 14 \item cellular automata \subitem Soft, 3, 28 \subitem balance theorem, 23, 45 \item tiles \subitem tiling problem, 19, 58 \subitem aperiodic tile set, 18, 45 \item Garden-of-Eden -theorem, 12 \item Bernoulli measure, 15, 16, 35 \item cellular automata \subitem balance theorem, 9, 11, 14 \subitem blocking word, 22, 32 \item Garden-of-Eden -theorem, 32 I have to sort the above index alphabetically using a perl script. Duplicate item or subitem entries should be merged and their numbers should be sorted. The subitems also should be sorted under respective item and their numbers should be also sorted. If same item is repeated in more than one place with subitems all the subitems should be merged under a single item and also subitems should be sorted

    Read the article

  • How can a user view profile info of other users?

    - by Arvind Singh
    I have stored profile info using this code ProfileBase userprofile = HttpContext.Current.Profile; userprofile.SetPropertyValue("FirstName", TextBoxFirstName.Text); userprofile.SetPropertyValue("LastName", TextBoxLastName.Text); userprofile.SetPropertyValue("AboutMe", TextBoxAboutMe.Text); userprofile.SetPropertyValue("ContactNo", TextBoxContactNo.Text); and in web.config <profile enabled="true" defaultProvider="AspNetSqlProfileProvider"> <properties> <add name="FirstName" type="String" /> <add name="LastName" type="String" /> <add name="AboutMe" type="String" /> <add name="ContactNo" type="String" /> </properties> </profile> The profile info is stored and every user is able to view his own profile info using something like this TextBoxFirstName.Text = HttpContext.Current.Profile.GetPropertyValue("FirstName").ToString(); How to fetch profile info of other user say a user types the username of other user in a text box and clicks a button?

    Read the article

  • conditional update records mysql query

    - by Shakti Singh
    Hi, Is there any single msql query which can update customer DOB? I want to update the DOB of those customers which have DOB greater than current date. example:- if a customer have dob 2034 update it to 1934 , if have 2068 updated with 1968. There was a bug in my system if you enter date less than 1970 it was storing it as 2070. The bug is solved now but what about the customers which have wrong DOB. So I have to update their DOB. All customers are stored in customer_entity table and the entity_id is the customer_id Details is as follows:- desc customer_entity -> ; +------------------+----------------------+------+-----+---------------------+----------------+ | Field | Type | Null | Key | Default | Extra | +------------------+----------------------+------+-----+---------------------+----------------+ | entity_id | int(10) unsigned | NO | PRI | NULL | auto_increment | | entity_type_id | smallint(8) unsigned | NO | MUL | 0 | | | attribute_set_id | smallint(5) unsigned | NO | | 0 | | | website_id | smallint(5) unsigned | YES | MUL | NULL | | | email | varchar(255) | NO | MUL | | | | group_id | smallint(3) unsigned | NO | | 0 | | | increment_id | varchar(50) | NO | | | | | store_id | smallint(5) unsigned | YES | MUL | 0 | | | created_at | datetime | NO | | 0000-00-00 00:00:00 | | | updated_at | datetime | NO | | 0000-00-00 00:00:00 | | | is_active | tinyint(1) unsigned | NO | | 1 | | +------------------+----------------------+------+-----+---------------------+----------------+ 11 rows in set (0.00 sec) And the DOB is stored in the customer_entity_datetime table the column value contain the DOB. but in this table values of all other attribute are also stored such as fname,lname etc. So the attribute_id with value 11 is DOB attribute. mysql> desc customer_entity_datetime; +----------------+----------------------+------+-----+---------------------+----------------+ | Field | Type | Null | Key | Default | Extra | +----------------+----------------------+------+-----+---------------------+----------------+ | value_id | int(11) | NO | PRI | NULL | auto_increment | | entity_type_id | smallint(8) unsigned | NO | MUL | 0 | | | attribute_id | smallint(5) unsigned | NO | MUL | 0 | | | entity_id | int(10) unsigned | NO | MUL | 0 | | | value | datetime | NO | | 0000-00-00 00:00:00 | | +----------------+----------------------+------+-----+---------------------+----------------+ 5 rows in set (0.01 sec) Thanks.

    Read the article

  • Java Memory Management

    - by Tara Singh
    I am designing a client-server chat application in Java. This is a secure application where the messages are exchanged using cryptographic algorithms. I have one server and it can support many clients. My problem is that when one client logs on the server it works fine, but when another user logs into the system, the server starts giving me bad padding exceptions for the encrypted text. I am not able to figure out the problem, according to my logic, when new connection request to server is made, the server creates a thread for listening to the client. Is it possible that once the instance of thread class is created, it does all the processing correctly for the first client, but not for the second client because the variables in server listener thread class already have some previous value, and thus the encrypted text is not decrypted properly? Please advise how I can make this process more robust so that the number of clients does not affect how well the server functions.

    Read the article

  • php switch statement error on int = 0

    - by Jagdeep Singh
    I am having a problem in php switch case. When i set $number=0 it should run very first case but here this code returns 10-20K that is in second case. I checked comparison operators, tested them in if else case they return correct values but here first case do not run on $number=0 Why is this happening ? php consider 0 as false or something wrong in code ? Link to codepad paste http://codepad.org/2glDh39K also here is the code <?php $number = 0; switch ($number) { case ($number <= 10000): echo "0-10K"; break; case ($number > 10000 && $number <= 20000): echo "10-20K"; break; case ($number > 20000 && $number <= 30000): echo "20-30K"; break; case ($number > 30000 && $number <= 40000): echo "30-40K"; break; case ($number > 40000 && $number <= 50000): echo "40-50K"; break; case ($number > 50000 && $number <= 60000): echo "50-60K"; break; case ($number > 60000 && $number <= 70000): echo "60-70K"; break; case ($number > 70000 && $number <= 80000): echo "70-80K"; break; case ($number > 80000 && $number <= 90000): echo "80-90K"; break; case ($number > 90000): echo "90K+"; break; default: //default echo "N/A"; break; } ?>

    Read the article

  • Intersection of line with cube and knowing the point of intersection.

    - by Raj
    Hello everyone, description 1.lines are originating from origin(0,0,0). 2.lines are at some random angle to the Normal of Top face of teh cube. 3.if the lines are intersecting cube , calculate the intersection point. 4.mainly i wan to know how much distance ,line traveled inside the cube. I dont know exactly which approach should i take , i will be pleased and thankful if someone could guied me to the right direction, to use OpenGL, DirectX or some other library, for C# . some example or sample will be appriciated.

    Read the article

  • How can we call an activity through service in android???

    - by Shalini Singh
    Hi! friends, i am a android developer,,, want to know is it possible to call an activity through background service in android like : import android.app.Service; import android.content.Intent; import android.content.SharedPreferences; import android.media.MediaPlayer; import android.os.Handler; import android.os.IBinder; import android.os.Message; public class background extends Service{ private int timer1; @Override public void onCreate() { // TODO Auto-generated method stub super.onCreate(); SharedPreferences preferences = getSharedPreferences("SaveTime", MODE_PRIVATE); timer1 = preferences.getInt("time", 0); startservice(); } @Override public IBinder onBind(Intent arg0) { // TODO Auto-generated method stub return null; } private void startservice() { Handler handler = new Handler(); handler.postDelayed(new Runnable(){ public void run() { mediaPlayerPlay.sendEmptyMessage(0); } }, timer1*60*1000); } private Handler mediaPlayerPlay = new Handler(){ @Override public void handleMessage(Message msg) { try { getApplication(); MediaPlayer mp = new MediaPlayer(); mp = MediaPlayer.create(background.this, R.raw.alarm); mp.start(); } catch(Exception e) { e.printStackTrace(); } super.handleMessage(msg); } }; /* * (non-Javadoc) * * @see android.app.Service#onDestroy() */ @Override public void onDestroy() { // TODO Auto-generated method stub super.onDestroy(); } } i want to call my activity......

    Read the article

  • Change only Revision number in AssemblyInfo.cs with msbuild FileUpdate task

    - by Divya mohan Singh
    I need to change only the revision number of an AssemblyInfo.cs file. The version number is in the format Major.Minor.Build.Revision e.g. 1.4.6.0. Currently I change the version with the FileUpdate task (from the MSBuild Community Tasks Project) and the following regex: <FileUpdate Files="@(AssemblyResult)" Regex='(\[\s*assembly:\s*AssemblyVersion\(\s*"[^\.]+\.[^\.]+)\.([^\.]+)(\.)([^\.]+)("\)\s*\])' ReplacementText='[assembly: AssemblyVersion("$(AssemblyMajorNumber).$(AssemblyMinorNumber).$(AssemblyBuildNumber).$(Revision)")]' /> Now I need to update only the revision number and leave major,minor and build unchanged. So, is there any task to do this? Or can it be done with a regex? What would be the regular expression then?

    Read the article

  • Histogram matching - image processing - c/c++

    - by Raj
    Hello I have two histograms. int Hist1[10] = {1,4,3,5,2,5,4,6,3,2}; int Hist1[10] = {1,4,3,15,12,15,4,6,3,2}; Hist1's distribution is of type multi-modal; Hist2's distribution is of type uni-modal with single prominent peak. My questions are Is there any way that i could determine the type of distribution programmatically? How to quantify whether these two histograms are similar/dissimilar? Thanks

    Read the article

  • Issues while downloading document from Sharepoint using JAVA

    - by Deepak Singh Rawat
    I am trying to download a file from Sharepoint 2007 sp2 document library using GetItem method of the Copy webservice. I am facing the following issues : In the local instance ( Windows Vista ) I can save only 10.5 Kb of any file. The webservice is returning only 10.5 Kb of data for any file. On the production server, I am able to List the documents using some credentials but when I am trying to download a document using the same credentials I get a 401 : Unauthorized message. I can download the document using the Sharepoint website successfully.

    Read the article

  • Super class variables not printing through sub class

    - by Abhishek Singh
    Can u tell me why this code is not displaying any result on the console. class employee { protected String name; protected double salary; protected String dob; public employee(String name, double salary, String dob) { this.name = name; this.salary = salary; this.dob = dob; } public employee(String name, double salary) { this.name = name; this.salary = salary; } } public class Manage extends employee { String dept1; public Manage(String name, double salary, String dob, String dept1) { super(name, salary, dob); this.dept1 = dept1; } public Manage(String name, double salary, String dept1) { super(name, salary); this.dept1 = dept1; } public static void main(String args[]) { employee e = new employee("Vikas", 122345); employee e2 = new employee("Vikas", 122345, "12-2-1991"); Manage m = (Manage) new Manage("Vikas", 122345, "Sales"); Manage m2 = new Manage("Vikas", 122345, "12-2-1991", "sales"); m.display(); m2.display(); } public void display() { System.out.println("Name " + name); System.out.println("Salary " + salary); System.out.println("Birth " + dob); System.out.println("Department " + dept1); } }

    Read the article

  • Running BlogEngine.NET with ASP.NET MVC under same website?

    - by Raj Aththanayake
    Hi Can anyone please help me with this? I have a Windows 2008 server and MVC 2.0 site is hosted under IIS 7.0 root directory. The site works fine. I want to use the BlogEngine.NET with my site. For example if my mite name is http:// mysite.com (which is the root of IIS) and the blog should be http://mysite.com/blog/Default.aspx Is this possible? Can I create a sub virtual directory within my root (where the MVC 2 app is hosted) and run the ASP.NET BlogEngine.Net in it? Any ideas appreciated.

    Read the article

  • sql query - how to apply limit within group by

    - by Raj
    hey guys assuming i have a table named t1 with following fields: ROWID, CID, PID, Score, SortKey it has the following data: 1, C1, P1, 10, 1 2, C1, P2, 20, 2 3, C1, P3, 30, 3 4, C2, P4, 20, 3 5, C2, P5, 30, 2 6, C3, P6, 10, 1 7, C3, P7, 20, 2 what query do i write so that it applies group by on CID, but instead of returning me 1 single result per group, it returns me a max of 2 results per group. also where condition is score = 20 and i want the results ordered by CID and SortKey. If I had to run my query on above data, i would expect the following result: RESULTS FOR C1 - note: ROWID 1 is not considered as its score < 20 C1, P2, 20, 2 C1, P3, 30, 3 RESULTS FOR C2 - note: ROWID 5 appears before ROWID 4 as ROWID 5 has lesser value SortKey C2, P5, 30, 2 C2, P4, 20, 3 RESULTS FOR C3 - note: ROWID 6 does not appear as its score is less than 20 so only 1 record returned here C3, P7, 20, 2 IN SHORT, I WANT A LIMIT WITHIN A GROUP BY. I want the simplest solution and want to avoid temp tables. sub queries are fine. also note i am using sqlite for this

    Read the article

  • iPad/iPhone: Form filling application pointers

    - by raj.tiwari
    Folks, I am starting work on an iPad/iPhone application that is essentially a form-filing UI. The requirement is to present a (rather large) form to the user. The form is composed of sections and questions, like so: Form Question 0.1 Question 0.2 Section 1 Question 1.1 etc. The user can take various paths down the form based on answers to questions. I would like to architect this by defining a declarative markup that can be used to author the form questionnaire including traversal rules. My questions are: Can anyone recommend a markup/language that would satisfy the declaration requirement? Is there any existing library that would ease the implementation as described above? Thanks for your time.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to set an Image fit to width of ScrollViewer

    - by Raj
    I've Image placed inside a ScrollViewer. <ScrollViewer x:Name="imageScroller" Grid.Column="2" Margin="5" HorizontalScrollBarVisibility="Visible" VerticalScrollBarVisibility="Visible"> <Image x:Name="imageViewer" Cursor="Hand" RenderTransformOrigin="0,0" Margin="0"> <Image.LayoutTransform> <ScaleTransform ScaleX="{Binding Path=Zoom, Converter={StaticResource debugConverter}}" ScaleY="{Binding Path=Zoom, Converter={StaticResource debugConverter}}"/> </Image.LayoutTransform> </Image> </ScrollViewer> How do I zoom image like "fit-to-width" in document viewers to the size and height of ScrollViewer?

    Read the article

  • calling background service from BroadcastReceiver....

    - by Shalini Singh
    Hi , i am trying to call a push notification background from BroadcastReceiver class.but my application is going to crash the code is given bellow public class AlarmReceiver extends BroadcastReceiver { Context ctx; static int count=1; @Override public void onReceive(Context context, Intent intent) { // TODO Auto-generated method stub //Toast.makeText(context, "working"+count, Toast.LENGTH_LONG).show(); count++; Log.e("broadcast***","receiver"); Intent myIntent=new Intent(context,NotifyService.class); myIntent.setFlags(Intent.FLAG_ACTIVITY_NEW_TASK); context.startActivity(myIntent); } } * manifest entry:- <intent-filter> <action android:name="android.intent.action.BOOT_COMPLETED"/> </intent-filter> </receiver> Error: 05-24 15:17:00.042: ERROR/AndroidRuntime(424): Caused by: android.content.ActivityNotFoundException: Unable to find explicit activity class {com.android.alarm/com.android.alarm.NotifyService}; have you declared this activity in your AndroidManifest.xml? Please help me....

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >