Search Results

Search found 44763 results on 1791 pages for 'first responder'.

Page 115/1791 | < Previous Page | 111 112 113 114 115 116 117 118 119 120 121 122  | Next Page >

  • Labels mail merge repeats on subsequent pages?

    - by leeand00
    I'm trying to do a mail merge to print to labels. The first field in the document does not contain a { NEXT } field code, and because of this the records repeat between label pages for example: Notice how the records shift to the left as the next page is displayed? But how they start over again in an off by one manner? Now I've tried to fix this by using the first record displayed on a page to see if the page number is 1. If it not on page 1 of the mail merge then it should just move to the next record; otherwise it should just display the first record: This doesn't work however, because when I do the preview and display the {page} field code, it reports that I am always on page 1 and thus the same behavior continues instead of just moving to the next record on the next page.

    Read the article

  • SMTP Server Issue in intersystem cache

    - by nayanak
    I am facing an issue when I am sending Email from intersystems cache. I am able to send the mail, with out any problem the first time. But the second time when I am trying to send the smtp server is not responding properly. The first Helo command is sent. I recieve the confirmation 220 from the server. But I do not recieve the Message 250. So the next command is giving me the error 503, 5.5.2 "Send helo first" message. I am unable to find out why the server is not responding the second time.

    Read the article

  • Laptop power supplies, does current matter?

    - by CodeSlave
    I have two laptops (same manufacture), with the same type of power connector. However, the power supplies/transformers are slightly different. The output on the first laptop's power supply is 15.6 V at 8.0 A. The output on the second laptop's power supply is 15.6 V at 5A. Clearly the voltages are the same, but the currents are different. I assume the second laptop's power supply can not be used on the first, because it can't supply enough power to the laptop. However, can the first laptop's power supply be safely used on the second laptop?

    Read the article

  • Multi-Document TOC showing in wrong order

    - by Jeremy DeStefano
    I had a large document that was having formatting issues, so I split it into 2 files. Chapters 1-7 are in the main doc with the TOC and a second doc has chapters 8-12. I have the following: {TOC \O "1-3" \H \Z \U} {RD \f "MCDPS Training Manual Part2.docx"} The TOC is created and has entries from both documents, however its showing the entries from Chapter 8-11 first and then Chapter 1-7. I've read that it should list them based on page numbers, but its not. Chapter 8 starts at page 121, yet its listing it first. How can I get it to show the TOC from the main doc first and then the RD?

    Read the article

  • Is there a reason the partition tool GParted doesn't show a percentage finish number initially?

    - by Jian Lin
    I am using GParted more, and it seems to do a reliable work. I just wonder why if the tasks is to resize a 250GB partition to 190GB, and then create a new partition, the first 10, 15 minutes, there is only a blue bar moving left and right, but there won't be an indicator showing how many percent is done. Then after that 10 to 15 minutes, it does show 1:05:00 left to finish the job. Update: at first I thought there is no percentage or time remaining at all... but after waiting for 10, 15 mintues, it does show. I just wonder why it didn't show at first.

    Read the article

  • Flow of packets in network

    - by user58859
    I can't visualize in my mind the network traffic flow. eg. If there are 15 pc's in a LAN When packet goes from router to local LAN, do it passes all the computers? Does it go to the ethernet card of every computer and those computers accept the packet based on their physical address? To which pc the packet will go first? To the nearest to the router? What happens if that first pc captures that packet(though it is not for it)? What happens when a pc broadcast a message? Do it have to generate 14 packets for all the pc's or only one packet reach to all pc's? If it is one packet and captured by first pc, how other pc's can get that? I can't imagine how this traffic is exactly flows? May be my analogy is completely wrong. Can anybody explain me this?

    Read the article

  • Word: MAC 2011, TOC on too many pages

    - by Mark
    I have a Word: MAC 2011 document where the bottom of the first 40 pages or so say "TOC: Page x". This notation appears to be in the Footer, as it is gray until I click on it (then the rest of the text goes gray instead). There is no TOC that I can see in the document, so I'm presuming someone tried to create one and messed things up. After the first 40 pages or so, all the other bottom of the page notations appear to be correct. (i.e. Chapter One, Chapter Two, etc.) How can I get those first 40 pages to be part of Chapter One rather than TOC?

    Read the article

  • Why does Windows Explorer highlight only second entry?

    - by normanius
    Why does Windows Explorer highlight the second but never the first entry if I use the keyboard for navigation? Example: let's look at a folder that contains the following entries a1 a2 a3 b1 b2 If I hit 'a' on the keyboard, the explorer highlights entry 'a2' instead of 'a1'. It works fine for 'b' with 'b1' (because it's not the first entry). Similarly, if I open a folder and use the arrow-down key to navigate then the first entry is skipped again. Why?! It's probable that I'm too stupid for this but this "feature" really annoys me!

    Read the article

  • Boot from Second SATA Drive

    - by Chris
    I have a Dell Precision 490 Workstation, and I just had my other question answered, Install Ubuntu to drive B without impacting drive A, and now I'm having a boot sequence issue. The external drive is great, boots up fine on my laptop, but how do I tell my desktop to boot from my second SATA drive and not the first SATAdrive. My drive configuration as follows SATA-0: Windows SATA-1: DVDR SATA-2: Ubuntu When I choose the boot menu, the option I have is "Internal Hard Drive". I assume it searches all drives, and loads the first bootable one it finds (which happens to be Windows), but I'd like to be able to select the drive from a list. Has anyone experienced this? Is possible without disabling the first hard drive in the BIOS?

    Read the article

  • Pre-load MS Windows right-click menus and Start menu at startup

    - by Steve
    Hello brainy people. On my WinXP SP3 laptop (1.4Ghz 1.2GB ram), after I first log in, when I right-click in Windows Explorer and choose New, the submenu can take up to 15 seconds to load, which is a pain in the ass when you want to do a quick easy operation. After the submenu has loaded the first time, subsequent loads perform instantly, obviously as the menu has been cached. My question is: can these right-click menus (and the Start menu, which also takes some time to load the first time) be pre-loaded at Windows startup? Thanks.

    Read the article

  • How Do I Enable CUPS Browsing Across A Network?

    - by David Mackintosh
    I have a CUPS server with two print queues defined. Once this was defined, all the CUPS clients on the same subnet could see the two print queues automatically, no problem. Now I have a collection of machines on a separate subnet, reachable from the first subnet by a router. How do I enable CUPS browsing on the second set of machines so that they can see the print queues defined on the first machine? Let's call the server A.B.C.7. The first subnet is A.B.C.0/24. The second subnet is A.B.D.0/24, and there is a router with arms on both networks.

    Read the article

  • Excel Matching problem with logic expression

    - by abelenky
    I have a block of data that represents the steps in a process and the possible errors: ProcessStep Status FeesPaid OK FormRecvd OK RoleAssigned OK CheckedIn Not Checked In. ReadyToStart Not Ready for Start I want to find the first Status that is not "OK". I have attempted this: =Match("<>""OK""", StatusRange, 0) which is supposed to return the index of the first element in the range that is NOT-EQUAL (<) to "OK" But this doesn't work, instead returning #N/A. I expect it to return 4 (index #4, in a 1-based index, representing that CheckedIn is the first non-OK element) Any ideas how to do this?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • VPN Authentication Credentials (Local/Remote Identifiers) For Remote Access VPN

    - by thatidiotguy
    So I am trying to set up a remote access VPN using the free ShrewSoft vpn client: https://www.shrew.net/software I want to use a PSK as the authentication mechanism combined with XAuth so that a connection requires a valid username/pass combo. Under the authentication tab this particular VPN Client however is asking for a Local Identity and a Remote Identity. The options for Local Identity Type are: Fully Qualified Domain Name User Fully Qualified Domain Name IP Address Key Identifier The options for Remote Identity are: Any Fully Qualified Domain Name User Fully Qualified Domain Name IP Address Key Identifier My current thinking is that I can use the Fully Qualifed Domain Name provided by the remote firewall for the Remote Identity, but I do not know what it wants for local identity. Just to stress: I am not trying to set up a site to site VPN. Can anybody shed any light on what I am missing here? A screenshot can be provided if that would be helpful. The current error I am getting during the connection is: IKE Responder: Proposed IKE ID mismatch

    Read the article

  • Auto-response on a mail non universal group

    - by russ
    Four domain users are part of global security group [email protected] running on Windows Server 2008 Standard and Exchange 2007 as a mail non universal group. Our goal is to create an auto-responder rule, or template that fires at sender. I have created a mail-enabled public folder, with owner permissions for each group member. I have also set up a rule template (response) and I am a little unclear as to the send as permission set, or where to set that up. Can someone please tell me if I am on the right track? Will I have to do each Outlook client machine (whole group!) the same?

    Read the article

  • Sudo asks for password twice with LDAP authentication

    - by Gnudiff
    I have Ubuntu 8.04 LTS machine and Windows 2003 AD domain. I have succesfully set up that I can log in with domain username and password, using domain prefix, like "domain+username". Upon login to machine it all works first try, however, for some reason when I try to sudo my logged in user, it asks for the password twice every time when I try sudo. It accepts the password after 2nd time, but not the first time. Once or twice I might think I just keep entering wrong pass the first time, but this is what happens always, any ideas of what's wrong? pam.conf is empty pam.d/sudo only includes common-auth & common-account, and common-auth is: auth sufficient pam_unix.so nullok_secure auth sufficient pam_winbind.so auth requisite pam_deny.so auth required pam_permit.so

    Read the article

  • ESX Firewall Command Troubles

    - by John
    Hi, I am working on creating some firewall rules to stop some of the SSH brute-force attacks that we have seen recently on our ESX server hosts. I have tried the following rules from the CLI to first block all SSH traffic and then allow the two ranges that I am interested in: esxcfg-firewall --ipruleAdd 0.0.0.0/0,22,tcp,REJECT,"Block_SSH" esxcfg-firewall --ipruleAdd 11.130.0.0/16,22,tcp,ACCEPT,"Allow_PUBLIC_SSH" esxcfg-firewall --ipruleAdd 10.130.0.0/16,22,tcp,ACCEPT,"Allow_PRIVATE_SSH" However, these rules are not working as intended. I know that if you do not enter the block rule first, then the allow rule will not be processed. We are now having the issue where the first entered allow rule is being ignored such that the block rule works and the last entered allow rule works. I was curious if anyone had any ideas on how I could allow a few different ranges of IP's with the esxcfg-firewall --ipruleAdd command? I am at a loss and am having a hard time locating examples or further documentation about this. Thanks in advance for your help with this.

    Read the article

  • How to convert excel individual cell values to percentage change values over time

    - by cgalloway
    I have two years of excel data showing daily share prices of a particular stock. I want to change those values to show percentage change (on a daily basis) from the zero date (ie the first day of the two year period). I know that the formula for showing daily percentage change would be (second day/first day -1) and that I can click and drag on that formula to extend over the rest of the two-year time period. The formula I want would be, basically, (each day/first day-1). Is there an easy way to automate the script so I dont have to type it out 730 times?

    Read the article

  • Asterisk Register username with special character like "@"

    - by Najibul Huq
    I am using a SIP provider that has provided me with a username like: [email protected] (Note this is only the username part) And has a numerical password. My Register string looks something like this: [email protected]:[email protected] But this is not working, as asterisk is only sending the first part +112223344 before the first @. My provider is adamant about having the full form of it. This is the first time I am facing this issue that is quite unusual for me. Please help.

    Read the article

  • Merged rows in column, bottom row fixed height

    - by Styxxy
    I've been struggling some time now with a specific problem using Tables in MS Word (2010). I have a table with 2 rows and 2 columns and the last column, the rows are merged. Now it can happen that this last cell will expand, and I would like to have the last row in the first column to be of a fixed height and the first row has to expand. What happens now is that the last row expands and the first row has a "fixed" height. A picture of the behaviour at this moment: And this is how I would like it to behave: I have been looking through all properties and settings, but I don't seem to find any option. Neither can I found anything by searching online (probably not using the exact right keywords). Any help is appreciated.

    Read the article

  • Ubuntu 12.04 on Amazon EC2: /dev/xvda1 will be checked for errors at next reboot?

    - by cwd
    I'm running the lastest Ubuntu 12.04 AMI (ami-a29943cb) from Canonical on Amazon EC2 and quite often when I log in I get the message: *** /dev/xvda1 will be checked for errors at next reboot *** I have read a bunch of documentation on this and seem to understand that every so many reboots (around 37 see Mount count / Maximum mount count below) Ubuntu wants to check a disk for errors. I can see that by using dumpe2fs -h /dev/xvda1 (reference) to get information such as: Last mounted on: / Filesystem UUID: 1ad27d06-4ecf-493d-bb19-4710c3caf924 Filesystem magic number: 0xEF53 Filesystem revision #: 1 (dynamic) Filesystem features: has_journal ext_attr resize_inode dir_index filetype needs_recovery extent flex_bg sparse_super large_file huge_file uninit_bg dir_nlink extra_isize Filesystem flags: signed_directory_hash Default mount options: (none) Filesystem state: clean Errors behavior: Continue Filesystem OS type: Linux Inode count: 524288 Block count: 2097152 Reserved block count: 104857 Free blocks: 1778055 Free inodes: 482659 First block: 0 Block size: 4096 Fragment size: 4096 Reserved GDT blocks: 511 Blocks per group: 32768 Fragments per group: 32768 Inodes per group: 8192 Inode blocks per group: 512 Flex block group size: 16 Filesystem created: Tue Apr 24 03:07:48 2012 Last mount time: Thu Nov 8 03:17:58 2012 Last write time: Tue Apr 24 03:08:52 2012 Mount count: 3 Maximum mount count: 37 Last checked: Tue Apr 24 03:07:48 2012 Check interval: 15552000 (6 months) Next check after: Sun Oct 21 03:07:48 2012 Lifetime writes: 2454 MB Reserved blocks uid: 0 (user root) Reserved blocks gid: 0 (group root) First inode: 11 Inode size: 256 Required extra isize: 28 Desired extra isize: 28 Journal inode: 8 Default directory hash: half_md4 Directory Hash Seed: 0a25e04c-6169-4d68-bfa6-a1acd8e39632 Journal backup: inode blocks Journal features: journal_incompat_revoke Journal size: 128M Journal length: 32768 Journal sequence: 0x0000158b Journal start: 1 I've tried these things to get rid of the message and usually the badblocks is what does it for me: Run this command and reboot: sudo touch /forcefsck Run badblocks to check the disk: badblocks /dev/sda1 Edit /etc/fstab and change the last "0" which is the fs_passno column accordingly and then reboot: The root filesystem should be specified with a fs_passno of 1, and other filesystems should have a fs_passno of 2. I don't understand: If this is a virtual drive shouldn't it be less prone to errors? Was the image created with one of the flags set? If not what is triggering it? Why is fs_passno set to 0 on Amazon EC2 Ubuntu images? This is not the first one that is like this.

    Read the article

  • Sublinear Extra Space MergeSort

    - by hulkmeister
    I am reviewing basic algorithms from a book called Algorithms by Robert Sedgewick, and I came across a problem in MergeSort that I am, sad to say, having difficulty solving. The problem is below: Sublinear Extra Space. Develop a merge implementation that reduces that extra space requirement to max(M, N/M), based on the following idea: Divide the array into N/M blocks of size M (for simplicity in this description, assume that N is a multiple of M). Then, (i) considering the blocks as items with their first key as the sort key, sort them using selection sort; and (ii) run through the array merging the first block with the second, then the second block with the third, and so forth. The problem I have with the problem is that based on the idea Sedgewick recommends, the following set of arrays will not be sorted: {0, 10, 12}, {3, 9, 11}, {5, 8, 13}. The algorithm I use is the following: Divide the full array into subarrays of size M. Run Selection Sort on each of the subarrays. Merge each of the subarrays using the method Sedgwick recommends in (ii). (This is where I encounter the problem of where to store the results after the merge.) This leads to wanting to increase the size of the auxiliary space needed to handle at least two subarrays at a time (for merging), but based on the specifications of the problem, that is not allowed. I have also considered using the original array as space for one subarray and using the auxiliary space for the second subarray. However, I can't envision a solution that does not end up overwriting the entries of the first subarray. Any ideas on other ways this can be done? NOTE: If this is suppose to be on StackOverflow.com, please let me know how I can move it. I posted here because the question was academic.

    Read the article

  • Parallelism in .NET – Part 4, Imperative Data Parallelism: Aggregation

    - by Reed
    In the article on simple data parallelism, I described how to perform an operation on an entire collection of elements in parallel.  Often, this is not adequate, as the parallel operation is going to be performing some form of aggregation. Simple examples of this might include taking the sum of the results of processing a function on each element in the collection, or finding the minimum of the collection given some criteria.  This can be done using the techniques described in simple data parallelism, however, special care needs to be taken into account to synchronize the shared data appropriately.  The Task Parallel Library has tools to assist in this synchronization. The main issue with aggregation when parallelizing a routine is that you need to handle synchronization of data.  Since multiple threads will need to write to a shared portion of data.  Suppose, for example, that we wanted to parallelize a simple loop that looked for the minimum value within a dataset: double min = double.MaxValue; foreach(var item in collection) { double value = item.PerformComputation(); min = System.Math.Min(min, value); } .csharpcode, .csharpcode pre { font-size: small; color: black; font-family: consolas, "Courier New", courier, monospace; background-color: #ffffff; /*white-space: pre;*/ } .csharpcode pre { margin: 0em; } .csharpcode .rem { color: #008000; } .csharpcode .kwrd { color: #0000ff; } .csharpcode .str { color: #006080; } .csharpcode .op { color: #0000c0; } .csharpcode .preproc { color: #cc6633; } .csharpcode .asp { background-color: #ffff00; } .csharpcode .html { color: #800000; } .csharpcode .attr { color: #ff0000; } .csharpcode .alt { background-color: #f4f4f4; width: 100%; margin: 0em; } .csharpcode .lnum { color: #606060; } This seems like a good candidate for parallelization, but there is a problem here.  If we just wrap this into a call to Parallel.ForEach, we’ll introduce a critical race condition, and get the wrong answer.  Let’s look at what happens here: // Buggy code! Do not use! double min = double.MaxValue; Parallel.ForEach(collection, item => { double value = item.PerformComputation(); min = System.Math.Min(min, value); }); This code has a fatal flaw: min will be checked, then set, by multiple threads simultaneously.  Two threads may perform the check at the same time, and set the wrong value for min.  Say we get a value of 1 in thread 1, and a value of 2 in thread 2, and these two elements are the first two to run.  If both hit the min check line at the same time, both will determine that min should change, to 1 and 2 respectively.  If element 1 happens to set the variable first, then element 2 sets the min variable, we’ll detect a min value of 2 instead of 1.  This can lead to wrong answers. Unfortunately, fixing this, with the Parallel.ForEach call we’re using, would require adding locking.  We would need to rewrite this like: // Safe, but slow double min = double.MaxValue; // Make a "lock" object object syncObject = new object(); Parallel.ForEach(collection, item => { double value = item.PerformComputation(); lock(syncObject) min = System.Math.Min(min, value); }); This will potentially add a huge amount of overhead to our calculation.  Since we can potentially block while waiting on the lock for every single iteration, we will most likely slow this down to where it is actually quite a bit slower than our serial implementation.  The problem is the lock statement – any time you use lock(object), you’re almost assuring reduced performance in a parallel situation.  This leads to two observations I’ll make: When parallelizing a routine, try to avoid locks. That being said: Always add any and all required synchronization to avoid race conditions. These two observations tend to be opposing forces – we often need to synchronize our algorithms, but we also want to avoid the synchronization when possible.  Looking at our routine, there is no way to directly avoid this lock, since each element is potentially being run on a separate thread, and this lock is necessary in order for our routine to function correctly every time. However, this isn’t the only way to design this routine to implement this algorithm.  Realize that, although our collection may have thousands or even millions of elements, we have a limited number of Processing Elements (PE).  Processing Element is the standard term for a hardware element which can process and execute instructions.  This typically is a core in your processor, but many modern systems have multiple hardware execution threads per core.  The Task Parallel Library will not execute the work for each item in the collection as a separate work item. Instead, when Parallel.ForEach executes, it will partition the collection into larger “chunks” which get processed on different threads via the ThreadPool.  This helps reduce the threading overhead, and help the overall speed.  In general, the Parallel class will only use one thread per PE in the system. Given the fact that there are typically fewer threads than work items, we can rethink our algorithm design.  We can parallelize our algorithm more effectively by approaching it differently.  Because the basic aggregation we are doing here (Min) is communitive, we do not need to perform this in a given order.  We knew this to be true already – otherwise, we wouldn’t have been able to parallelize this routine in the first place.  With this in mind, we can treat each thread’s work independently, allowing each thread to serially process many elements with no locking, then, after all the threads are complete, “merge” together the results. This can be accomplished via a different set of overloads in the Parallel class: Parallel.ForEach<TSource,TLocal>.  The idea behind these overloads is to allow each thread to begin by initializing some local state (TLocal).  The thread will then process an entire set of items in the source collection, providing that state to the delegate which processes an individual item.  Finally, at the end, a separate delegate is run which allows you to handle merging that local state into your final results. To rewriting our routine using Parallel.ForEach<TSource,TLocal>, we need to provide three delegates instead of one.  The most basic version of this function is declared as: public static ParallelLoopResult ForEach<TSource, TLocal>( IEnumerable<TSource> source, Func<TLocal> localInit, Func<TSource, ParallelLoopState, TLocal, TLocal> body, Action<TLocal> localFinally ) The first delegate (the localInit argument) is defined as Func<TLocal>.  This delegate initializes our local state.  It should return some object we can use to track the results of a single thread’s operations. The second delegate (the body argument) is where our main processing occurs, although now, instead of being an Action<T>, we actually provide a Func<TSource, ParallelLoopState, TLocal, TLocal> delegate.  This delegate will receive three arguments: our original element from the collection (TSource), a ParallelLoopState which we can use for early termination, and the instance of our local state we created (TLocal).  It should do whatever processing you wish to occur per element, then return the value of the local state after processing is completed. The third delegate (the localFinally argument) is defined as Action<TLocal>.  This delegate is passed our local state after it’s been processed by all of the elements this thread will handle.  This is where you can merge your final results together.  This may require synchronization, but now, instead of synchronizing once per element (potentially millions of times), you’ll only have to synchronize once per thread, which is an ideal situation. Now that I’ve explained how this works, lets look at the code: // Safe, and fast! double min = double.MaxValue; // Make a "lock" object object syncObject = new object(); Parallel.ForEach( collection, // First, we provide a local state initialization delegate. () => double.MaxValue, // Next, we supply the body, which takes the original item, loop state, // and local state, and returns a new local state (item, loopState, localState) => { double value = item.PerformComputation(); return System.Math.Min(localState, value); }, // Finally, we provide an Action<TLocal>, to "merge" results together localState => { // This requires locking, but it's only once per used thread lock(syncObj) min = System.Math.Min(min, localState); } ); Although this is a bit more complicated than the previous version, it is now both thread-safe, and has minimal locking.  This same approach can be used by Parallel.For, although now, it’s Parallel.For<TLocal>.  When working with Parallel.For<TLocal>, you use the same triplet of delegates, with the same purpose and results. Also, many times, you can completely avoid locking by using a method of the Interlocked class to perform the final aggregation in an atomic operation.  The MSDN example demonstrating this same technique using Parallel.For uses the Interlocked class instead of a lock, since they are doing a sum operation on a long variable, which is possible via Interlocked.Add. By taking advantage of local state, we can use the Parallel class methods to parallelize algorithms such as aggregation, which, at first, may seem like poor candidates for parallelization.  Doing so requires careful consideration, and often requires a slight redesign of the algorithm, but the performance gains can be significant if handled in a way to avoid excessive synchronization.

    Read the article

  • CodePlex Daily Summary for Tuesday, March 09, 2010

    CodePlex Daily Summary for Tuesday, March 09, 2010New Projects.NET Excel Wrapper - Read, Write, Edit & Automate Excel Files in .NET with ease: .NET Excel Wrapper encapsulates the complexity of working with multiple Excel objects giving you one central point to do all your processing. It h...Advancement Voyage: Advancement Voyage is a high quality RPG experience that provides all the advancement and voyaging that a player could hope for.ASP.Net Routing configuration: ASP.NET routing configuration enables you to configure the routes in the web.config bbinjest: bbinjestBuildUp: BuildUp is a build number increment tool for C# .net projects. It is run as a post build step in Visual Studio.Controlled Vocabulary: This project is devoted to creating tools to assist with Controlling Vocabulary in communication. The initial delivery is an Outlook 2010 Add-in w...CycleList: A replacement for the WPF ListBox Control. Displays only a single item and allows the user to change the selected item by clicking on it once. Very...Forensic Suite: A suite of security softwareFREE DNN Chat Module for 123 Flash Chat -- Embed FREE Chat Room!: 123 Flash Chat is a live chat solution and its DotNetNuke Chat Module helps to embed a live chat room into website with DotNetNuke(DNN) integrated ...HouseFly experimental controls: Experimental controls for use in HouseFly.ICatalogAll: junkMidiStylus: MidiStylus allows you to control MIDI-enabled hardware or software using your pressure-sensitive pen tablet. The program maps the X position, Y po...myTunes: Search for your favorite artistsNColony - Pluggable Socialism?: NColony will maximize the use of MEF to create flexible application architectures through a suite of plug-in solutions. If MEF is an outlet for plu...Network Monitor Decryption Expert: NmDecrypt is a Network Monitor Expert which when given a trace with encrypted frames, a security certificate, and a passkey will create a new trace...occulo: occulo is a free steganography program, meant to embed files within images with optional encrytion. Open Ant: A implementation of a Open Source Ant which is created to show what is possible in the serious game AntMe! The First implementation of that ProjectProgramming Patterns by example: Design patterns provide solutions to common software design problems. This project will contain samples, written in c# and ruby, of each design pat...project4k: Developing bulk mail system storing email informationQuail - Selenium Remote Control Made Easy: Quail makes it easy for Quality Assurance departments write automated tests against web applications. Both HTML and Silverlight applications can b...RedBulb for XNA Framework: RedBulb is a collection of utility functions and classes that make writing games with XNA a lot easier. Key features: Console,GUI (Labels, Buttons,...RegExpress: RegExpress is a WPF application that combines interactive demos of regular expressions with slide content. This was designed for a user group prese...RemoveFolder: Small utility program to remove empty foldersScrumTFS: ScrumTFSSharePoint - Open internal link in new window list definition: A simple SharePoint list definition to render SharePoint internal links with the option to open them in a new window.SqlSiteMap4MVC: SqlSiteMapProvider for ASP.Net MVC.T Sina .NET Client: t.sina.com.cn api 新浪微博APITest-Lint-Extensions: Test Lint is a free Typemock VS 2010 Extension that finds common problems in your unit tests as you type them. this project will host extensions ...ThinkGearNET: ThinkGearNET is a library for easy usage of the Neurosky Mindset headset from .NET .Wiki to Maml: This project enables you to write wiki syntax and have it converted into MAML syntax for Sandcastle documentation projects.WPF Undo/Redo Framework: This project attempts to solve the age-old programmer problem of supporting unlimited undo/redo in an application, in an easily reusable manner. Th...WPFValidators: WPF Validators Validações de campos para WPFWSP Listener: The WSP listener is a windows service application which waits for new WSC and WSP files in a specific folder. If a new WSC and WSP file are added, ...New Releases.NET Excel Wrapper - Read, Write, Edit & Automate Excel Files in .NET with ease: First Release: This is the first release which includes the main library release..NET Excel Wrapper - Read, Write, Edit & Automate Excel Files in .NET with ease: Updated Version: New Features:SetRangeValue using multidimensional array Print current worksheet Print all worksheets Format ranges background, color, alig...ArkSwitch: ArkSwitch v1.1.2: This release removes all memory reporting information, and is focused on stability.BattLineSvc: V2.1: - Fixed a bug where on system start-up, it would pop up a notification box to let you know the service started. Annoying! And fixed! - Fixed the ...BuildUp: BuildUp 1.0 Alpha 1: Use at your own risk!Not yet feature complete. Basic build incrementing and attribute overriding works. Still working on cascading build incremen...Controlled Vocabulary: 1.0.0.1: Initial Alpha Release. System Requirements Outlook 2010 .Net Framework 3.5 Installation 1. Close Outlook (Use Task Manager to ensure no running i...CycleList: CycleList: The binaries contain the .NET 3.5 DLL ONLY. Please download source for usage examples.FluentNHibernate.Search: 0.3 Beta: 0.3 Beta take the following changes : Mappings : - Field Mapping without specifying "Name" - Id Mapping without specifiying "Field" - Builtin Anal...FREE DNN Chat Module for 123 Flash Chat -- Embed FREE Chat Room!: 123 Flash Chat DNN Chat Module: With FREE DotNetNuke Chat Module of 123 Flash Chat, webmaster will be assist to add a chat room into DotNetNuke instantly and help to attract more ...GameStore League Manager: League Manager 1.0 release 3: This release includes a full installer so that you can get your league running faster and generate interest quicker.iExporter - iTunes playlist exporting: iExporter gui v2.3.1.0 - console v1.2.1.0: Paypal donate! Solved a big bug for iExporter ( Gui & Console ) When a track isn't located under the main iTunes library, iExporter would crash! ...jQuery.cssLess: jQuery.cssLess 0.3: New - Removed the dependency from XRegExp - Added comment support (both CSS style and C style) - Optimised it for speed - Added speed test TOD...jQuery.cssLess: jQuery.cssLess 0.4: NEW - @import directive - preserving of comments in the resulting CSS - code refactoring - more class oriented approach TODO - implement operation...MapWindow GIS: MapWindow 6.0 msi (March 8): Rewrote the shapefile saving code in the indexed case so that it uses the shape indices rather than trying to create features. This should allow s...MidiStylus: MidiStylus 0.5.1: MidiStylus Beta 0.5.1 This release contains basic functionality for transmitting MIDI data based on X position, Y position, and pressure value rea...MiniTwitter: 1.09.1: MiniTwitter 1.09.1 更新内容 修正 URL に & が含まれている時に短縮 URL がおかしくなるバグを修正Mosaictor: first executable: .exe file of the app in its current state. Mind you that this will likely be highly unstable due to heaps of uncaught errors.MvcContrib a Codeplex Foundation project: T4MVC: T4MVC is a T4 template that generates strongly typed helpers for ASP.NET MVC. You can download it below, and check out the documention here.N2 CMS: 2.0 beta: Major Changes ASP.NET MVC 2 templates Refreshed management UI LINQ support Performance improvements Auto image resize Upgrade Make a comp...NotesForGallery: ASP.NET AJAX Photo Gallery Control: NotesForGallery 2.0: PresentationNotesForGallery is an open source control on top of the Microsoft ASP.NET AJAX framework for easy displaying image galleries in the as...occulo: occulo 0.1 binaries: Windows binaries. Tested on Windows XP SP2.occulo: occulo 0.1 source: Initial source release.Open NFe: DANFE 1.9.5: Ajuste de layout e correção dos campos de ISS.patterns & practices Web Client Developer Guidance: Web Application Guidance -- March 8th Drop: This iteration we focused on documentation and bug fixes.PoshConsole: PoshConsole 2.0 Beta: With this release, I am refocusing PoshConsole... It will be a PowerShell 2 host, without support for PowerShell 1.0 I have used some of the new P...Quick Performance Monitor: QPerfmon 1.1: Now you can specify different updating frequencies.RedBulb for XNA Framework: Cipher Puzzle (Sample) Creators Club Package: RedBulb Sample Game: Cipher Puzzle http://bayimg.com/image/galgfaacb.jpgRedBulb for XNA Framework: RedBulbStarter (Base Code): This is the code you need to start with. Quick Start Guide: Download the latest version of RedBulb: http://redbulb.codeplex.com/releases/view/415...RoTwee: RoTwee 7.0.0.0 (Alpha): Now this version is under improvement of code structure and may be buggy. However movement of rotation is quite good in this version thanks to clea...SCSI Interface for Multimedia and Block Devices: Release 9 - Improvements and Bug Fixes: Changes I have made in this version: Fixed INQUIRY command timeout problem Lowered ISOBurn's memory usage significantly by not explicitly setting...SharePoint - Open internal link in new window list definition: Open link in new window list definition: First release, with english and italian localization supportSharePoint Outlook Connector: Version 1.2.3.2: Few bug fixing and some ui enhancementsSysI: sysi, release build: Better than ever -- now allows for escalation to adminThe Silverlight Hyper Video Player [http://slhvp.com]: Beta 1: Beta (1.1) The code is ready for intensive testing. I will update the code at least every second day until we are ready to freeze for V1, which wi...Truecrafting: Truecrafting 0.52: fixed several trinkets that broke just before i released 0.51, sorry fixed water elemental not doing anything while summoned if not using glyph o...Truecrafting: Truecrafting 0.53: fixed mp5 calculations when gear contained mp5 and made the formulas more efficient no need to rebuild profiles with this release if placed in th...umbracoSamplePackageCreator (beta): Working Beta: For Visual Studio 2008 creating packages for Umbraco 4.0.3.VCC: Latest build, v2.1.30307.0: Automatic drop of latest buildVCC: Latest build, v2.1.30308.0: Automatic drop of latest buildVOB2MKV: vob2mkv-1.0.3: This is a maintenance update of the VOB2MKV utility. The MKVMUX filter now describes the cluster locations using a separate SeekHead element at th...WPFValidators: WPFValidators 1.0 Beta: Primeira versão do componente ainda em Beta, pode ser utilizada em produção pois esta funcionando bem e as futuras alterações não sofreram muito im...WSDLGenerator: WSDLGenerator 0.0.06: - Added option to generate SharePoint compatible *disco.aspx file. - Changed commandline optionsWSP Listener: WSP Listener version 1.0.0.0: First version of the WSP Listener includes: Easy cop[y paste installation of WSP solutions Extended logging E-mail when installation is finish...Yet another pali text reader: Pali Text Reader App v1.1: new features/updates + search history is now a tab + format codes in dictionary + add/edit terms in the dictionary + pali keyboard inserts symbols...Most Popular ProjectsMetaSharpi4o - Indexed LINQResExBraintree Client LibraryGeek's LibrarySharepoint Feature ManagerConfiguration ManagementOragon Architecture SqlBuilderTerrain Independant Navigating Automaton v2.0WBFS ManagerMost Active ProjectsUmbraco CMSRawrSDS: Scientific DataSet library and toolsBlogEngine.NETjQuery Library for SharePoint Web ServicesFasterflect - A Fast and Simple Reflection APIFarseer Physics Enginepatterns & practices – Enterprise LibraryTeam FTW - Software ProjectIonics Isapi Rewrite Filter

    Read the article

  • CodePlex Daily Summary for Friday, March 05, 2010

    CodePlex Daily Summary for Friday, March 05, 2010New Projects.svn Folders Cleanup Tool: dotSVN Cleanup is a tool that allows you to remove the .svn folders . Just click, browse, say abracadabra ...and the magic is done. Have fun with...Accord: The Accord framework creates an easy we to integrate any Dependency Injection framework into your project, while abstracting the details of your im...Asp.net MVC Lab: Try asp.net mvc outASP.NET Themes management with Webforms: The provided source is an example for how to use themes in ASP.NET Webforms. this source is the "up to date" support for the article I wroteB&W Port Scanner: B&W Port Scanner (formerly Net Inspector) is a fast TCP Port scan utility. The main idea is support of customizable operations to be performed f...BizTalk SWAT - Simple Web Activity Tracker: This is a web based version of BizTalk HAT. The concept is designed to be able to share and enable sharing of orchestration info easily. Some of th...C# Linear Hash Table: A C# dictionary-like implementation of a linear hash table. It is more memory efficiant than the .NET dictionary, and also almost as fast. NOTE: On...DBF Import Export Wizard: DBF Import Export Wizard is a tool for anyone needing to import DBF files into SQL Server or to export SQL Server tables to a DBF file. This proje...Domain as XML - Driven Development: Visual Studio Code Samples: Domain as XML - Driven Development: Visual Studio Code SamplesEasyDownload: This application allows to manage downloads handling an stack of files and several useful configurationsEos2: .FlightTickets: This application allows to buy flight ticketsFotofly PhotoViewer: A Silverlight control that uses the Fotofly metadata library to show the people in a photo (using Windows Live Photo Gallery People metadata) and a...Fujiy source code: Source code examplesGameSet: This application allows to play games with distributed users.Injectivity (Dependency Injection): Injectivity is a dependency injection framework (written in C#) with a strong focus on the ease of configuration and performance. Having been writt...Inventory: Keep track of inputs, materias and salesLoanTin.Com Source Code: LoanTin.Com - a Social Networking Website as same as Tumblr.com, based on source code of Loantiner Project, allow anyone can share anything to anyo...mysln: my solutions.NumTextBox: TextBox控件重写 之NumTextBox,主要实现的功能是,只允许输入数字,或String,Numeric,Currency,Decimal,Float,Double,Short,Int,Long 修改自:http://www.codeproject.com/KB/edit/num...Quick Performance Monitor: This small utility helps to monitor performance counters without using the full blown perfmon tool from Windows. It supports a number of command li...Runo: Runo ResearchSales: This application allows to manage a hardware storeScrewWiki Form Auth Provider: Enables your ASP.NET site to use Forms Authentication to integrate with your ScrewWiki. User management is performed on a parent site, and cookie i...SDS: Scientific DataSet library and tools: The SDS library makes it easy for .Net developers to read, write and share scalars, vectors, matrices and multidimensional grids which are very com...ShapeSweeper: Minesweeper-like game for the Zune HD. Each hidden object has three properties to discover--location, color, and shape--and all three must be corre...SilverlightExcel: an Excel file viewer in Silverlight 4: SilverlightExcel is a Silverlight application allowing you to open and view Excel files and also create graphs.sPWadmin: pwAdmin is an Web Interface based on JSP that uses the PW-Java API to control an PW-Server.Video Player control in Silverlight: A control for playing video in Silverlight 4 with chapters on timeline control. This player will be easily skinnable and customizable. More Featur...XNA Light Pre Pass Renderer: A demo/sample that shows how to write a light pre pass renderer in XNA.Zimms: Collaboration Site for friends, a code depot, and scratch padNew Releases.svn Folders Cleanup Tool: dotSVN Cleanup Tool: dotSVN Cleanup Tool executableAccord: Alpha: Initial build of the Accord framework.AcPrac: AcPrac Ver 0.1: The first version of AcPrac. It is not fully functional, but rather a version to get the bugs out. Please report all bugs.ASP.NET: ASP.NET Browser Definition Files: This download contains: ASP.NET 4 Browser Definition Files -- You can use the new ASP.NET 4 browser definition files with earlier versions of ASP....B&W Port Scanner: Black`n`White Port Scanner 1.0: B&W Port Scanner 1.0 Final Release Date: 03.03.2010 Black`n`WhiteBizTalk SWAT - Simple Web Activity Tracker: BizTalk SWAT: This is a web based version of BizTalk HAT. The concept is designed to be able to share and enable sharing of orchestration info easily. It uses th...BTP Tools: CSB+CUV+HCSB dict files 2010-03-04: 5. is now missing a space between the Strong’s number and the Count: >CSB Translation: 圣所 7, 至圣所G39+G394 it should be: CSB Translation: 圣所 7, 至圣所G...C# Linear Hash Table: Linear Hash Table: First working version of the Linear Hash Table.Cassiopeia: WinTools 1.0 beta: First ReleaseComposure: Caliburn-44007-trunk-vs2010.net40: This is a very simple conversion of the Caliburn trunk (rev 44007) for use in Visual Studio 2010 RC1 built against .NET40. Because the conversion w...Cover Creator: CoverCreator 1.3.0: English and Polish version. Functionality to add image to the front page. Load / save covers.DBF Import Export Wizard: DBF Import Export Wizard Source Code: Version 0.1.0.3DBF Import Export Wizard: DBF_Import_Export_Wizard Setup 0.1.0.3: Zip file contains Setup.exeESB Toolkit Extensions: Tellago BizTalk ESB 2.0 Toolkit Extensions v0.2: Windows Installer file that installs Library on a BizTalk ESB 2.0 system. This Install automatically configures the esb.config to use the new compo...Fotofly PhotoViewer: Fotofly Photoview v0.1: The first public release. Based on a Silverlight application I have been using for over a year at www.tassography.com. This version uses Fotofly v0...HPC with GPUs applied to CG: Cuda Soft Bodies simulation: Cuda src for soft bodiesHPC with GPUs applied to CG: Full Soft Bodies src: full src code for soft bodies simulationInjectivity (Dependency Injection): 2.8.166.2135: Release 2.8.166.2135 of the Injectivity dependency injection framework.Line Counter: 1.5 (Code Outline Preview): This version contains preview of the code outline feature, you can now view C# code outline within Line Counter. Note that the code outline now onl...Micajah Mindtouch Deki Wiki Copier: MicajahWikiCopier: You should use the following line arguments: WikiCopier.exe "http://oldwikiwithdata.wik.is/@api/deki" "login" "password" "http://newwiki.somename.l...ncontrols: Alpha 0.4.0.1: Added some example on the Console Project.NumTextBox: NumTextBox初始版本: TextBox控件重写 之NumTextBox,主要实现的功能是,只允许输入数字,或String,Numeric,Currency,Decimal,Float,Double,Short,Int,Long 此为初始版本PSCodeplex: PS CodePlex 0.2: PS CodePlex 0.2 has some breaking changes to the parameters. A few of the parameters are renamed and a few are made as switch parameters. Add-Rele...Quick Performance Monitor: QPerfMon First release - Version 1.0.0: The first release of the utility.RapidWebDev - .NET Enterprise Software Development Infrastructure: ProductManagement Quick Sample 0.2: This is a sample product management application to demonstrate how to develop enterprise software in RapidWebDev. The glossary of the system are ro...ScrewWiki Form Auth Provider: ScrewWiki Forms Authentication: Initial ReleaseSee.Sharper: See.Sharper.Docs-1.10.3.4: HTML documentation (including Doxygen project)See.Sharper: See.Sharper-1.10.3.4: Solution (Source files, debug and release binaries)Solar.Generic: Solar.Generic 0.8.0.0 Beta (Revised, Renamed): Solar.Generic 0.8.0.0 (Revised & Renamed) Renamed project from Solar.Commons to Solar.Generic. Project solution file is now in format of Visual ...Solar.Security: Solar.Security 1.1.0.0: Performed several major refactorings of code base. Stripped In-Memory implementation of IConfiguration interface of transactional behavior due to...sPWadmin: pwAdmin v0.7: -Star System Simulator: Star System Simulator 2.3: Changes in this release: Fixed several localisation issues. Features in this release: Model star systems in 3D. Euler-Cromer method. Improved...SysI: sysi, stable and ready: This time for sure.TheWhiteAmbit: TheWhiteAmbit - Demo: Two little demos demonstrating: - fast realtime raytracing - generating bent normals for shading (CUDA capable GPU needed = nVidia GeForce >8x00)VsTortoise - a TortoiseSVN add-in for Microsoft Visual Studio: VsTortoise Build 22 Beta: Build 22 (beta) New: Visual Studio 2010 RC support (VsTortoise for Visual Studio 2010 RC screenshots) New: VsTortoise integrates in to Solution E...WinMergeFS: WinMergeFS 0.1.42128alpha: WinMergeFS provides AuFS functionality for windows. With WinMergeFS users can mount multiple directories into a virtual drive. Plugin based root se...WSDLGenerator: WSDLGenerator 0.0.0.2: - Bugs fixed - Code refactored - Added support for custom typesXNA Light Pre Pass Renderer: LightPrePassRendererXNA: Zipped source code for the light pre pass renderer made with XNA.Most Popular ProjectsMetaSharpRawrWBFS ManagerAJAX Control ToolkitMicrosoft SQL Server Product Samples: DatabaseSilverlight ToolkitWindows Presentation Foundation (WPF)LiveUpload to FacebookASP.NETMicrosoft SQL Server Community & SamplesMost Active ProjectsUmbraco CMSRawrBlogEngine.NETSDS: Scientific DataSet library and toolsMapWindow GISpatterns & practices – Enterprise LibraryjQuery Library for SharePoint Web ServicesIonics Isapi Rewrite FilterMDT Web FrontEndDiffPlex - a .NET Diff Generator

    Read the article

< Previous Page | 111 112 113 114 115 116 117 118 119 120 121 122  | Next Page >