Search Results

Search found 47210 results on 1889 pages for 'text input'.

Page 116/1889 | < Previous Page | 112 113 114 115 116 117 118 119 120 121 122 123  | Next Page >

  • Replace special text with sed?

    - by user143822
    I'm using CMD on Windows Xp to replace special text with Sed. I'm using this command for replace special characters like $ or * : sed -i "s/\*/123/g;" 1.txt But how command must i use to replace this strings with ciao! in my text files? Is possible? \\ \\\ "" sed.exe -i "s/{\*)(//123/ sed -i "s/\\/123/g;" 1.txt the previous command does not work because i have \, " and other special strings that sed use to make regex.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Trobleshooting input device detection in Windows Xp Pro Sp3

    - by iceman
    My laptop (Acer travelmate 4152NlCi)doesn't respond to the keyboard and mouse anymore while booting in Windows Xp Pro Sp3. i can't type the password and login. I have Opensuse 11.0 on it as well and it works. So I can boot into Linux and not Windows, not even in safe mode. What would be the troubleshooting steps?

    Read the article

  • Create text file named after a cell containing other cell data

    - by user143041
    I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

    Read the article

  • 5.1 Sound Card with digital input for Ubuntu

    - by phsr
    I have a Intel Atom PC that I'm shoe-horning into a role as a media server. I have a 5.1 surround sound speaker set that works pretty well. I want to be able to take the optical out from my cable box or PS3 and route it into the PC so that I can play it surround sound. Is there a low price video card that has 5.1 and optical in that works with Ubuntu?

    Read the article

  • ViewSonic LCD Monitor Touch-input

    - by Synetech inc.
    I bought a used 15" ViewSonic LCD monitor (VP150m) and noticed that it has a 3.5mm connector on the back labeled “touch i/o”. I’m trying to figure out how to use the touch function but am having trouble finding anything useful. First, I cannot find any information on what kind of cable it uses (TS, TRS, TRRS, etc.), or how to connect it to the computer. Second, I cannot find touch drivers for it—though I can find a page that mentions how easy it is to install them. Does anyone have any information on using the touchscreen function of the VP150m? Thanks a lot.

    Read the article

  • Linux `alternatives --config` without user input

    - by Steve
    I am writing a RHEL kickstart script, and in my %post, I need to install a JRE. Basically, the current setup involves me needing to manually go in after first boot and set the newly installed JRE as the default using the alternatives --config command. Is there a way for me to pass arguments to alternatives so I don't have to manually pick the correct JRE?

    Read the article

  • How to put text in same row but different column if a certain text is present in the same row?

    - by melai
    How can I put text in the same row but different column if a certain text is present in the same row? Issue Area Correction Done Process changed bin Process skip lap converted to global Security done global migration Process changed bin How can I code this in a macro? For example: If the correction done is in the cell, the Issue should be Process automatically. If the word global is present the Issue should be Security. I have 500 rows and I want to have the code until row 500.

    Read the article

  • Why does Chrome show overlapping text?

    - by dog44wgm
    In Chrome, news articles at: http://www.theprovince.com with a leading photo and caption show the caption text overlapped with the body text. I have an image but as a new user here I'm not allowed to upload it. It happens at that site almost always, here's an example from today: http://www.theprovince.com/sports/Canucks+Blackhawks+collision+Titanic+proportions/5721421/story.html It rarely happens elsewhere. The same link works fine in Internet Explorer so I'm guessing it's a Chrome issue. It's been like this for many months, I read the site almost everyday. I click on "Print this Article" to get a proper look at it, but it's annoying, hope someone has the answer. Thanks in advance.

    Read the article

  • Iptables state tracking

    - by complexgeek
    Hi there. I've just taken over administration of a fairly complex firewall ruleset for a firewall box running Fedora Core 12, and there's one thing about it that is puzzling me. When I run nmap on the gateway from outside the network, I see all the expected services, but also sunrpc on port 111. The INPUT chain has DEFAULT DROP set, and there is no rule allowing port 111. As best I can tell (watching the packet counters before/during/after the scan) it's being allowed by the rule: "-m state --state RELATED,ESTABLISHED -j ACCEPT" but I don't understand why a brand new TCP connection would be considered RELATED or ESTABLISHED. Any suggestions would be greatly appreciated. EDIT: Conntrack modules: nf_conntrack_netlink 14925 0 nfnetlink 3479 1 nf_conntrack_netlink nf_conntrack_irc 5206 1 nf_nat_irc nf_conntrack_proto_udplite 3138 0 nf_conntrack_h323 62110 1 nf_nat_h323 nf_conntrack_proto_dccp 6878 0 nf_conntrack_sip 16921 1 nf_nat_sip nf_conntrack_proto_sctp 11131 0 nf_conntrack_pptp 10673 1 nf_nat_pptp nf_conntrack_sane 5458 0 nf_conntrack_proto_gre 6574 1 nf_conntrack_pptp nf_conntrack_amanda 2796 1 nf_nat_amanda nf_conntrack_ftp 11741 1 nf_nat_ftp nf_conntrack_tftp 4665 1 nf_nat_tftp nf_conntrack_netbios_ns 1534 0 nf_conntrack_ipv6 18504 2 ipv6 279399 40 ip6t_REJECT,nf_conntrack_ipv6 INPUT chain on the filter table: -A INPUT -s 192.168.200.10/32 -p tcp -m tcp --dport 22 -m state --state NEW,ESTABLISHED -j ACCEPT -A INPUT -s 127.0.0.0/8 -i lo -j ACCEPT -A INPUT -p udp -m udp --sport 67:68 --dport 67:68 -j ACCEPT -A INPUT -d 192.168.200.5/32 -i eth0 -j ACCEPT -A INPUT -d 192.168.1.2/32 -i eth0 -j ACCEPT -A INPUT -d {public_ip}/32 -i ppp0 -p tcp -m multiport --dports 22,80,443 -j ACCEPT -A INPUT -d {public_ip}/32 -i ppp0 -p tcp -m multiport --sports 22,25,80,443 -j ACCEPT -A INPUT -d {public_ip}/32 -i ppp0 -p udp -m udp --dport 1194 -j ACCEPT -A INPUT -d {public_ip}/32 -i ppp0 -p udp -m udp --sport 1194 -j ACCEPT -A INPUT -d {public_ip}/32 -i ppp0 -p udp -m multiport --sports 53,123 -j ACCEPT -A INPUT -d {public_ip}/32 -i ppp0 -p icmp -m icmp --icmp-type 8 -j ACCEPT -A INPUT -i eth0 -m state --state NEW -j ACCEPT -A INPUT -d {public_ip}/32 -m state --state NEW -j ACCEPT -A INPUT -m state --state RELATED,ESTABLISHED -j ACCEPT eth0 is connected to the internal network, eth3 is connected to an ADSL modem in bridge mode, ppp0 is the WAN connection tunneled over eth3.

    Read the article

  • Format text to 5 chars from a number

    - by Wheelersg
    In Access, I used a query to sum some numbers and appended the answer to another table(table2). Now I need to export the number as a text with 5 positions but can't seem to get it to hard code all 5 positions. I have it formatted as text, field length 5, custom foramt "00000" (also tried @@@@@). Example: 3 + 3 + 1 = 7. THen append the 7 to table2. It always shows as 7. I need it to shows as 00007.

    Read the article

  • Input string was not in a correct format.

    - by Jon
    I have this error which doesn't happen on my local machine but it does when the code is built by our build sever and deployed to the target server. I can't work out what the problem is, after having spent many hours on this issue. Here is an error trace: [FormatException: Input string was not in a correct format.] System.Number.StringToNumber(String str, NumberStyles options, NumberBuffer& number, NumberFormatInfo info, Boolean parseDecimal) +7469351 System.Number.ParseInt32(String s, NumberStyles style, NumberFormatInfo info) +119 System.Byte.Parse(String s, NumberStyles style, NumberFormatInfo info) +35 System.String.System.IConvertible.ToByte(IFormatProvider provider) +46 System.Convert.ChangeType(Object value, TypeCode typeCode, IFormatProvider provider) +199 System.Web.UI.WebControls.Parameter.GetValue(Object value, String defaultValue, TypeCode type, Boolean convertEmptyStringToNull, Boolean ignoreNullableTypeChanges) +127 System.Web.UI.WebControls.Parameter.GetValue(Object value, Boolean ignoreNullableTypeChanges) +66 System.Web.UI.WebControls.ParameterCollection.GetValues(HttpContext context, Control control) +285 System.Web.UI.WebControls.SqlDataSourceView.InitializeParameters(DbCommand command, ParameterCollection parameters, IDictionary exclusionList) +251 System.Web.UI.WebControls.SqlDataSourceView.ExecuteSelect(DataSourceSelectArguments arguments) +476 System.Web.UI.WebControls.SqlDataSource.Select(DataSourceSelectArguments arguments) +19 Customer_NewTenancyList.BindReport(GridSortEventArgs e) +442 Customer_NewTenancyList.Page_Load(Object sender, EventArgs e) +345 System.Web.UI.Control.OnLoad(EventArgs e) +73 baseRslpage.OnLoad(EventArgs e) +16 System.Web.UI.Control.LoadRecursive() +52 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +2170 Here is my own trace: Begin PreInit aspx.page End PreInit 3.12888928620816E-05 0.000031 aspx.page Begin Init 7.43111205474439E-05 0.000043 aspx.page End Init 0.00122138428208054 0.001147 aspx.page Begin InitComplete 0.00125379063540199 0.000032 aspx.page End InitComplete 0.00127781603527823 0.000024 aspx.page Begin PreLoad 0.00131022238859967 0.000032 aspx.page End PreLoad 0.00133424778847591 0.000024 aspx.page Begin Load 0.00135575890231859 0.000022 Page_Load 0.00145996209015392 0.000104 BindReport 0.0014856636807192 0.000026 Parameters add start: 30/03/2010 30/04/2010 0.0015569017850034 0.000071 Parameters add ended 0.00160048274291844 0.000044 Trace 1 0.00162450814279468 0.000024 Unhandled Execution Error Input string was not in a correct format. at System.Number.StringToNumber(String str, NumberStyles options, NumberBuffer& number, NumberFormatInfo info, Boolean parseDecimal) at System.Number.ParseInt32(String s, NumberStyles style, NumberFormatInfo info) at System.Byte.Parse(String s, NumberStyles style, NumberFormatInfo info) at System.String.System.IConvertible.ToByte(IFormatProvider provider) at System.Convert.ChangeType(Object value, TypeCode typeCode, IFormatProvider provider) at System.Web.UI.WebControls.Parameter.GetValue(Object value, String defaultValue, TypeCode type, Boolean convertEmptyStringToNull, Boolean ignoreNullableTypeChanges) at System.Web.UI.WebControls.Parameter.GetValue(Object value, Boolean ignoreNullableTypeChanges) at System.Web.UI.WebControls.ParameterCollection.GetValues(HttpContext context, Control control) at System.Web.UI.WebControls.SqlDataSourceView.InitializeParameters(DbCommand command, ParameterCollection parameters, IDictionary exclusionList) at System.Web.UI.WebControls.SqlDataSourceView.ExecuteSelect(DataSourceSelectArguments arguments) at System.Web.UI.WebControls.SqlDataSource.Select(DataSourceSelectArguments arguments) at Customer_NewTenancyList.BindReport(GridSortEventArgs e) at Customer_NewTenancyList.Page_Load(Object sender, EventArgs e) at System.Web.UI.Control.OnLoad(EventArgs e) at baseRslpage.OnLoad(EventArgs e) at System.Web.UI.Control.LoadRecursive() at System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) And here is my code: Trace.Warn("BindReport") Dim sds As New SqlDataSource sds.SelectCommand = "C_MYSTORED_PROC" sds.ConnectionString = ConfigurationManager.ConnectionStrings("connstring").ConnectionString sds.SelectCommandType = SqlDataSourceCommandType.StoredProcedure Trace.Warn(String.Format("Parameters add start: {0} {1}", dpFrom.Text, dpTo.Text)) sds.SelectParameters.Add(New Parameter("FROMDATE", DbType.DateTime, dpFrom.Text)) sds.SelectParameters.Add(New Parameter("TODATE", DbType.DateTime, dpTo.Text)) Trace.Warn("Parameters add ended") Dim dv As DataView Dim dt As DataTable Trace.Warn("Trace 1") dv = sds.Select(New DataSourceSelectArguments()) Trace.Warn("Trace 2") If e IsNot Nothing Then dv.Sort = String.Format("{0} {1}", e.SortField, e.SortDirection) Trace.Warn("Trace 3") Else gvReport.CurrentSortColumnIndex = 0 gvReport.Columns(0).SortDirection = "DESC" Trace.Warn("Trace 4") End If Trace.Warn("Trace 5") dt = dv.ToTable() Cache("NewTenancyList") = dt Trace.Warn("Trace 6") Trace.Warn("About to databind") gvReport.DataSource = dt gvReport.DataBind() Trace.Warn("Databinded") What I don't understand and this is really weird, why does it work on my local machine but not on the live server? If i build the code on my local machine then copy over the complete \bin directory it works. If I pull the code from source safe, build then copy, I get this error. It seems to choke after the line "dv = sds.Select(New DataSourceSelectArguments())" in the code.

    Read the article

  • ASP.NET Podcast Show #148 - ASP.NET WebForms to build a Mobile Web Application

    - by Wallym
    Check the podcast site for the original url. This is the video and source code for an ASP.NET WebForms app that I wrote that is optimized for the iPhone and mobile environments.  Subscribe to everything. Subscribe to WMV. Subscribe to M4V for iPhone/iPad. Subscribe to MP3. Download WMV. Download M4V for iPhone/iPad. Download MP3. Link to iWebKit. Source Code: <%@ Page Title="MapSplore" Language="C#" MasterPageFile="iPhoneMaster.master" AutoEventWireup="true" CodeFile="Default.aspx.cs" Inherits="AT_iPhone_Default" %> <asp:Content ID="Content1" ContentPlaceHolderID="head" Runat="Server"></asp:Content><asp:Content ID="Content2" ContentPlaceHolderID="Content" Runat="Server" ClientIDMode="Static">    <asp:ScriptManager ID="sm" runat="server"         EnablePartialRendering="true" EnableHistory="false" EnableCdn="true" />    <script type="text/javascript" src="http://maps.google.com/maps/api/js?sensor=true"></script>    <script  language="javascript"  type="text/javascript">    <!--    Sys.WebForms.PageRequestManager.getInstance().add_endRequest(endRequestHandle);    function endRequestHandle(sender, Args) {        setupMapDiv();        setupPlaceIveBeen();    }    function setupPlaceIveBeen() {        var mapPlaceIveBeen = document.getElementById('divPlaceIveBeen');        if (mapPlaceIveBeen != null) {            var PlaceLat = document.getElementById('<%=hdPlaceIveBeenLatitude.ClientID %>').value;            var PlaceLon = document.getElementById('<%=hdPlaceIveBeenLongitude.ClientID %>').value;            var PlaceTitle = document.getElementById('<%=lblPlaceIveBeenName.ClientID %>').innerHTML;            var latlng = new google.maps.LatLng(PlaceLat, PlaceLon);            var myOptions = {                zoom: 14,                center: latlng,                mapTypeId: google.maps.MapTypeId.ROADMAP            };            var map = new google.maps.Map(mapPlaceIveBeen, myOptions);            var marker = new google.maps.Marker({                position: new google.maps.LatLng(PlaceLat, PlaceLon),                map: map,                title: PlaceTitle,                clickable: false            });        }    }    function setupMapDiv() {        var mapdiv = document.getElementById('divImHere');        if (mapdiv != null) {            var PlaceLat = document.getElementById('<%=hdPlaceLat.ClientID %>').value;            var PlaceLon = document.getElementById('<%=hdPlaceLon.ClientID %>').value;            var PlaceTitle = document.getElementById('<%=hdPlaceTitle.ClientID %>').value;            var latlng = new google.maps.LatLng(PlaceLat, PlaceLon);            var myOptions = {                zoom: 14,                center: latlng,                mapTypeId: google.maps.MapTypeId.ROADMAP            };            var map = new google.maps.Map(mapdiv, myOptions);            var marker = new google.maps.Marker({                position: new google.maps.LatLng(PlaceLat, PlaceLon),                map: map,                title: PlaceTitle,                clickable: false            });        }     }    -->    </script>    <asp:HiddenField ID="Latitude" runat="server" />    <asp:HiddenField ID="Longitude" runat="server" />    <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1/jquery.min.js%22%3E%3C/script>    <script language="javascript" type="text/javascript">        $(document).ready(function () {            GetLocation();            setupMapDiv();            setupPlaceIveBeen();        });        function GetLocation() {            if (navigator.geolocation != null) {                navigator.geolocation.getCurrentPosition(getData);            }            else {                var mess = document.getElementById('<%=Message.ClientID %>');                mess.innerHTML = "Sorry, your browser does not support geolocation. " +                    "Try the latest version of Safari on the iPhone, Android browser, or the latest version of FireFox.";            }        }        function UpdateLocation_Click() {            GetLocation();        }        function getData(position) {            var latitude = position.coords.latitude;            var longitude = position.coords.longitude;            var hdLat = document.getElementById('<%=Latitude.ClientID %>');            var hdLon = document.getElementById('<%=Longitude.ClientID %>');            hdLat.value = latitude;            hdLon.value = longitude;        }    </script>    <asp:Label ID="Message" runat="server" />    <asp:UpdatePanel ID="upl" runat="server">        <ContentTemplate>    <asp:Panel ID="pnlStart" runat="server" Visible="true">    <div id="topbar">        <div id="title">MapSplore</div>    </div>    <div id="content">        <ul class="pageitem">            <li class="menu">                <asp:LinkButton ID="lbLocalDeals" runat="server" onclick="lbLocalDeals_Click">                <asp:Image ID="imLocalDeals" runat="server" ImageUrl="~/Images/ArtFavor_Money_Bag_Icon.png" Height="30" />                <span class="name">Local Deals.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbLocalPlaces" runat="server" onclick="lbLocalPlaces_Click">                <asp:Image ID="imLocalPlaces" runat="server" ImageUrl="~/Images/Andy_Houses_on_the_horizon_-_Starburst_remix.png" Height="30" />                <span class="name">Local Places.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbWhereIveBeen" runat="server" onclick="lbWhereIveBeen_Click">                <asp:Image ID="imImHere" runat="server" ImageUrl="~/Images/ryanlerch_flagpole.png" Height="30" />                <span class="name">I've been here.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbMyStats" runat="server">                <asp:Image ID="imMyStats" runat="server" ImageUrl="~/Images/Anonymous_Spreadsheet.png" Height="30" />                <span class="name">My Stats.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbAddAPlace" runat="server" onclick="lbAddAPlace_Click">                <asp:Image ID="imAddAPlace" runat="server" ImageUrl="~/Images/jean_victor_balin_add.png" Height="30" />                <span class="name">Add a Place.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="button">                <input type="button" value="Update Your Current Location" onclick="UpdateLocation_Click()">                </li>        </ul>    </div>    </asp:Panel>    <div>    <asp:Panel ID="pnlCoupons" runat="server" Visible="false">        <div id="topbar">        <div id="title">MapSplore</div>        <div id="leftbutton">            <asp:LinkButton runat="server" Text="Return"                 ID="ReturnFromDeals" OnClick="ReturnFromDeals_Click" /></div></div>    <div class="content">    <asp:ListView ID="lvCoupons" runat="server">        <LayoutTemplate>            <ul class="pageitem" runat="server">                <asp:PlaceHolder ID="itemPlaceholder" runat="server" />            </ul>        </LayoutTemplate>        <ItemTemplate>            <li class="menu">                <asp:LinkButton ID="lbBusiness" runat="server" Text='<%#Eval("Place.Name") %>' OnClick="lbBusiness_Click">                    <span class="comment">                    <asp:Label ID="lblAddress" runat="server" Text='<%#Eval("Place.Address1") %>' />                    <asp:Label ID="lblDis" runat="server" Text='<%# Convert.ToString(Convert.ToInt32(Eval("Place.Distance"))) + " meters" %>' CssClass="smallText" />                    <asp:HiddenField ID="hdPlaceId" runat="server" Value='<%#Eval("PlaceId") %>' />                    <asp:HiddenField ID="hdGeoPromotionId" runat="server" Value='<%#Eval("GeoPromotionId") %>' />                    </span>                    <span class="arrow"></span>                </asp:LinkButton></li></ItemTemplate></asp:ListView><asp:GridView ID="gvCoupons" runat="server" AutoGenerateColumns="false">            <HeaderStyle BackColor="Silver" />            <AlternatingRowStyle BackColor="Wheat" />            <Columns>                <asp:TemplateField AccessibleHeaderText="Business" HeaderText="Business">                    <ItemTemplate>                        <asp:Image ID="imPlaceType" runat="server" Text='<%#Eval("Type") %>' ImageUrl='<%#Eval("Image") %>' />                        <asp:LinkButton ID="lbBusiness" runat="server" Text='<%#Eval("Name") %>' OnClick="lbBusiness_Click" />                        <asp:LinkButton ID="lblAddress" runat="server" Text='<%#Eval("Address1") %>' CssClass="smallText" />                        <asp:Label ID="lblDis" runat="server" Text='<%# Convert.ToString(Convert.ToInt32(Eval("Distance"))) + " meters" %>' CssClass="smallText" />                        <asp:HiddenField ID="hdPlaceId" runat="server" Value='<%#Eval("PlaceId") %>' />                        <asp:HiddenField ID="hdGeoPromotionId" runat="server" Value='<%#Eval("GeoPromotionId") %>' />                        <asp:Label ID="lblInfo" runat="server" Visible="false" />                    </ItemTemplate>                </asp:TemplateField>            </Columns>        </asp:GridView>    </div>    </asp:Panel>    <asp:Panel ID="pnlPlaces" runat="server" Visible="false">    <div id="topbar">        <div id="title">            MapSplore</div><div id="leftbutton">            <asp:LinkButton runat="server" Text="Return"                 ID="ReturnFromPlaces" OnClick="ReturnFromPlaces_Click" /></div></div>        <div id="content">        <asp:ListView ID="lvPlaces" runat="server">            <LayoutTemplate>                <ul id="ulPlaces" class="pageitem" runat="server">                    <asp:PlaceHolder ID="itemPlaceholder" runat="server" />                    <li class="menu">                        <asp:LinkButton ID="lbNotListed" runat="server" CssClass="name"                            OnClick="lbNotListed_Click">                            Place not listed                            <span class="arrow"></span>                            </asp:LinkButton>                    </li>                </ul>            </LayoutTemplate>            <ItemTemplate>            <li class="menu">                <asp:LinkButton ID="lbImHere" runat="server" CssClass="name"                     OnClick="lbImHere_Click">                <%#DisplayName(Eval("Name")) %>&nbsp;                <%# Convert.ToString(Convert.ToInt32(Eval("Distance"))) + " meters" %>                <asp:HiddenField ID="hdPlaceId" runat="server" Value='<%#Eval("PlaceId") %>' />                <span class="arrow"></span>                </asp:LinkButton></li></ItemTemplate></asp:ListView>    </div>    </asp:Panel>    <asp:Panel ID="pnlImHereNow" runat="server" Visible="false">        <div id="topbar">        <div id="title">            MapSplore</div><div id="leftbutton">            <asp:LinkButton runat="server" Text="Places"                 ID="lbImHereNowReturn" OnClick="lbImHereNowReturn_Click" /></div></div>            <div id="rightbutton">            <asp:LinkButton runat="server" Text="Beginning"                ID="lbBackToBeginning" OnClick="lbBackToBeginning_Click" />            </div>        <div id="content">        <ul class="pageitem">        <asp:HiddenField ID="hdPlaceId" runat="server" />        <asp:HiddenField ID="hdPlaceLat" runat="server" />        <asp:HiddenField ID="hdPlaceLon" runat="server" />        <asp:HiddenField ID="hdPlaceTitle" runat="server" />        <asp:Button ID="btnImHereNow" runat="server"             Text="I'm here" OnClick="btnImHereNow_Click" />             <asp:Label ID="lblPlaceTitle" runat="server" /><br />        <asp:TextBox ID="txtWhatsHappening" runat="server" TextMode="MultiLine" Rows="2" style="width:300px" /><br />        <div id="divImHere" style="width:300px; height:300px"></div>        </div>        </ul>    </asp:Panel>    <asp:Panel runat="server" ID="pnlIveBeenHere" Visible="false">        <div id="topbar">        <div id="title">            Where I've been</div><div id="leftbutton">            <asp:LinkButton ID="lbIveBeenHereBack" runat="server" Text="Back" OnClick="lbIveBeenHereBack_Click" /></div></div>        <div id="content">        <asp:ListView ID="lvWhereIveBeen" runat="server">            <LayoutTemplate>                <ul id="ulWhereIveBeen" class="pageitem" runat="server">                    <asp:PlaceHolder ID="itemPlaceholder" runat="server" />                </ul>            </LayoutTemplate>            <ItemTemplate>            <li class="menu" runat="server">                <asp:LinkButton ID="lbPlaceIveBeen" runat="server" OnClick="lbPlaceIveBeen_Click" CssClass="name">                    <asp:Label ID="lblPlace" runat="server" Text='<%#Eval("PlaceName") %>' /> at                    <asp:Label ID="lblTime" runat="server" Text='<%#Eval("ATTime") %>' CssClass="content" />                    <asp:HiddenField ID="hdATID" runat="server" Value='<%#Eval("ATID") %>' />                    <span class="arrow"></span>                </asp:LinkButton>            </li>            </ItemTemplate>        </asp:ListView>        </div>        </asp:Panel>    <asp:Panel runat="server" ID="pnlPlaceIveBeen" Visible="false">        <div id="topbar">        <div id="title">            I've been here        </div>        <div id="leftbutton">            <asp:LinkButton ID="lbPlaceIveBeenBack" runat="server" Text="Back" OnClick="lbPlaceIveBeenBack_Click" />        </div>        <div id="rightbutton">            <asp:LinkButton ID="lbPlaceIveBeenBeginning" runat="server" Text="Beginning" OnClick="lbPlaceIveBeenBeginning_Click" />        </div>        </div>        <div id="content">            <ul class="pageitem">            <li>            <asp:HiddenField ID="hdPlaceIveBeenPlaceId" runat="server" />            <asp:HiddenField ID="hdPlaceIveBeenLatitude" runat="server" />            <asp:HiddenField ID="hdPlaceIveBeenLongitude" runat="server" />            <asp:Label ID="lblPlaceIveBeenName" runat="server" /><br />            <asp:Label ID="lblPlaceIveBeenAddress" runat="server" /><br />            <asp:Label ID="lblPlaceIveBeenCity" runat="server" />,             <asp:Label ID="lblPlaceIveBeenState" runat="server" />            <asp:Label ID="lblPlaceIveBeenZipCode" runat="server" /><br />            <asp:Label ID="lblPlaceIveBeenCountry" runat="server" /><br />            <div id="divPlaceIveBeen" style="width:300px; height:300px"></div>            </li>            </ul>        </div>                </asp:Panel>         <asp:Panel ID="pnlAddPlace" runat="server" Visible="false">                <div id="topbar"><div id="title">MapSplore</div><div id="leftbutton"><asp:LinkButton ID="lbAddPlaceReturn" runat="server" Text="Back" OnClick="lbAddPlaceReturn_Click" /></div><div id="rightnav"></div></div><div id="content">    <ul class="pageitem">        <li id="liPlaceAddMessage" runat="server" visible="false">        <asp:Label ID="PlaceAddMessage" runat="server" />        </li>        <li class="bigfield">        <asp:TextBox ID="txtPlaceName" runat="server" placeholder="Name of Establishment" />        </li>        <li class="bigfield">        <asp:TextBox ID="txtAddress1" runat="server" placeholder="Address 1" />        </li>        <li class="bigfield">        <asp:TextBox ID="txtCity" runat="server" placeholder="City" />        </li>        <li class="select">        <asp:DropDownList ID="ddlProvince" runat="server" placeholder="Select State" />          <span class="arrow"></span>              </li>        <li class="bigfield">        <asp:TextBox ID="txtZipCode" runat="server" placeholder="Zip Code" />        </li>        <li class="select">        <asp:DropDownList ID="ddlCountry" runat="server"             onselectedindexchanged="ddlCountry_SelectedIndexChanged" />        <span class="arrow"></span>        </li>        <li class="bigfield">        <asp:TextBox ID="txtPhoneNumber" runat="server" placeholder="Phone Number" />        </li>        <li class="checkbox">            <span class="name">You Here Now:</span> <asp:CheckBox ID="cbYouHereNow" runat="server" Checked="true" />        </li>        <li class="button">        <asp:Button ID="btnAdd" runat="server" Text="Add Place"             onclick="btnAdd_Click" />        </li>    </ul></div>        </asp:Panel>        <asp:Panel ID="pnlImHere" runat="server" Visible="false">            <asp:TextBox ID="txtImHere" runat="server"                 TextMode="MultiLine" Rows="3" Columns="40" /><br />            <asp:DropDownList ID="ddlPlace" runat="server" /><br />            <asp:Button ID="btnHere" runat="server" Text="Tell Everyone I'm Here"                 onclick="btnHere_Click" /><br />        </asp:Panel>     </div>    </ContentTemplate>    </asp:UpdatePanel> </asp:Content> Code Behind .cs file: using System;using System.Collections.Generic;using System.Linq;using System.Web;using System.Web.Security;using System.Web.UI;using System.Web.UI.HtmlControls;using System.Web.UI.WebControls;using LocationDataModel; public partial class AT_iPhone_Default : ViewStatePage{    private iPhoneDevice ipd;     protected void Page_Load(object sender, EventArgs e)    {        LocationDataEntities lde = new LocationDataEntities();        if (!Page.IsPostBack)        {            var Countries = from c in lde.Countries select c;            foreach (Country co in Countries)            {                ddlCountry.Items.Add(new ListItem(co.Name, co.CountryId.ToString()));            }            ddlCountry_SelectedIndexChanged(ddlCountry, null);            if (AppleIPhone.IsIPad())                ipd = iPhoneDevice.iPad;            if (AppleIPhone.IsIPhone())                ipd = iPhoneDevice.iPhone;            if (AppleIPhone.IsIPodTouch())                ipd = iPhoneDevice.iPodTouch;        }    }    protected void btnPlaces_Click(object sender, EventArgs e)    {    }    protected void btnAdd_Click(object sender, EventArgs e)    {        bool blImHere = cbYouHereNow.Checked;        string Place = txtPlaceName.Text,            Address1 = txtAddress1.Text,            City = txtCity.Text,            ZipCode = txtZipCode.Text,            PhoneNumber = txtPhoneNumber.Text,            ProvinceId = ddlProvince.SelectedItem.Value,            CountryId = ddlCountry.SelectedItem.Value;        int iProvinceId, iCountryId;        double dLatitude, dLongitude;        DataAccess da = new DataAccess();        if ((!String.IsNullOrEmpty(ProvinceId)) &&            (!String.IsNullOrEmpty(CountryId)))        {            iProvinceId = Convert.ToInt32(ProvinceId);            iCountryId = Convert.ToInt32(CountryId);            if (blImHere)            {                dLatitude = Convert.ToDouble(Latitude.Value);                dLongitude = Convert.ToDouble(Longitude.Value);                da.StorePlace(Place, Address1, String.Empty, City,                    iProvinceId, ZipCode, iCountryId, PhoneNumber,                    dLatitude, dLongitude);            }            else            {                da.StorePlace(Place, Address1, String.Empty, City,                    iProvinceId, ZipCode, iCountryId, PhoneNumber);            }            liPlaceAddMessage.Visible = true;            PlaceAddMessage.Text = "Awesome, your place has been added. Add Another!";            txtPlaceName.Text = String.Empty;            txtAddress1.Text = String.Empty;            txtCity.Text = String.Empty;            ddlProvince.SelectedIndex = -1;            txtZipCode.Text = String.Empty;            txtPhoneNumber.Text = String.Empty;        }        else        {            liPlaceAddMessage.Visible = true;            PlaceAddMessage.Text = "Please select a State and a Country.";        }    }    protected void ddlCountry_SelectedIndexChanged(object sender, EventArgs e)    {        string CountryId = ddlCountry.SelectedItem.Value;        if (!String.IsNullOrEmpty(CountryId))        {            int iCountryId = Convert.ToInt32(CountryId);            LocationDataModel.LocationDataEntities lde = new LocationDataModel.LocationDataEntities();            var prov = from p in lde.Provinces where p.CountryId == iCountryId                        orderby p.ProvinceName select p;                        ddlProvince.Items.Add(String.Empty);            foreach (Province pr in prov)            {                ddlProvince.Items.Add(new ListItem(pr.ProvinceName, pr.ProvinceId.ToString()));            }        }        else        {            ddlProvince.Items.Clear();        }    }    protected void btnImHere_Click(object sender, EventArgs e)    {        int i = 0;        DataAccess da = new DataAccess();        double Lat = Convert.ToDouble(Latitude.Value),            Lon = Convert.ToDouble(Longitude.Value);        List<Place> lp = da.NearByLocations(Lat, Lon);        foreach (Place p in lp)        {            ListItem li = new ListItem(p.Name, p.PlaceId.ToString());            if (i == 0)            {                li.Selected = true;            }            ddlPlace.Items.Add(li);            i++;        }        pnlAddPlace.Visible = false;        pnlImHere.Visible = true;    }    protected void lbImHere_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        ListViewItem lvi = (ListViewItem)(((LinkButton)sender).Parent);        HiddenField hd = (HiddenField)lvi.FindControl("hdPlaceId");        long PlaceId = Convert.ToInt64(hd.Value);        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        Place pl = da.GetPlace(PlaceId);        pnlImHereNow.Visible = true;        pnlPlaces.Visible = false;        hdPlaceId.Value = PlaceId.ToString();        hdPlaceLat.Value = pl.Latitude.ToString();        hdPlaceLon.Value = pl.Longitude.ToString();        hdPlaceTitle.Value = pl.Name;        lblPlaceTitle.Text = pl.Name;    }    protected void btnHere_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        string WhatsH = txtImHere.Text;        long PlaceId = Convert.ToInt64(ddlPlace.SelectedValue);        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        da.StoreUserAT(UserName, PlaceId, WhatsH,            dLatitude, dLongitude);    }    protected void btnLocalCoupons_Click(object sender, EventArgs e)    {        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();     }    protected void lbBusiness_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        GridViewRow gvr = (GridViewRow)(((LinkButton)sender).Parent.Parent);        HiddenField hd = (HiddenField)gvr.FindControl("hdPlaceId");        string sPlaceId = hd.Value;        Int64 PlaceId;        if (!String.IsNullOrEmpty(sPlaceId))        {            PlaceId = Convert.ToInt64(sPlaceId);        }    }    protected void lbLocalDeals_Click(object sender, EventArgs e)    {        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        pnlCoupons.Visible = true;        pnlStart.Visible = false;        List<GeoPromotion> lgp = da.NearByDeals(dLatitude, dLongitude);        lvCoupons.DataSource = lgp;        lvCoupons.DataBind();    }    protected void lbLocalPlaces_Click(object sender, EventArgs e)    {        DataAccess da = new DataAccess();        double Lat = Convert.ToDouble(Latitude.Value);        double Lon = Convert.ToDouble(Longitude.Value);        List<LocationDataModel.Place> places = da.NearByLocations(Lat, Lon);        lvPlaces.DataSource = places;        lvPlaces.SelectedIndex = -1;        lvPlaces.DataBind();        pnlPlaces.Visible = true;        pnlStart.Visible = false;    }    protected void ReturnFromPlaces_Click(object sender, EventArgs e)    {        pnlPlaces.Visible = false;        pnlStart.Visible = true;    }    protected void ReturnFromDeals_Click(object sender, EventArgs e)    {        pnlCoupons.Visible = false;        pnlStart.Visible = true;    }    protected void btnImHereNow_Click(object sender, EventArgs e)    {        long PlaceId = Convert.ToInt32(hdPlaceId.Value);        string UserName = Membership.GetUser().UserName;        string WhatsHappening = txtWhatsHappening.Text;        double UserLat = Convert.ToDouble(Latitude.Value);        double UserLon = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        da.StoreUserAT(UserName, PlaceId, WhatsHappening,             UserLat, UserLon);    }    protected void lbImHereNowReturn_Click(object sender, EventArgs e)    {        pnlImHereNow.Visible = false;        pnlPlaces.Visible = true;    }    protected void lbBackToBeginning_Click(object sender, EventArgs e)    {        pnlStart.Visible = true;        pnlImHereNow.Visible = false;    }    protected void lbWhereIveBeen_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        pnlStart.Visible = false;        pnlIveBeenHere.Visible = true;        DataAccess da = new DataAccess();        lvWhereIveBeen.DataSource = da.UserATs(UserName, 0, 15);        lvWhereIveBeen.DataBind();    }    protected void lbIveBeenHereBack_Click(object sender, EventArgs e)    {        pnlIveBeenHere.Visible = false;        pnlStart.Visible = true;    }     protected void lbPlaceIveBeen_Click(object sender, EventArgs e)    {        LinkButton lb = (LinkButton)sender;        ListViewItem lvi = (ListViewItem)lb.Parent.Parent;        HiddenField hdATID = (HiddenField)lvi.FindControl("hdATID");        Int64 ATID = Convert.ToInt64(hdATID.Value);        DataAccess da = new DataAccess();        pnlIveBeenHere.Visible = false;        pnlPlaceIveBeen.Visible = true;        var plac = da.GetPlaceViaATID(ATID);        hdPlaceIveBeenPlaceId.Value = plac.PlaceId.ToString();        hdPlaceIveBeenLatitude.Value = plac.Latitude.ToString();        hdPlaceIveBeenLongitude.Value = plac.Longitude.ToString();        lblPlaceIveBeenName.Text = plac.Name;        lblPlaceIveBeenAddress.Text = plac.Address1;        lblPlaceIveBeenCity.Text = plac.City;        lblPlaceIveBeenState.Text = plac.Province.ProvinceName;        lblPlaceIveBeenZipCode.Text = plac.ZipCode;        lblPlaceIveBeenCountry.Text = plac.Country.Name;    }     protected void lbNotListed_Click(object sender, EventArgs e)    {        SetupAddPoint();        pnlPlaces.Visible = false;    }     protected void lbAddAPlace_Click(object sender, EventArgs e)    {        SetupAddPoint();    }     private void SetupAddPoint()    {        double lat = Convert.ToDouble(Latitude.Value);        double lon = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        var zip = da.WhereAmIAt(lat, lon);        if (zip.Count > 0)        {            var z0 = zip[0];            txtCity.Text = z0.City;            txtZipCode.Text = z0.ZipCode;            ddlProvince.ClearSelection();            if (z0.ProvinceId.HasValue == true)            {                foreach (ListItem li in ddlProvince.Items)                {                    if (li.Value == z0.ProvinceId.Value.ToString())                    {                        li.Selected = true;                        break;                    }                }            }        }        pnlAddPlace.Visible = true;        pnlStart.Visible = false;    }    protected void lbAddPlaceReturn_Click(object sender, EventArgs e)    {        pnlAddPlace.Visible = false;        pnlStart.Visible = true;        liPlaceAddMessage.Visible = false;        PlaceAddMessage.Text = String.Empty;    }    protected void lbPlaceIveBeenBack_Click(object sender, EventArgs e)    {        pnlIveBeenHere.Visible = true;        pnlPlaceIveBeen.Visible = false;            }    protected void lbPlaceIveBeenBeginning_Click(object sender, EventArgs e)    {        pnlPlaceIveBeen.Visible = false;        pnlStart.Visible = true;    }    protected string DisplayName(object val)    {        string strVal = Convert.ToString(val);         if (AppleIPhone.IsIPad())        {            ipd = iPhoneDevice.iPad;        }        if (AppleIPhone.IsIPhone())        {            ipd = iPhoneDevice.iPhone;        }        if (AppleIPhone.IsIPodTouch())        {            ipd = iPhoneDevice.iPodTouch;        }        return (iPhoneHelper.DisplayContentOnMenu(strVal, ipd));    }} iPhoneHelper.cs file: using System;using System.Collections.Generic;using System.Linq;using System.Web; public enum iPhoneDevice{    iPhone, iPodTouch, iPad}/// <summary>/// Summary description for iPhoneHelper/// </summary>/// public class iPhoneHelper{ public iPhoneHelper() {  //  // TODO: Add constructor logic here  // } // This code is stupid in retrospect. Use css to solve this problem      public static string DisplayContentOnMenu(string val, iPhoneDevice ipd)    {        string Return = val;        string Elipsis = "...";        int iPadMaxLength = 30;        int iPhoneMaxLength = 15;        if (ipd == iPhoneDevice.iPad)        {            if (Return.Length > iPadMaxLength)            {                Return = Return.Substring(0, iPadMaxLength - Elipsis.Length) + Elipsis;            }        }        else        {            if (Return.Length > iPhoneMaxLength)            {                Return = Return.Substring(0, iPhoneMaxLength - Elipsis.Length) + Elipsis;            }        }        return (Return);    }}  Source code for the ViewStatePage: using System;using System.Data;using System.Data.SqlClient;using System.Configuration;using System.Web;using System.Web.Security;using System.Web.UI;using System.Web.UI.WebControls;using System.Web.UI.WebControls.WebParts;using System.Web.UI.HtmlControls; /// <summary>/// Summary description for BasePage/// </summary>#region Base class for a page.public class ViewStatePage : System.Web.UI.Page{     PageStatePersisterToDatabase myPageStatePersister;        public ViewStatePage()        : base()    {        myPageStatePersister = new PageStatePersisterToDatabase(this);    }     protected override PageStatePersister PageStatePersister    {        get        {            return myPageStatePersister;        }    } }#endregion #region This class will override the page persistence to store page state in a database.public class PageStatePersisterToDatabase : PageStatePersister{    private string ViewStateKeyField = "__VIEWSTATE_KEY";    private string _exNoConnectionStringFound = "No Database Configuration information is in the web.config.";     public PageStatePersisterToDatabase(Page page)        : base(page)    {    }     public override void Load()    {         // Get the cache key from the web form data        System.Int64 key = Convert.ToInt64(Page.Request.Params[ViewStateKeyField]);         Pair state = this.LoadState(key);         // Abort if cache object is not of type Pair        if (state == null)            throw new ApplicationException("Missing valid " + ViewStateKeyField);         // Set view state and control state        ViewState = state.First;        ControlState = state.Second;    }     public override void Save()    {         // No processing needed if no states available        if (ViewState == null && ControlState != null)            return;         System.Int64 key;        IStateFormatter formatter = this.StateFormatter;        Pair statePair = new Pair(ViewState, ControlState);         // Serialize the statePair object to a string.        string serializedState = formatter.Serialize(statePair);         // Save the ViewState and get a unique identifier back.        key = SaveState(serializedState);         // Register hidden field to store cache key in        // Page.ClientScript does not work properly with Atlas.        //Page.ClientScript.RegisterHiddenField(ViewStateKeyField, key.ToString());        ScriptManager.RegisterHiddenField(this.Page, ViewStateKeyField, key.ToString());    }     private System.Int64 SaveState(string PageState)    {        System.Int64 i64Key = 0;        string strConn = String.Empty,            strProvider = String.Empty;         string strSql = "insert into tblPageState ( SerializedState ) values ( '" + SqlEscape(PageState) + "');select scope_identity();";        SqlConnection sqlCn;        SqlCommand sqlCm;        try        {            GetDBConnectionString(ref strConn, ref strProvider);            sqlCn = new SqlConnection(strConn);            sqlCm = new SqlCommand(strSql, sqlCn);            sqlCn.Open();            i64Key = Convert.ToInt64(sqlCm.ExecuteScalar());            if (sqlCn.State != ConnectionState.Closed)            {                sqlCn.Close();            }            sqlCn.Dispose();            sqlCm.Dispose();        }        finally        {            sqlCn = null;            sqlCm = null;        }        return i64Key;    }     private Pair LoadState(System.Int64 iKey)    {        string strConn = String.Empty,            strProvider = String.Empty,            SerializedState = String.Empty,            strMinutesInPast = GetMinutesInPastToDelete();        Pair PageState;        string strSql = "select SerializedState from tblPageState where tblPageStateID=" + iKey.ToString() + ";" +            "delete from tblPageState where DateUpdated<DateAdd(mi, " + strMinutesInPast + ", getdate());";        SqlConnection sqlCn;        SqlCommand sqlCm;        try        {            GetDBConnectionString(ref strConn, ref strProvider);            sqlCn = new SqlConnection(strConn);            sqlCm = new SqlCommand(strSql, sqlCn);             sqlCn.Open();            SerializedState = Convert.ToString(sqlCm.ExecuteScalar());            IStateFormatter formatter = this.StateFormatter;             if ((null == SerializedState) ||                (String.Empty == SerializedState))            {                throw (new ApplicationException("No ViewState records were returned."));            }             // Deserilize returns the Pair object that is serialized in            // the Save method.            PageState = (Pair)formatter.Deserialize(SerializedState);             if (sqlCn.State != ConnectionState.Closed)            {                sqlCn.Close();            }            sqlCn.Dispose();            sqlCm.Dispose();        }        finally        {            sqlCn = null;            sqlCm = null;        }        return PageState;    }     private string SqlEscape(string Val)    {        string ReturnVal = String.Empty;        if (null != Val)        {            ReturnVal = Val.Replace("'", "''");        }        return (ReturnVal);    }    private void GetDBConnectionString(ref string ConnectionStringValue, ref string ProviderNameValue)    {        if (System.Configuration.ConfigurationManager.ConnectionStrings.Count > 0)        {            ConnectionStringValue = System.Configuration.ConfigurationManager.ConnectionStrings["ApplicationServices"].ConnectionString;            ProviderNameValue = System.Configuration.ConfigurationManager.ConnectionStrings["ApplicationServices"].ProviderName;        }        else        {            throw new ConfigurationErrorsException(_exNoConnectionStringFound);        }    }    private string GetMinutesInPastToDelete()    {        string strReturn = "-60";        if (null != System.Configuration.ConfigurationManager.AppSettings["MinutesInPastToDeletePageState"])        {            strReturn = System.Configuration.ConfigurationManager.AppSettings["MinutesInPastToDeletePageState"].ToString();        }        return (strReturn);    }}#endregion AppleiPhone.cs file: using System;using System.Collections.Generic;using System.Linq;using System.Web; /// <summary>/// Summary description for AppleIPhone/// </summary>public class AppleIPhone{ public AppleIPhone() {  //  // TODO: Add constructor logic here  // }     static public bool IsIPhoneOS()    {        return (IsIPad() || IsIPhone() || IsIPodTouch());    }     static public bool IsIPhone()    {        return IsTest("iPhone");    }     static public bool IsIPodTouch()    {        return IsTest("iPod");    }     static public bool IsIPad()    {        return IsTest("iPad");    }     static private bool IsTest(string Agent)    {        bool bl = false;        string ua = HttpContext.Current.Request.UserAgent.ToLower();        try        {            bl = ua.Contains(Agent.ToLower());        }        catch { }        return (bl);        }} Master page .cs: using System;using System.Collections.Generic;using System.Linq;using System.Web;using System.Web.UI;using System.Web.UI.HtmlControls;using System.Web.UI.WebControls; public partial class MasterPages_iPhoneMaster : System.Web.UI.MasterPage{    protected void Page_Load(object sender, EventArgs e)    {            HtmlHead head = Page.Header;            HtmlMeta meta = new HtmlMeta();            if (AppleIPhone.IsIPad() == true)            {                meta.Content = "width=400,user-scalable=no";                head.Controls.Add(meta);             }            else            {                meta.Content = "width=device-width, user-scalable=no";                meta.Attributes.Add("name", "viewport");            }            meta.Attributes.Add("name", "viewport");            head.Controls.Add(meta);            HtmlLink cssLink = new HtmlLink();            HtmlGenericControl script = new HtmlGenericControl("script");            script.Attributes.Add("type", "text/javascript");            script.Attributes.Add("src", ResolveUrl("~/Scripts/iWebKit/javascript/functions.js"));            head.Controls.Add(script);            cssLink.Attributes.Add("rel", "stylesheet");            cssLink.Attributes.Add("href", ResolveUrl("~/Scripts/iWebKit/css/style.css") );            cssLink.Attributes.Add("type", "text/css");            head.Controls.Add(cssLink);            HtmlGenericControl jsLink = new HtmlGenericControl("script");            //jsLink.Attributes.Add("type", "text/javascript");            //jsLink.Attributes.Add("src", ResolveUrl("~/Scripts/jquery-1.4.1.min.js") );            //head.Controls.Add(jsLink);            HtmlLink appleIcon = new HtmlLink();            appleIcon.Attributes.Add("rel", "apple-touch-icon");            appleIcon.Attributes.Add("href", ResolveUrl("~/apple-touch-icon.png"));            HtmlMeta appleMobileWebAppStatusBarStyle = new HtmlMeta();            appleMobileWebAppStatusBarStyle.Attributes.Add("name", "apple-mobile-web-app-status-bar-style");            appleMobileWebAppStatusBarStyle.Attributes.Add("content", "black");            head.Controls.Add(appleMobileWebAppStatusBarStyle);    }     internal string FindPath(string Location)    {        string Url = Server.MapPath(Location);        return (Url);    }}

    Read the article

  • Convertion of tiff image in Python script - OCR using tesseract

    - by PYTHON TEAM
    I want to convert a tiff image file to text document. My code perfectly as I expected to convert tiff images with usual font but its not working for french script font . My tiff image file contains text. The font of text is in french script format.I here is my code import Image import subprocess import util import errors tesseract_exe_name = 'tesseract' # Name of executable to be called at command line scratch_image_name = "temp.bmp" # This file must be .bmp or other Tesseract-compatible format scratch_text_name_root = "temp" # Leave out the .txt extension cleanup_scratch_flag = True # Temporary files cleaned up after OCR operation def call_tesseract(input_filename, output_filename): """Calls external tesseract.exe on input file (restrictions on types), outputting output_filename+'txt'""" args = [tesseract_exe_name, input_filename, output_filename] proc = subprocess.Popen(args) retcode = proc.wait() if retcode!=0: errors.check_for_errors() def image_to_string(im, cleanup = cleanup_scratch_flag): """Converts im to file, applies tesseract, and fetches resulting text. If cleanup=True, delete scratch files after operation.""" try: util.image_to_scratch(im, scratch_image_name) call_tesseract(scratch_image_name, scratch_text_name_root) text = util.retrieve_text(scratch_text_name_root) finally: if cleanup: util.perform_cleanup(scratch_image_name, scratch_text_name_root) return text def image_file_to_string(filename, cleanup = cleanup_scratch_flag, graceful_errors=True): If cleanup=True, delete scratch files after operation.""" try: try: call_tesseract(filename, scratch_text_name_root) text = util.retrieve_text(scratch_text_name_root) except errors.Tesser_General_Exception: if graceful_errors: im = Image.open(filename) text = image_to_string(im, cleanup) else: raise finally: if cleanup: util.perform_cleanup(scratch_image_name, scratch_text_name_root) return text if __name__=='__main__': im = Image.open("/home/oomsys/phototest.tif") text = image_to_string(im) print text try: text = image_file_to_string('fnord.tif', graceful_errors=False) except errors.Tesser_General_Exception, value: print "fnord.tif is incompatible filetype. Try graceful_errors=True" print value text = image_file_to_string('fnord.tif', graceful_errors=True) print "fnord.tif contents:", text text = image_file_to_string('fonts_test.png', graceful_errors=True) print text

    Read the article

  • wxWidgets in Code::Blocks

    - by Vlad
    Hello all, I'm trying to compile the minimal sample from the "Cross-Platform GUI Programming with wxWidgets" book but the following compile errors: ||=== minimal, Debug ===| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0x918)||undefined reference to `__Unwind_Resume' | C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0x931)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0xa96)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0xada)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.text+0xb1e)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_frame.o):frame.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_datacmn.o):datacmn.cpp:(.eh_frame+0x11)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x63a)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x696)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x6f2)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x74a)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.text+0x7a2)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdicmn.o):gdicmn.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0x88f)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0x927)||undefined reference to `__Unwind_Resume' | C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0x9bf)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0xb8b)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.text+0xc87)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menu.o):menu.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xbc0)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xc59)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xcf5)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xda6)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.text+0xdce)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_menucmn.o):menucmn.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x1ff)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x257)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x2af)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x2fc)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.text+0x36d)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_icon.o):icon.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0x4a8)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0x73a)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0x813)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0xc06)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.text+0xd3e)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_gdiimage.o):gdiimage.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0x970)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0xa80)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0xb8c)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0xc78)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.text+0xd4f)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_event.o):event.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x2ef)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x32b)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x43d)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x586)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.text+0x601)||undefined reference to `__Unwind_Resume'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_appcmn.o):appcmn.cpp:(.eh_frame+0x12)||undefined reference to `___gxx_personality_v0'| C:\SourceCode\Libraries\wxWidgets2.8\lib\gcc_lib\libwxmsw28u_core.a(corelib_app.o):app.cpp:(.text+0x1da)||undefined reference to `__Unwind_Resume'| ||More errors follow but not being shown.| ||Edit the max errors limit in compiler options...| ||=== Build finished: 50 errors, 0 warnings ===| Here's the code sample from the book: #include "wx/wx.h" #include "mondrian.xpm" // Declare the application class class MyApp : public wxApp { public: // Called on application startup virtual bool OnInit(); }; // Declare our main frame class class MyFrame : public wxFrame { public: // Constructor MyFrame(const wxString& title); // Event handlers void OnQuit(wxCommandEvent& event); void OnAbout(wxCommandEvent& event); private: // This class handles events DECLARE_EVENT_TABLE() }; // Implements MyApp& GetApp() DECLARE_APP(MyApp) // Give wxWidgets the means to create a MyApp object IMPLEMENT_APP(MyApp) // Initialize the application bool MyApp::OnInit() { // Create the main application window MyFrame *frame = new MyFrame(wxT("Minimal wxWidgets App")); // Show it frame->Show(true); // Start the event loop return true; } // Event table for MyFrame BEGIN_EVENT_TABLE(MyFrame, wxFrame) EVT_MENU(wxID_ABOUT, MyFrame::OnAbout) EVT_MENU(wxID_EXIT, MyFrame::OnQuit) END_EVENT_TABLE() void MyFrame::OnAbout(wxCommandEvent& event) { wxString msg; msg.Printf(wxT("Hello and welcome to %s"), wxVERSION_STRING); wxMessageBox(msg, wxT("About Minimal"), wxOK | wxICON_INFORMATION, this); } void MyFrame::OnQuit(wxCommandEvent& event) { // Destroy the frame Close(); } MyFrame::MyFrame(const wxString& title) : wxFrame(NULL, wxID_ANY, title) { // Set the frame icon SetIcon(wxIcon(mondrian_xpm)); // Create a menu bar wxMenu *fileMenu = new wxMenu; // The “About” item should be in the help menu wxMenu *helpMenu = new wxMenu; helpMenu->Append(wxID_ABOUT, wxT("&About...\tF1"), wxT("Show about dialog")); fileMenu->Append(wxID_EXIT, wxT("E&xit\tAlt-X"), wxT("Quit this program")); // Now append the freshly created menu to the menu bar... wxMenuBar *menuBar = new wxMenuBar(); menuBar->Append(fileMenu, wxT("&File")); menuBar->Append(helpMenu, wxT("&Help")); // ... and attach this menu bar to the frame SetMenuBar(menuBar); // Create a status bar just for fun CreateStatusBar(2); SetStatusText(wxT("Welcome to wxWidgets!")); } So what's happenning? Thanks! P.S.: I installed wxWidgets through wxPack wich afaik comes with everything precomplied and i also added the wxWidgets directory to Global variables-base in Code::Blocks so everything should be correctly set, right?

    Read the article

  • How do i select the preceding nodes of a text node starting from a specific node and not the root no

    - by Rachel
    How do i select the preceding nodes of a text node starting from a specific node whose id i know instead of getting the text nodes from the root node? When i invoke the below piece from a template match of text node, I get all the preceding text nodes from the root. I want to modify the above piece of code to select only the text nodes that appear after the node having a specific id say 123. i.e something like //*[@id='123'] <xsl:template match="text()[. is $text-to-split]"> <xsl:variable name="split-index" as="xsd:integer" select="$index - sum(preceding::text()/string-length(.))"/> <xsl:value-of select="substring(., 1, $split-index - 1)"/> <xsl:copy-of select="$new"/> <xsl:value-of select="substring(., $split-index)"/> </xsl:template> <xsl:variable name="text-to-split" as="text()?" select="descendant::text()[sum((preceding::text(), .)/string-length(.)) ge $index][1]"/> How do i include the condition in places where i use preceding::text inorder to select preceding text nodes relative to the specific node's id which i know?

    Read the article

  • Understanding Microsoft Word Formatting Behavior. Does anyone?

    - by deemer
    This isn't a question about how to do something (well, not directly), but rather an inquiry to see if anyone understands why MS Word behaves the way it does with respect to formatting from a design perspective. This is also admittedly a rant about Word. This is a question that has plagued me, well, every time I open a document in Word, and covers a lot of individual topics, so I'll restrict the discussion here to two concrete behaviors that baffle me. 1) Backspacing over whitespace changes the format of preceding text. This seems to most often occur when the preceding text is a header or list number. The strangest thing about this is the new format of the changed text usually doesn't appear anywhere else in the document. 2) Numbered lists count almost at random. I am working on a document today where the list numbers count as follows: 1, 2, 2, 3, 3. The lettering in the sublists go like this 1: a, 2: a, 2: b c d, 3: e f g, 3: a. Clicking on each number or letter highlights the other numbers or letters that Word thinks it is related to, which are scattered around the document pretty heavily. Attempts to renumber the list have so far proven fruitless, as Word seems to maintain these associations through clipboard copies, etc. Why could this even happen?

    Read the article

  • ASP.NET MVC File Upload Error - "The input is not a valid Base-64 string"

    - by Justin
    Hey all, I'm trying to add a file upload control to my ASP.NET MVC 2 form but after I select a jpg and click Save, it gives the following error: The input is not a valid Base-64 string as it contains a non-base 64 character, more than two padding characters, or a non-white space character among the padding characters. Here's the view: <% using (Html.BeginForm("Save", "Developers", FormMethod.Post, new {enctype = "multipart/form-data"})) { %> <%: Html.ValidationSummary(true) %> <fieldset> <legend>Fields</legend> <div class="editor-label"> Login Name </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.LoginName) %> <%: Html.ValidationMessageFor(model => model.LoginName) %> </div> <div class="editor-label"> Password </div> <div class="editor-field"> <%: Html.Password("Password") %> <%: Html.ValidationMessageFor(model => model.Password) %> </div> <div class="editor-label"> First Name </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.FirstName) %> <%: Html.ValidationMessageFor(model => model.FirstName) %> </div> <div class="editor-label"> Last Name </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.LastName) %> <%: Html.ValidationMessageFor(model => model.LastName) %> </div> <div class="editor-label"> Photo </div> <div class="editor-field"> <input id="Photo" name="Photo" type="file" /> </div> <p> <%: Html.Hidden("DeveloperID") %> <%: Html.Hidden("CreateDate") %> <input type="submit" value="Save" /> </p> </fieldset> <% } %> And the controller: //POST: /Secure/Developers/Save/ [AcceptVerbs(HttpVerbs.Post)] public ActionResult Save(Developer developer) { //get profile photo. var upload = Request.Files["Photo"]; if (upload.ContentLength > 0) { string savedFileName = Path.Combine( ConfigurationManager.AppSettings["FileUploadDirectory"], "Developer_" + developer.FirstName + "_" + developer.LastName + ".jpg"); upload.SaveAs(savedFileName); } developer.UpdateDate = DateTime.Now; if (developer.DeveloperID == 0) {//inserting new developer. DataContext.DeveloperData.Insert(developer); } else {//attaching existing developer. DataContext.DeveloperData.Attach(developer); } //save changes. DataContext.SaveChanges(); //redirect to developer list. return RedirectToAction("Index"); } Thanks, Justin

    Read the article

  • How does CommandManager.RequerySuggested work?

    - by Andrei Rinea
    The MSDN only states that Occurs when the CommandManager detects conditions that might change the ability of a command to execute. However I can't seem to find any traces of how this works, what I should be aware of / avoid etc... Does it just listen for input? (i.e.: mouse moves, keys pressed and so on)

    Read the article

  • Watin - Watin.Core.Exceptions.ElementNotFoundException

    - by potterosa
    I have code that runs that gives me the error : Could not find a 'INPUT (text password textarea hidden) or TEXTAREA' tag containing attribute name with value ________ (It's testing a website) It says it can't find a What reason could it be that it can't find it? It finds others without an issue on other pages, but this page for some odd reason it baulks? How can that be?

    Read the article

  • Enforce numbers in mobile web form

    - by Peter Smit
    I have a simple webform targeted for Opera Mini and Opera Mobile. I'm using just a HTML input element. Now I would like to restrict the element to only have integer numbers. Is there a way to enforce this in this browser (possible even that the phone will have it's number mode on when entering the form)? And if I wanted to allow floats, is something possible then?

    Read the article

  • Editable table view cell

    - by Koning Baard XIV
    I am creating an application. I have to implement a bookmark feature, and adding one should be similar to this: I want editable UITableViewCells for text input. I was wondering if there is an easier way then embedding a UITextField into a UITableViewCell. And if not, can someone explain how I can use the UITextField inside it? Thanks

    Read the article

  • How to retrieve the size of a file before uploading it?

    - by geowa4
    I have an file input tag in my web app. I'd like to check that the file isn't too big before sending it to the server. Of course, I still have validation server side. Is there any way to do this with JavaScript? It must work in IE7+ and FF3+. Thank you. EDIT: somefileinputobject.files[0].filesize works in FF, but not IE.

    Read the article

< Previous Page | 112 113 114 115 116 117 118 119 120 121 122 123  | Next Page >