Search Results

Search found 518 results on 21 pages for 'brij raj singh'.

Page 13/21 | < Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >

  • Cordova - Scrolling with a fixed header and footer (ios)

    - by Samu Singh
    Using Cordova (phonegap) & bootstrap to make a mobile application, testing on IOS for now. Getting an issue with a header and footer bar that are fixed with scrollable content in the middle. When tapping to scroll, the header/footer bar moves down or up with the content but then snaps back to place as soon as the scrolling completes. If I use -webkit-overflow-scrolling: touch; it works as expected, but it makes it really awkward to scroll through the content, and if you scroll passed the end, it only scrolls the header or footer (with elastic overflow) until you stop for a second. here's my html for the header/footer bars: <div id="headerBar"> <div class="container-fluid" style="background-color: #1569C7"> <div class="row"> <div class="col-xs-3 text-left"> <button id="logoutButton" type="button" class="btn btn-default"> Log Out </button> <button type="button" class="btn btn-default" id="restoreQuestionFeedButton"> <span class="glyphicon glyphicon-chevron-left"></span> </button> </div> <div class="col-xs-6 text-center" style="height: 55px"> <strong id="usernameText"></strong> </div> <div class="col-xs-3 text-right"> <button id="oldCreatQuestionButton" type="button" class="btn btn-default"> <span class="glyphicon glyphicon-plus"></span> </button> </div> </div> </div> </div> <div id="footerBar"> <div class="container-fluid" style="padding: 0"> <div class="row text-center"> <button id="createQuestionButton" type="button" class="btn btn-default footerButton"> <span class="glyphicon glyphicon-plus"></span> <strong>Ask a new free question!</strong> </button> </div> </div> </div> And here is the related CSS: #headerBar { position: fixed; z-index: 100; top: 0; left: 0; width: 100%; background-color: #1569C7; } #footerBar { position: fixed; z-index: 100; bottom: 0; left: 0; width: 100%; background-color: #1569C7 !important; }

    Read the article

  • Print expression as is without evaluating it

    - by Raj
    i want to print the expression Xmin and Ymin as is without calculating the final value . i,e with the values of I and J as 1,2,3,4,5 example when I=1 Xmin= Xmin ((1 - 1)*10 + (1 - 1)*1) is there a way to do it .. I tried the following code, but no luck: int a, g; a = 10; g = 1; for (int J=1; J<=5; J++) { for (int I = 1; I <= 5; I++) { string Xmin = Convert.ToString((I - 1)*a + (I - 1)*g); string Ymin = Convert.ToString((J - 1) * a); Debug.WriteLine("X=" + Xmin + "Y=" + Ymin); } }

    Read the article

  • IE not triggering keyboard event on a form with ONE FIELD

    - by raj
    I'm seeing my Friend's code here... <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN"> <HTML> <HEAD> <TITLE> Check action </TITLE> <script> function detectEvent(){ if(window.event.keyCode==13) { alert("you hit return!"); } } </script> </HEAD> <BODY> <form name="name1" onkeyup="detectEvent()" action="page2.html"> <p> Field1 <input type="text" id="text1"/> </p> </form> </BODY> </HTML> and when he tried entering a value in the textbox and pressed enter, it did not call the detectEvent(). I said, it'll always call onSubmit on enter button..... and he surprised me, <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN"> <HTML> <HEAD> <TITLE> Check action </TITLE> <script> function detectEvent(){ if(window.event.keyCode==13) { alert("you hit return!"); } } </script> </HEAD> <BODY> <form name="name1" onkeyup="detectEvent()" action="page2.html"> <p> Field1 <input type="text" id="text1"/> </p> <p> Field1 <input type="text" id="text2"/> </p> </form> </BODY> </HTML> Now press enter, The function gets called..... Why so!? Why onKeyUp not called on forms with just one field.!!! am i missing something?

    Read the article

  • C program to display a jpeg or bmp or pcx file.

    - by Raj
    What is the code in 'c' to display a picture file like jpeg file or bmp file or pcx file. For example the picture may be available in desktop and the program during execution must be given the path of the file as input and should display the image.(If it is in command line,it'll be excellent). Platform:Windows xp Turbo c compiler(or turboc++)

    Read the article

  • HSM - cryptoki - opening sessions overhead

    - by Raj
    I am having a query regarding sessions with HSM. I am aware that there is an overhead if you initialise and finalise the cryptoki api for every file you want to encrypt/decrypt. My queries are, Is there an overhead in opening and closing individual sessions for every file, you want to encrypt/decrypt.(C_Initialize/C_Finalize) How many maximum number of sessions can i have for a HSM simultaneously, with out affecting the performance? Is opening and closing the session for processing individual files the best approach or opening a session and processing multiple files and then closing the session the best approach? Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • IIS reset details

    - by Raj
    What exactly happens when we do IISreset? What resources get released? We have an ASP.Net website (.net 1.1) which use Crystal reports 11. Lately, running reports are throwing several crystal report specific exceptions and then the users can't run reports anymore. Resetting IIS lets the users log back in and run the reports until it fails the next time. Knowing exactly what resources are released when IIS is reset will help us dig deeper to find the root cause. Any help?

    Read the article

  • Preloading and caching of images in silverlight

    - by Prabhjot Singh
    Hi there I have a silverlight application in vs2010 and iam using silverlight 4.0. I have to show a videoppt in which a video is synchronised with images and it runs as a video powerpoint presentation. Is it possible to preload the images or cache them, so that they get rendered as soon as the video starts. If there is a way out, plz guide me.

    Read the article

  • How to increase the height of the select box

    - by Raj
    Checkout http://demo.neeraj.name/admin_data in both chrome and firefox. In firefox the select box has large height. In chrome the height of select box is very small. How do I make the select box of chrome and safari look like the select drop down of firefox?

    Read the article

  • specifying multiple URLs with cURL/PHP using square brackets

    - by Raj Gundu
    I have a large array of URLS similar to this: $nodes = array( 'http://www.example.com/product.php?page=1&sortOn=sellprice', 'http://www.example.com/product.php?page=2&sortOn=sellprice', 'http://www.example.com/product.php?page=3&sortOn=sellprice' ); The cURL manual states here (http://curl.haxx.se/docs/manpage.html) that i can use square brackets '[]' to specify multiple urls. Used in the above example this would be similar to this: 'http://www.example.com/product.php?page=[1-3]&sortOn=sellprice' So far i have been unable to reference this correctly. This is the complete code segment I'm currently trying to utilize this with: $nodes = array( 'http://www.example.com/product.php?page=1&sortOn=sellprice', 'http://www.example.com/product.php?page=2&sortOn=sellprice', 'http://www.example.com/product.php?page=3&sortOn=sellprice' ); $node_count = count($nodes); $curl_arr = array(); $master = curl_multi_init(); for($i = 0; $i < $node_count; $i++) { $url =$nodes[$i]; $curl_arr[$i] = curl_init($url); curl_setopt($curl_arr[$i], CURLOPT_RETURNTRANSFER, true); curl_multi_add_handle($master, $curl_arr[$i]); } do { curl_multi_exec($master,$running); } while($running > 0); echo "results: "; for($i = 0; $i < $node_count; $i++) { $results = curl_multi_getcontent ( $curl_arr[$i] ); echo( $i . "\n" . $results . "\n"); echo 'done'; I can't seem to find any more documentation on this. Thanks in advance.

    Read the article

  • standard encryption decryption across different platforms

    - by Raj
    hey guys i need to implement a standard encryption decryption logic across an entire project platform which has different clients implemented using different platforms as follows: 1) iphone app (objectiv c) 2) website (classic asp) 3) webservice (asp.net) the iphone app as well as the website need to send info to webservice using encrypted query strings the web service then decrypts this and processes the info further wanted to know the simplest way to achieve this. is there some free and ready to use binary available with an easy to use api to achieve this? encryption needs to be as secure as possible thnx in advance

    Read the article

  • Ruby - calling constructor without arguments & removal of new line characters

    - by Raj
    I am a newbie at Ruby, I have written down a sample program. I dont understand the following: Why constructor without any arguments are not called in Ruby? How do we access the class variable outside the class' definition? Why does it always append newline characters at the end of the string? How do we strip it? Code: class Employee attr_reader :empid attr_writer :empid attr_writer :name def name return @name.upcase end attr_accessor :salary @@employeeCount = 0 def initiaze() @@employeeCount += 1 puts ("Initialize called!") end def getCount return @@employeeCount end end anEmp = Employee.new print ("Enter new employee name: ") anEmp.name = gets() print ("Enter #{anEmp.name}'s employee ID: ") anEmp.empid = gets() print ("Enter salary for #{anEmp.name}: ") anEmp.salary = gets() theEmpName = anEmp.name.split.join("\n") theEmpID = anEmp.empid.split.join("\n") theEmpSalary = anEmp.salary.split.join("\n") anEmp = Employee.new() anEmp = Employee.new() theCount = anEmp.getCount puts ("New employee #{theEmpName} with employee ID #{theEmpID} has been enrolled, welcome to hell! You have been paid as low as $ #{theEmpSalary}") puts ("Total number of employees created = #{theCount}") Output: Enter new employee name: Lionel Messi Enter LIONEL MESSI 's employee ID: 10 Enter salary for LIONEL MESSI : 10000000 New employee LIONEL MESSI with employee ID 10 has been enrolled, welcome to hell! You have been paid as low as $ 10000000 Total number of employees created = 0 Thanks

    Read the article

  • how to create Cross domain asp.net web service

    - by Prithvi Raj Nandiwal
    i have create a web service. i want to access this web service using Ajax jqury. i am able to access on same domain. but i want to access thia web service to another domain. Have any one idea. how to create cross domain web service in asp.net. any setting in web,config file so that i access it on another domain. my webservice [WebService(Namespace = "http://tempuri.org/")] [System.Web.Script.Services.ScriptService] public class Service : System.Web.Services.WebService { public Service () { } [WebMethod] public string SetName(string name) { return "hello my dear friend " + name; } } JavaScript $.ajax({ type: "GET", url:'http://192.168.1.119/Service/SetName.asmx?name=pr', ContentType: "application/x-www-form-urlencoded", cache: false, dataType: "jsonp", success: onSuccess });

    Read the article

  • Lan Chatting system [closed]

    - by jay prakash singh
    Possible Duplicate: LAN chating system or LAN chat server displaying list of user to all the user window my code is i m use RMI so this is the interface declaration public void sendPublicMessage(String keyword, String username, String message) throws RemoteException; public void sendPrivateMessage(String keyword, String username, String message) throws RemoteException; public ArrayList getClientList() throws RemoteException; public void connect(String username) throws RemoteException; public void disconnect(String username) throws RemoteException; } chat Server here connectedUser is the HasMap object we use the follo0wing code for connection here ChatImpl is the stub try { InetAddress Address = InetAddress.getLocalHost(); ChatImpl csi = new ChatImpl(this); Naming.rebind("rmi://"+Address.getHostAddress()+":1099/ChatService", csi); } public ArrayList getClientList() { ArrayList myUser = new ArrayList(); Iterator i = connectedUser.keySet().iterator(); String user = null; while(i.hasNext()) { user = i.next().toString(); myUser.add(user); } return myUser; } public void addClient(Socket clientSocket) throws RemoteException { connectedUser.put(getUsername(), clientSocket); sendPublicMessage(ONLINE, getUsername(), "CLIENT"); } this is the client side code for array list public void updateClient(ArrayList allClientList) throws RemoteException { listClient.clear(); int i = 0; String username; for(i=0; i<allClientList.size(); i++) { username = allClientList.get(i).toString(); listClient.addElement(username); } }

    Read the article

  • how to reload the whole page through a button placed in a division in jsp

    - by ajeet singh
    when i tried to make web project, i placed the links on the left on one division and a bigger division on the right to load the jsp pages on clicking the links making the main page same... but when there is a need arises to load the whole page by clicking the button placed on the right division, i found that the only page is loaded on the right division jsp calling its action... please help me to sort out this problem..

    Read the article

  • min max coordinate of cells , given cell length in c#

    - by Raj
    Please see attached picture to better understand my question i have a matrix of cells of [JXI] , cell is square in shape with length "a" my question is .. is there a way to use FOR loop to assign MIN,MAX coordinate to each cell taking origin (0,0) at one corner Thanks "freeimagehosting.net/uploads/3b09575180.jpg" i was trying following code but no success int a ; a = 1; for (int J=1; J<=5; J++) { for (int I = 1; I <= 5; I++) { double Xmin = ((I - 1)*a ); double Ymin = ((J - 1) * a); double Xmax = (I * a ); double Ymax = (J * a); } }

    Read the article

  • Multiple queries using same datacontext throws SqlException

    - by Raj
    I've search control with which I'm trying to implement search as user types something. I'm using Linq to SQL to fire queries against the database. Though it works fine usually, when user types the queries really fast some random SqlException is thrown. These are the two different error message I stumbled across recently: A severe error occurred on the current command. The results, if any, should be discarded. Invalid attempt to call Read when reader is closed. Edit: Included code DataContextFactory class: public DataContextFactory(IConnectionStringFactory connectionStringFactory) { this.dataContext = new RegionDataContext(connectionStringFactory.ConnectionString); } public DataContext Context { get { return this.dataContext; } } public void SaveAll() { this.dataContext.SubmitChanges(); } Registering IDataContextFactory with Unity // Get connection string from Application.Current settings ConnectionInfo connectionInfo = Application.Current.Properties["ConnectionInfo"] as ConnectionInfo; // Register ConnectionStringFactory with Unity container as a Singleton this.container.RegisterType<IConnectionStringFactory, ConnectionStringFactory>(new ContainerControlledLifetimeManager(), new InjectionConstructor(connectionInfo.ConnectionString)); // Register DataContextFactory with Unity container this.container.RegisterType<IDataContextFactory, DataContextFactory>(); Connection string: Data Source=.\SQLEXPRESS2008;User Instance=true;Integrated Security=true;AttachDbFilename=C:\client.mdf;MultipleActiveResultSets=true; Using datacontext from a repository class: // IDataContextFactory dependency is injected by Unity public CompanyRepository(IDataContextFactory dataContextFactory) { this.dataContextFactory = dataContextFactory; } // return List<T> of companies var results = this.dataContextFactory.Context.GetTable<CompanyEntity>() .Join(this.dataContextFactory.Context.GetTable<RegionEntity>(), c => c.regioncode, r => r.regioncode, (c, r) => new { c = c, r = r }) .Where(t => t.c.summary_region != null) .Select(t => new { Id = t.c.compcode, Company = t.c.compname, Region = t.r.regionname }).ToList(); What is the work around?

    Read the article

  • Jersey Test Framework with no Maven environment

    - by Raj Arcot
    We do not use a Maven framework in our environments. Can you suggest a way to use the Jersey test framework for testing the Rest web services? I have tried to override the TestContaioner and TestContainerFactory interfaces to set up an AppDescriptor but I fail to understand how to set the LowLevelDescriptor to use the HTTPContainerFactory instead of the default one. I tried also settign the System property jersey.test.containerFactory. Does not work?Any ideas?

    Read the article

< Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >